BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_A13 (1026 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 40 4e-04 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 28 0.006 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 36 0.012 SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex p... 35 0.021 SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr... 34 0.028 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 34 0.037 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 33 0.049 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 33 0.049 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 33 0.065 SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||M... 32 0.11 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 32 0.15 SPCC830.07c |psi1|psi|DNAJ domain protein Psi1|Schizosaccharomyc... 29 1.1 SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|S... 28 2.4 SPBC543.02c |||DNAJ/TPR domain protein DNAJC7 family|Schizosacch... 27 3.2 SPAC26A3.16 |dph1|ucp5|UBA domain protein Dph1|Schizosaccharomyc... 27 4.3 SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyc... 27 5.7 SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1... 27 5.7 SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pomb... 26 9.9 SPBC557.04 |ppk29||Ark1/Prk1 family protein kinase Ppk29|Schizos... 26 9.9 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 26 9.9 SPAC57A7.04c |pabp||mRNA export shuttling protein |Schizosacchar... 26 9.9 SPAC1D4.11c |lkh1|kic1|dual specificity protein kinase Lkh1|Schi... 26 9.9 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 40.3 bits (90), Expect = 4e-04 Identities = 17/35 (48%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Frame = +2 Query: 875 RXPPPXPP----PXPPXXPXPXPPPXPXXGXAPPP 967 + PPP PP P P P P PPP P G PPP Sbjct: 730 KSPPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPP 764 Score = 38.7 bits (86), Expect = 0.001 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = +3 Query: 465 PXTPXXXGPPPPPXP---XXXXPPPPPXPP 545 P P GPPPPP P PPPPP PP Sbjct: 753 PPAPIMGGPPPPPPPPGVAGAGPPPPPPPP 782 Score = 37.1 bits (82), Expect = 0.004 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPPP P PPP P PP P A PP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPP 776 Score = 35.5 bits (78), Expect = 0.012 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 PP P P PPP P PPPPP PP Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPP 768 Score = 32.7 bits (71), Expect = 0.086 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P+ P PPPPPP A P PPP P AP P P Sbjct: 756 PIMGGPPPPPPPPGVAG----AGPPPPPPPPPAVSAGGSRYYAPAPQAEPEP 803 Score = 31.1 bits (67), Expect = 0.26 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -3 Query: 487 PXXXGVXGXPXPXXXGGXXPPPPPPP 410 P G P P G PPPPPPP Sbjct: 756 PIMGGPPPPPPPPGVAGAGPPPPPPP 781 Score = 30.7 bits (66), Expect = 0.35 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 494 PPPXPRXXXPXPPPXPXPXPXP 559 PPP P P P P P P P P Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPP 754 Score = 30.7 bits (66), Expect = 0.35 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPP----XXPPPPPXXP 205 P P P P+ PPP PP PPPPP P Sbjct: 744 PAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPP 782 Score = 30.7 bits (66), Expect = 0.35 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 467 PHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 P P GP PPP P PP P P P P Sbjct: 754 PAPIMGGPPPPPPPPGVAGAGPPPP-PPPPP 783 Score = 30.3 bits (65), Expect = 0.46 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +3 Query: 816 LXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 L P PPPP P P P P PP A PPP Sbjct: 728 LLKSPPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPP 778 Score = 29.9 bits (64), Expect = 0.61 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +3 Query: 492 PPPPXPXXXXPPPPPXPPXXPXPXXV 569 PPPP P P P P P P P + Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPI 757 Score = 29.9 bits (64), Expect = 0.61 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P P P P P PPP PP PP P PPPA Sbjct: 744 PAPAPIPVPPPAPIMGGPP---PPPPPPGVAGAGPPPPP----PPPPA 784 Score = 29.5 bits (63), Expect = 0.80 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 881 PPPXPPPXP---PXXPXPXPPPXPXXGXAPPP 967 P P PPP P P P PP G PPP Sbjct: 748 PIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPP 779 Score = 29.5 bits (63), Expect = 0.80 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -3 Query: 730 PPPPPXGXXXXGXPXGPGXPXAPXAPXAR 644 PPPPP G G P P P A A +R Sbjct: 763 PPPPPPGVAGAGPPPPPPPPPAVSAGGSR 791 Score = 29.5 bits (63), Expect = 0.80 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 460 PXPXXXGGXXPPPPPPP 410 P P G PPPPPPP Sbjct: 766 PPPGVAGAGPPPPPPPP 782 Score = 29.1 bits (62), Expect = 1.