BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_A14 (869 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29362| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 >SB_29362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 587 Score = 34.3 bits (75), Expect = 0.13 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 1/91 (1%) Frame = +1 Query: 337 ASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFTLRRMFKKYSQ 516 +S A W Y +N+T EN K Q L S + A ++ K + + T RR K ++ Sbjct: 46 SSEASWNYATNLTVENLNKRTQASLTYSAFLEEARKKAKKFDLTKLSNDT-RRQIKMVTE 104 Query: 517 LGVAALPDDQFQALMRTVSG-MESNYPXAKI 606 A+ D Q + V G M+ Y K+ Sbjct: 105 --TASSSDKDVQKTLNDVEGKMDQIYGSGKV 133 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,564,014 Number of Sequences: 59808 Number of extensions: 373878 Number of successful extensions: 989 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 935 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 989 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2491217872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -