BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_A13 (1026 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 25 0.94 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 25 0.94 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 25 0.94 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 25 0.94 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 25 0.94 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 25 0.94 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 25 0.94 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 25 0.94 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 24 2.2 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 23 5.0 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 22 8.8 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 25.0 bits (52), Expect = 0.94 Identities = 10/27 (37%), Positives = 11/27 (40%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXPXGG 232 PP + PP P P P P P G Sbjct: 39 PPACYSPPQVAPQYPQHPYAAPAPGHG 65 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 25.0 bits (52), Expect = 0.94 Identities = 10/27 (37%), Positives = 11/27 (40%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXPXGG 232 PP + PP P P P P P G Sbjct: 39 PPACYSPPQVAPQYPQHPYAAPAPGHG 65 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 25.0 bits (52), Expect = 0.94 Identities = 10/27 (37%), Positives = 11/27 (40%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXPXGG 232 PP + PP P P P P P G Sbjct: 39 PPACYSPPQVAPQYPQHPYAAPAPGHG 65 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 25.0 bits (52), Expect = 0.94 Identities = 10/27 (37%), Positives = 11/27 (40%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXPXGG 232 PP + PP P P P P P G Sbjct: 39 PPACYSPPQVAPQYPQHPYAAPAPGHG 65 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 25.0 bits (52), Expect = 0.94 Identities = 10/27 (37%), Positives = 11/27 (40%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXPXGG 232 PP + PP P P P P P G Sbjct: 39 PPACYSPPQVAPQYPQHPYAAPAPGHG 65 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 25.0 bits (52), Expect = 0.94 Identities = 10/27 (37%), Positives = 11/27 (40%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXPXGG 232 PP + PP P P P P P G Sbjct: 39 PPACYSPPQVAPQYPQHPYAAPAPGHG 65 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 25.0 bits (52), Expect = 0.94 Identities = 10/27 (37%), Positives = 11/27 (40%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXPXGG 232 PP + PP P P P P P G Sbjct: 39 PPACYSPPQVAPQYPQHPYAAPAPGHG 65 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 25.0 bits (52), Expect = 0.94 Identities = 10/27 (37%), Positives = 11/27 (40%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXPXGG 232 PP + PP P P P P P G Sbjct: 39 PPACYSPPQVAPQYPQHPYAAPAPGHG 65 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 23.8 bits (49), Expect = 2.2 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -3 Query: 430 PPPPPPP 410 PPPPPPP Sbjct: 731 PPPPPPP 737 Score = 23.8 bits (49), Expect = 2.2 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 429 PPPPPPP 409 PPPPPPP Sbjct: 731 PPPPPPP 737 Score = 23.8 bits (49), Expect = 2.2 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +3 Query: 834 PPPPPPP 854 PPPPPPP Sbjct: 731 PPPPPPP 737 Score = 23.8 bits (49), Expect = 2.2 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 835 PPPPPPP 855 PPPPPPP Sbjct: 731 PPPPPPP 737 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 22.6 bits (46), Expect = 5.0 Identities = 10/27 (37%), Positives = 10/27 (37%) Frame = -3 Query: 733 GPPPPPXGXXXXGXPXGPGXPXAPXAP 653 GP PP G P P P P P Sbjct: 161 GPALPPTGFLCNNYPPLPQVPPLPLPP 187 Score = 22.6 bits (46), Expect = 5.0 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 Query: 896 PPXPPXXPXPXPPPXP 943 PP P P P PP P Sbjct: 175 PPLPQVPPLPLPPIFP 190 Score = 22.2 bits (45), Expect = 6.6 Identities = 11/36 (30%), Positives = 11/36 (30%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXP 920 P P P PP P P P PP P Sbjct: 155 PSIIDPGPALPPTGFLCNNYPPLPQVPPLPLPPIFP 190 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 21.8 bits (44), Expect = 8.8 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGG 494 GG GGG G GGG Sbjct: 92 GGGRGGGRDGDRGDGGG 108 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.310 0.152 0.543 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,988 Number of Sequences: 336 Number of extensions: 5151 Number of successful extensions: 19 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 122,585 effective HSP length: 58 effective length of database: 103,097 effective search space used: 29176451 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 43 (21.9 bits)
- SilkBase 1999-2023 -