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PPPPP P P P P P P Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAP 756 Score = 28.3 bits (60), Expect = 1.9 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXG-PXPPPXPRXXXPXPPPXPXP 547 PP A P P P PPP P P PPP P P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGP-PPPPPPP 768 Score = 28.3 bits (60), Expect(2) = 0.23 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 460 PXPXXXGGXXPPPPPPP 410 P P G PPPPPPP Sbjct: 752 PPPAPIMGGPPPPPPPP 768 Score = 27.9 bits (59), Expect = 2.4 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +2 Query: 98 PPXPXPXXXFXXX---PLFXXPP-PXWXPPXXPPPPPXXPXXXPXP 223 PP P P P+ PP P P PPPPP P P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPP 777 Score = 27.9 bits (59), Expect = 2.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -1 Query: 486 PXXXGXGXXRAPXXXGGXXPPPPPPP 409 P G P G PPPPPPP Sbjct: 756 PIMGGPPPPPPPPGVAGAGPPPPPPP 781 Score = 27.5 bits (58), Expect = 3.2 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPP--PXPPXXPXPXXV 569 P P P P P P PP P PP P P V Sbjct: 734 PPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGV 770 Score = 27.1 bits (57), Expect = 4.3 Identities = 15/51 (29%), Positives = 15/51 (29%), Gaps = 1/51 (1%) Frame = -3 Query: 430 PPPPPPPXXXXVXCXXXXXXXXXXXXXXXXXXXXPX-GFXGXGGPPXPXPP 281 PPPPPP P G G G PP P PP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPP 782 Score = 27.1 bits (57), Expect = 4.3 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -1 Query: 453 PXXXGGXXPPPPPPP 409 P G PPPPPPP Sbjct: 768 PGVAGAGPPPPPPPP 782 Score = 26.2 bits (55), Expect = 7.5 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 467 PHPXXXGPXPPPXPRXXXPXPPPXPXPXPXPXXXXFXXXGGGGXP 601 P P P P P P P PPP P P G G P Sbjct: 735 PPPAVIVPTPAPAP---IPVPPPAPIMGGPPPPPPPPGVAGAGPP 776 Score = 25.8 bits (54), Expect = 9.9 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -1 Query: 453 PXXXGGXXPPPPPPP 409 P G PPPPPPP Sbjct: 754 PAPIMGGPPPPPPPP 768 Score = 21.4 bits (43), Expect(2) = 0.23 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 307 GGPPXPXPPG 278 G PP P PPG Sbjct: 760 GPPPPPPPPG 769 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 28.3 bits (60), Expect(2) = 0.006 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 829 PXPPPPPPPXXP 864 P PPPPPPP P Sbjct: 236 PAPPPPPPPTLP 247 Score = 27.9 bits (59), Expect = 2.4 Identities = 21/75 (28%), Positives = 25/75 (33%), Gaps = 9/75 (12%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPP--------XPPXXPXX 926 P +P + L PPPPPPP +A P P P Sbjct: 168 PPSFQPPSAAAPATSLPSDYNPPPPPPPPPAVEDQAADANEPDDYYSSGRAVSPEIPPTY 227 Query: 927 XPPRA-PRXAXXPPP 968 P +A P A PPP Sbjct: 228 TPKQADPLPAPPPPP 242 Score = 27.1 bits (57), Expect = 4.3 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPP 545 P P P PPPPP PP Sbjct: 173 PPSAAAPATSLPSDYNPPPPPPPP 196 Score = 27.1 bits (57), Expect(2) = 0.006 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 814 PXXXPPXPPPPPPP 855 P P PPPPPPP Sbjct: 184 PSDYNPPPPPPPPP 197 Score = 27.1 bits (57), Expect = 4.3 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXP 943 P PP P P P PPP P Sbjct: 221 PEIPPTYTPKQADPLPAPPPPPPP 244 Score = 26.2 bits (55), Expect = 7.5 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +3 Query: 828 PXPPPPPPP 854 P PPPPPPP Sbjct: 236 PAPPPPPPP 244 Score = 25.8 bits (54), Expect = 9.9 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = +3 Query: 843 PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P +A P PPP PP PP++ + P P+ Sbjct: 221 PEIPPTYTPKQADPLPAPPPPPPP---TLPPQSTNTSQLPMPS 260 Score = 25.8 bits (54), Expect = 9.9 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXP 943 P PPP PP PP P P Sbjct: 236 PAPPPPPPPTLPPQSTNTSQLPMP 259 Score = 23.8 bits (49), Expect(2) = 4.0 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +3 Query: 501 PXPXXXXPPPPPXPP 545 P P PPPP PP Sbjct: 234 PLPAPPPPPPPTLPP 248 Score = 21.4 bits (43), Expect(2) = 4.0 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +3 Query: 522 PPPPPXPPXXPXP 560 PPPP P P P Sbjct: 273 PPPPATPSQPPRP 285 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 35.5 bits (78), Expect = 0.012 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P P P P P PPP P P PP AP PP Sbjct: 145 PRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPP 196 Score = 27.5 bits (58), Expect = 3.2 Identities = 18/66 (27%), Positives = 21/66 (31%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRX 950 PR P P+ P PP P + PP P P PP P+ Sbjct: 145 PRPSIPPPSPASAPPI---PSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPK- 200 Query: 951 AXXPPP 968 PPP Sbjct: 201 -VPPPP 205 Score = 27.1 bits (57), Expect = 4.3 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPR-XAXXPPPA 971 PP P A P PP P P +AP + PPPA Sbjct: 130 PPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPA 175 Score = 27.1 bits (57), Expect = 4.3 Identities = 14/49 (28%), Positives = 15/49 (30%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 P PP P A P PP PP P PP+A Sbjct: 139 PPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSA 187 Score = 25.8 bits (54), Expect = 9.9 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPP 934 PPP PP P P PP Sbjct: 5 PPPPPPAPAPAAAAPAPP 22 >SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex protein Gar1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 194 Score = 34.7 bits (76), Expect = 0.021 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 RGG G GG G GG GG GGG RG Sbjct: 144 RGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRG 176 Score = 33.5 bits (73), Expect = 0.049 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 A GG RG RGG G G GG G GG GG RG Sbjct: 135 AGRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRGGSRG 188 Score = 31.5 bits (68), Expect = 0.20 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG G+RGG GG GGG G GG GG RG Sbjct: 141 GGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRGGSRGGFRG 192 >SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 34.3 bits (75), Expect = 0.028 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG G RGG G G GGG G AR GG GG G Sbjct: 16 GGRGGFNGGRGGFGGGRGGARGGG--RGGARGGRGGRGGARGGRGG 59 Score = 33.9 bits (74), Expect = 0.037 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG GARGG G GG GG G AR GG GG G Sbjct: 26 GGFGGGRGGARGGGRGGARGGRGG---RGGARGGRGGSSGGRGGAKG 69 Score = 32.7 bits (71), Expect = 0.086 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGG-GXRG 871 RGG G GGG G GG GG GG G RG Sbjct: 18 RGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRG 51 Score = 32.3 bits (70), Expect = 0.11 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXG-GGGGGGXGXXXRG 812 GG RG GG G GG GG G G GG GG G G Sbjct: 19 GGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGG 70 Score = 31.9 bits (69), Expect = 0.15 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 RGG G GG G G GG GG GGG G Sbjct: 11 RGGSRGGRGGFNGGRG-GFGGGRGGARGGGRGG 42 Score = 30.7 bits (66), Expect = 0.35 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G GG G G G GGG GG G Sbjct: 16 GGRGGFNGGRGGFGGGRGGARGGGRGGARGG 46 Score = 30.3 bits (65), Expect = 0.46 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 946 RGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 RG RGG G G GG G R GG GG G RG Sbjct: 8 RGGRGGSRGGRGGFNGGRGGFGGGR-GGARGGGRGGARGGRGGRG 51 Score = 29.1 bits (62), Expect = 1.1 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 GG RG RGG G GG GGG G AR GGG GG Sbjct: 9 GGRGGSRGGRGGFNGGR-GGFGGGR--GGAR-------GGGRGG 42 Score = 28.3 bits (60), Expect = 1.9 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGG 896 A GGG RG RGG G GG GG Sbjct: 35 ARGGGRGGARGGRGG-RGGARGGRGG 59 Score = 25.8 bits (54), Expect = 9.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G GG GG G G GG G G G Sbjct: 16 GGRGGFNGGRGGFGGGRGGARGGGRGGARG 45 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 33.9 bits (74), Expect = 0.037 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXP--PPPPXPP 545 P PPPPP P P PPPP PP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 33.9 bits (74), Expect = 0.037 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXP 554 PPPPP P PP P PP P Sbjct: 9 PPPPPPPPGFEPPSQPPPPPPP 30 Score = 33.5 bits (73), Expect = 0.049 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXG 952 P PP PPP P P PPP P G Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPPG 31 Score = 31.1 bits (67), Expect = 0.26 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 152 PPPXWXPPXXPPPPP 196 PPP + PP PPPPP Sbjct: 14 PPPGFEPPSQPPPPP 28 Score = 30.3 bits (65), Expect = 0.46 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPP 911 PPPPPPP P PPP PP Sbjct: 9 PPPPPPPPGFEP----PSQPPPPPPP 30 Score = 29.5 bits (63), Expect = 0.80 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 486 GPPPPPXPXXXXPPPPPXPPXXP 554 G PPPP P PP PP P Sbjct: 7 GNPPPPPPPPGFEPPSQPPPPPP 29 Score = 28.7 bits (61), Expect = 1.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PP PP PP P PP P PPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPP--PPPPP 30 Score = 28.3 bits (60), Expect = 1.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPP 536 P P PPP P PPPPP Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPPP 29 Score = 27.5 bits (58), Expect = 3.2 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 814 PXXXPPXPPPPPPP 855 P PP PPPPPP Sbjct: 16 PGFEPPSQPPPPPP 29 Score = 26.6 bits (56), Expect = 5.7 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +2 Query: 158 PXWXPPXXPPPPPXXPXXXPXP 223 P PP PPPP P P P Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPP 26 Score = 26.6 bits (56), Expect = 5.7 Identities = 11/20 (55%), Positives = 11/20 (55%), Gaps = 3/20 (15%) Frame = +1 Query: 814 PXXXPPXPPPPP---PPXXP 864 P PP PPPPP PP P Sbjct: 5 PPGNPPPPPPPPGFEPPSQP 24 Score = 26.2 bits (55), Expect = 7.5 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 3/26 (11%) Frame = +2 Query: 155 PPXWXPPXXPPP---PPXXPXXXPXP 223 PP PP PPP PP P P P Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 33.5 bits (73), Expect = 0.049 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -2 Query: 968 GGGXXGPPXGXGGVXGGXXXXXXXXXXXXXXXXAXGXXGG--GGGGGXGGXXXG 813 GGG GPP G GG GG G GG GG GG GG G Sbjct: 194 GGGSGGPPPGPGG-FGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGG 246 Score = 31.1 bits (67), Expect = 0.26 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGP 485 G GG GGG G G GG GGP Sbjct: 249 GGLGGFGGGPGGFGGGPGGHGGP 271 Score = 29.5 bits (63), Expect = 0.80 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG G GG G GG GGG G GGG GG G Sbjct: 227 GGGPGGFEGGPGGFGGGP-GGFGGGL--GGFGGGPGGFGGGPGGHGG 270 Score = 29.5 bits (63), Expect = 0.80 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGG 883 GGG G GG G G GG GGG GG Sbjct: 241 GGGPGGFGGGLGGFGGGP-GGFGGGPGG 267 Score = 28.7 bits (61), Expect = 1.4 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG G GG G G GG G GG GGG G G Sbjct: 214 GGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGGFGGGLGGFGGGPGGFGGG 264 Score = 27.1 bits (57), Expect = 4.3 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -3 Query: 553 GXXGGXGG-GGGXXXXGXGGGGGPXXXGVXGXP 458 G GG GG GGG G G GG G G P Sbjct: 239 GFGGGPGGFGGGLGGFGGGPGGFGGGPGGHGGP 271 Score = 27.1 bits (57), Expect = 4.3 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -1 Query: 228 PXGXGXXXGXXGGGGGXXGGXXXGGG 151 P G G G GGG G GG G G Sbjct: 244 PGGFGGGLGGFGGGPGGFGGGPGGHG 269 Score = 26.6 bits (56), Expect = 5.7 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 228 PXGXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 P G G G GGG G GG G G G Sbjct: 237 PGGFGGGPGGFGGGLGGFGGGPGGFGGGPGG 267 Score = 26.2 bits (55), Expect = 7.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGP 484 G G G G GGG G G GG GP Sbjct: 248 GGGLG-GFGGGPGGFGGGPGGHGGP 271 Score = 25.8 bits (54), Expect = 9.9 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 1/61 (1%) Frame = -1 Query: 600 GXPPPPXXXNXXXXGXGXGXGXGGGXGXXXRGXGG-GXGPXXXGXGXXRAPXXXGGXXPP 424 G PPP G G GG G G GG GP G G GG Sbjct: 198 GGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGGFGGGLGGFGGG 257 Query: 423 P 421 P Sbjct: 258 P 258 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 33.5 bits (73), Expect = 0.049 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PP PP PP P PP P A PP Sbjct: 420 PPSLPPSAPPSLPPSAPPSLPMGAPAAPP 448 Score = 33.1 bits (72), Expect = 0.065 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPR-APRXAXXPPP 968 PPPPPP + P PP P PPR AP PPP Sbjct: 337 PPPPPPPRSNAAGSIPL---PPQGRSAPPPPPPRSAPSTGRQPPP 378 Score = 31.5 bits (68), Expect = 0.20 Identities = 36/159 (22%), Positives = 38/159 (23%), Gaps = 7/159 (4%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXXXXRAXGAXGA 668 PPP P P PP P P +P + A Sbjct: 253 PPPIPPPSNGTVSSPPNSPPRPIAPVSMNPAINSTSKPPLPPPSSRVSAAALAA-NKKRP 311 Query: 669 XGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXXXPXPPPPP 848 P P P G G P R A G P PPPPP Sbjct: 312 PPPPPPSRRNRGKPPIGNGSS------NSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPP 365 Query: 849 PPXXXXXXRAXP-------XXXPPPXPPXXPXXXPPRAP 944 P R P PP PP P P P Sbjct: 366 PRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALP 404 Score = 31.5 bits (68), Expect = 0.20 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 P PP P PP PP P PP AP PAA Sbjct: 401 PALPPLGNASRTSTPPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAA 446 Score = 31.5 bits (68), Expect = 0.20 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXP--XPXPPPXPXXGXAPPP 967 P PP PP PP P P PP P PP Sbjct: 425 PSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPP 458 Score = 31.1 bits (67), Expect = 0.26 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 PP P PP + P PP PP P P AP PP A Sbjct: 415 PPVPTPP-------SLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSA 453 Score = 30.7 bits (66), Expect = 0.35 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXP--PRAPRXAXXPPPA 971 PP PP A P P P P P P P A PPPA Sbjct: 432 PPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPA 479 Score = 30.3 bits (65), Expect = 0.46 Identities = 18/54 (33%), Positives = 20/54 (37%), Gaps = 8/54 (14%) Frame = +3 Query: 834 PPPPPPPXXXXXX--------RAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 PPPPPPP R+ P PP P PP + A PPA Sbjct: 337 PPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPA 390 Score = 29.9 bits (64), Expect = 0.61 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 4/32 (12%) Frame = +2 Query: 884 PPXPPPXP--PXXPX--PXPPPXPXXGXAPPP 967 PP PP P P P P PP P APPP Sbjct: 447 PPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPP 478 Score = 29.5 bits (63), Expect = 0.80 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 P PP PP PP PP P PP AP A P A+ Sbjct: 444 PAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPA--PPPAPAPAPAAPVAS 490 Score = 29.1 bits (62), Expect = 1.1 Identities = 17/53 (32%), Positives = 20/53 (37%), Gaps = 8/53 (15%) Frame = +3 Query: 834 PPPPPPPXXXXXXR-------AXPXXXPPPXPPXXPXXXP-PRAPRXAXXPPP 968 PPPPPPP + + PPP PP P P+ PPP Sbjct: 311 PPPPPPPSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPP 363 Score = 29.1 bits (62), Expect = 1.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 P PP PP PP P P P PP Sbjct: 421 PSLPPSAPPSLPPSAPPSLPMGAPAAPPLPP 451 Score = 28.7 bits (61), Expect = 1.4 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 7/60 (11%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXP-----PPXPPXXPXXXP--PRAPRXAXXPPPA 971 P P PP PP A P P PP P P P P AP P PA Sbjct: 424 PPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAPA 483 Score = 28.7 bits (61), Expect = 1.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 887 PXPPPXPPXXPXPXPPPXP 943 P PP PP P P P P P Sbjct: 464 PAAPPLPPAAPAPPPAPAP 482 Score = 28.3 bits (60), Expect = 1.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 PPP PP P PP PPPR Sbjct: 338 PPPPPPRSNAAGSIPLPPQGRSAPPPPPPR 367 Score = 28.3 bits (60), Expect = 1.9 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXP--PPXPPXXPXXXPPRAPRXAXXP-PPAA 974 P P PP PP + P P PP PP P P A A P PPAA Sbjct: 420 PPSLPPSAPPSLPPSAPP---SLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAA 473 Score = 27.9 bits (59), Expect = 2.4 Identities = 23/81 (28%), Positives = 23/81 (28%), Gaps = 2/81 (2%) Frame = -3 Query: 805 PXPPAXGRXXRGXXXXXXXXXXXX--GPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXX 632 P PP R RG PPPPP P P AP P R Sbjct: 312 PPPPPPSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPPR---- 367 Query: 631 XLXVXXXXXXGRXPPPXXXKR 569 GR PPP R Sbjct: 368 -----SAPSTGRQPPPLSSSR 383 Score = 27.1 bits (57), Expect = 4.3 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 4/48 (8%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXP--PPX--WXPPXXPPPPPXXPXXXPXPXG 229 PP P P P P PP P PP PP P P P G Sbjct: 415 PPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAG 462 Score = 27.1 bits (57), Expect = 4.3 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 3/44 (6%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXGPXPPPXPRXXX---PXPPPXPXPXPXP 559 P GA P P PP P P PP P P P P Sbjct: 437 PSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAP 480 Score = 27.1 bits (57), Expect = 4.3 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PP P P P P P P AP P Sbjct: 457 PPLPAGMPAAPPLPPAAPAPPPAPAPAP 484 Score = 26.6 bits (56), Expect = 5.7 Identities = 11/30 (36%), Positives = 11/30 (36%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P P P PP P PP PP P Sbjct: 425 PSAPPSLPPSAPPSLPMGAPAAPPLPPSAP 454 Score = 26.2 bits (55), Expect = 7.5 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXP 943 P P PP P P PPP P Sbjct: 234 PSIPSSRPPERVPSLSAPAPPPIP 257 Score = 26.2 bits (55), Expect = 7.5 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +3 Query: 441 PXXXGXGXPXTPXXXGPPP--PPXPXXXXPPPPPXPPXXPXP 560 P G P P P PP P P PP PP P P Sbjct: 436 PPSLPMGAPAAPPLPPSAPIAPPLPAGM-PAAPPLPPAAPAP 476 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 33.1 bits (72), Expect = 0.065 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 429 GXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 G P G P P PP P P PP PP P P Sbjct: 1177 GIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVP 1220 Score = 31.5 bits (68), Expect = 0.20 Identities = 33/161 (20%), Positives = 33/161 (20%), Gaps = 2/161 (1%) Frame = +3 Query: 492 PPPPXPXXXXP--PPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXXXXRAXGAXG 665 PP P P P P P P P P P G Sbjct: 1022 PPVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSG 1081 Query: 666 AXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXXXPXPPPP 845 A P P G P P P P P P PP Sbjct: 1082 APPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPP 1141 Query: 846 PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP P P AP P P Sbjct: 1142 VPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVP 1182 Score = 31.5 bits (68), Expect = 0.20 Identities = 40/170 (23%), Positives = 43/170 (25%), Gaps = 3/170 (1%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXXXX 644 P P G PP P P P P P P P +P Sbjct: 1074 PSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVP------------KPSVAVPPVPAPSGAP 1121 Query: 645 RA-XGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRP--XAGGXGXXP 815 + A P P G P P P P P A G P Sbjct: 1122 PVPKPSVAAPPVPVPSGAPPVPKP-SVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPP 1180 Query: 816 LXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 + PP PP P PP PP P PP A PP Sbjct: 1181 VPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPP--PSTAPPVPTPSAGLPP 1228 Score = 30.3 bits (65), Expect = 0.46 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 429 GXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 G P P P G PP P P PP P P P Sbjct: 1119 GAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVP 1162 Score = 29.5 bits (63), Expect = 0.80 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 1/45 (2%) Frame = +3 Query: 429 GXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPP-PPPXPPXXPXP 560 G P P P G PP P P PP P P P P Sbjct: 1138 GAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVP 1182 Score = 29.1 bits (62), Expect = 1.1 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXP---PPXPXXGXAPPP 967 P PP P P P P P PP P A PP Sbjct: 1117 PSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPP 1151 Score = 28.7 bits (61), Expect = 1.4 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 1/45 (2%) Frame = +3 Query: 429 GXXPPXXXGXGXPXTPXXX-GPPPPPXPXXXXPPPPPXPPXXPXP 560 G P P P G PP P P PP PP P P Sbjct: 1157 GAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVP 1201 Score = 28.3 bits (60), Expect = 1.9 Identities = 39/188 (20%), Positives = 42/188 (22%), Gaps = 10/188 (5%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPP-PPPXP------PXXPXPXXVRFXXXGGGX 596 PP P P PP P P PPP P P P P G Sbjct: 1032 PPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGI 1091 Query: 597 RPXXXXXXTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPR 776 P + P P G P P P P Sbjct: 1092 PPVPKPSVAAPPVPKP----SVAVPPVPAPSGAPPVPKP-SVAAPPVPVPSGAPPVPKPS 1146 Query: 777 XXRPXAGGXGXXPLXXXPX---PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPR 947 P P P PP P P PP PP P + Sbjct: 1147 VAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVG 1206 Query: 948 XAXXPPPA 971 PPP+ Sbjct: 1207 VPPVPPPS 1214 Score = 27.9 bits (59), Expect = 2.4 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 4/35 (11%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXP----PPXPXXGXAPP 964 P PP P P P P P PP P APP Sbjct: 1088 PSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPP 1122 Score = 26.6 bits (56), Expect = 5.7 Identities = 13/42 (30%), Positives = 14/42 (33%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P+ PP P PP P P P Sbjct: 1121 PPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVP 1162 Score = 26.6 bits (56), Expect = 5.7 Identities = 11/32 (34%), Positives = 12/32 (37%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P+ PP PP P P P PPP Sbjct: 1182 PKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPP 1213 Score = 26.2 bits (55), Expect = 7.5 Identities = 13/42 (30%), Positives = 13/42 (30%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PP P PP P P P Sbjct: 1064 PPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVP 1105 Score = 26.2 bits (55), Expect = 7.5 Identities = 13/42 (30%), Positives = 13/42 (30%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PP P PP P P P Sbjct: 1102 PPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVP 1143 Score = 26.2 bits (55), Expect = 7.5 Identities = 13/44 (29%), Positives = 13/44 (29%) Frame = +3 Query: 429 GXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 G P P G PP P P P P P P P Sbjct: 1187 GVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVP 1230 >SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||Manual Length = 500 Score = 32.3 bits (70), Expect = 0.11 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G GG G G GG GGG G G G Sbjct: 447 GGSRGGRGGFGGRGGFGGRGGFGGGRGRGRGG 478 Score = 27.1 bits (57), Expect = 4.3 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = -3 Query: 967 GGGXXAXRGARGGXXX-GXXGGXGGGXXXG 881 GGG RG GG G GG GGG G Sbjct: 446 GGGSRGGRGGFGGRGGFGGRGGFGGGRGRG 475 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 31.9 bits (69), Expect = 0.15 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 3/44 (6%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPX---PXXXXPPPPPXPPXXPXP 560 PP P PPPPP P PP P PP P P Sbjct: 1690 PPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPP 1733 Score = 31.1 bits (67), Expect = 0.26 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 PP P P PPP P PP P PP Sbjct: 1699 PPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPP 1734 Score = 31.1 bits (67), Expect = 0.26 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXP 943 PPP PP P P PPP P Sbjct: 1716 PPPSAPPMPAGPPSAPPPPLP 1736 Score = 30.7 bits (66), Expect = 0.35 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = +3 Query: 828 PXPPP---PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXA 953 P PPP PPPP P PPP P P R A Sbjct: 1707 PPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNPGDRSA 1751 Score = 29.5 bits (63), Expect = 0.80 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P PP P P PP PP AP PP A Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSA 1730 Score = 29.5 bits (63), Expect = 0.80 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 P P PPPPP P PP PP P G P PPP Sbjct: 1700 PQMSAPTPPPPPMSVPP------------------PPSAPPMPAGPPSAPPP 1733 Score = 29.5 bits (63), Expect = 0.80 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P P PPPP P PP PP P Sbjct: 1707 PPPPPMSVPPPPSAPPMPAGPPSAPPPPLP 1736 Score = 29.1 bits (62), Expect = 1.1 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPPP P PP P P PP P + P Sbjct: 1705 PTPPPPP-----MSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVP 1744 Score = 28.7 bits (61), Expect = 1.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P PPP P PP APPP Sbjct: 1705 PTPPPPPMSVPPPPSAPPMPAGPPSAPPP 1733 Score = 27.9 bits (59), Expect = 2.4 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 PPP P PP P P P PP Sbjct: 1707 PPPPPMSVPPPPSAPPMPAGPPSAPPPP 1734 Score = 27.1 bits (57), Expect = 4.3 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PP PP P P P P PPP Sbjct: 1707 PPPPPMSVPPPPSAPPMPAGPPSAPPPP 1734 Score = 26.6 bits (56), Expect = 5.7 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAP 961 PPP P P P PPP AP Sbjct: 1715 PPPPSAPPMPAGPPSAPPPPLPASSAP 1741 Score = 26.2 bits (55), Expect = 7.5 Identities = 12/28 (42%), Positives = 12/28 (42%), Gaps = 3/28 (10%) Frame = +2 Query: 155 PPXWXPPXXPPPP---PXXPXXXPXPXG 229 PP P PPPP P P P P G Sbjct: 1699 PPQMSAPTPPPPPMSVPPPPSAPPMPAG 1726 >SPCC830.07c |psi1|psi|DNAJ domain protein Psi1|Schizosaccharomyces pombe|chr 3|||Manual Length = 379 Score = 29.1 bits (62), Expect = 1.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGG 883 G A P G GG G G G G G GG Sbjct: 72 GNAAPPPPGAEGGPGAGFGGFPGAGPGG 99 >SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|Schizosaccharomyces pombe|chr 3|||Manual Length = 551 Score = 27.9 bits (59), Expect = 2.4 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -3 Query: 442 GGXXPPPPPPP 410 GG PPPPPPP Sbjct: 303 GGLPPPPPPPP 313 Score = 27.9 bits (59), Expect = 2.4 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -1 Query: 441 GGXXPPPPPPP 409 GG PPPPPPP Sbjct: 303 GGLPPPPPPPP 313 Score = 26.2 bits (55), Expect = 7.5 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +3 Query: 828 PXPPPPPPP 854 P PPPPPPP Sbjct: 306 PPPPPPPPP 314 Score = 26.2 bits (55), Expect = 7.5 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 829 PXPPPPPPP 855 P PPPPPPP Sbjct: 306 PPPPPPPPP 314 >SPBC543.02c |||DNAJ/TPR domain protein DNAJC7 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 476 Score = 27.5 bits (58), Expect = 3.2 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -1 Query: 969 RGGGAXPXXGX-GGGXGXGXXGGXGGGXGGGXRG 871 + GG+ P G GGG G G G GGG G Sbjct: 436 QAGGSFPGGGFPGGGFPGGSYNSQGFGMGGGFPG 469 >SPAC26A3.16 |dph1|ucp5|UBA domain protein Dph1|Schizosaccharomyces pombe|chr 1|||Manual Length = 354 Score = 27.1 bits (57), Expect = 4.3 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 960 GAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 G P GGG G GG GG GG G Sbjct: 217 GIDPMSLMGGGLGGAGLGGLGGAGLGGFGG 246 >SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 26.6 bits (56), Expect = 5.7 Identities = 11/32 (34%), Positives = 12/32 (37%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P PP P P P P P + PP Sbjct: 492 PLPPTTFAPPGVPLPPIPGAPGMPNLNMSQPP 523 >SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1|||Manual Length = 1841 Score = 26.6 bits (56), Expect = 5.7 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 805 GXXPXXXPPXPPPPP 849 G P PP PPPPP Sbjct: 939 GVMPAFPPPPPPPPP 953 Score = 26.2 bits (55), Expect = 7.5 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 826 PPXPPPPPP 852 PP PPPPPP Sbjct: 945 PPPPPPPPP 953 Score = 26.2 bits (55), Expect = 7.5 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 829 PXPPPPPPP 855 P PPPPPPP Sbjct: 945 PPPPPPPPP 953 Score = 25.8 bits (54), Expect = 9.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 826 PPXPPPPPPP 855 P PPPPPPP Sbjct: 942 PAFPPPPPPP 951 >SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 331 Score = 25.8 bits (54), Expect = 9.9 Identities = 12/28 (42%), Positives = 12/28 (42%), Gaps = 4/28 (14%) Frame = +2 Query: 872 PRXPPPXPPPXP----PXXPXPXPPPXP 943 P P P PP P P P P PP P Sbjct: 99 PEEPLPREPPLPNEPVPEEPLPGEPPLP 126 Score = 25.8 bits (54), Expect = 9.9 Identities = 12/28 (42%), Positives = 12/28 (42%), Gaps = 4/28 (14%) Frame = +2 Query: 872 PRXPPPXPPPXP----PXXPXPXPPPXP 943 P P P PP P P P P PP P Sbjct: 115 PEEPLPGEPPLPDEPVPEEPLPGEPPLP 142 >SPBC557.04 |ppk29||Ark1/Prk1 family protein kinase Ppk29|Schizosaccharomyces pombe|chr 2|||Manual Length = 872 Score = 25.8 bits (54), Expect = 9.9 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -3 Query: 460 PXPXXXGGXXPPPPPPP 410 P P G PPPPP P Sbjct: 347 PTPQVQGSRPPPPPPMP 363 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 25.8 bits (54), Expect = 9.9 Identities = 11/33 (33%), Positives = 12/33 (36%) Frame = +3 Query: 843 PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRA 941 PPPP + P PP P PP A Sbjct: 908 PPPPPTASMTASAPAIASPPPPKVGETYHPPTA 940 >SPAC57A7.04c |pabp||mRNA export shuttling protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 653 Score = 25.8 bits (54), Expect = 9.9 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 1/43 (2%) Frame = +3 Query: 417 GGGGGXXPPXXXGXGXPXTPXXXGPPPP-PXPXXXXPPPPPXP 542 G GG P G G P P GP P P P P P Sbjct: 485 GPGGYPIPAAVNGRGMPMVPGHNGPMPMYPGMPTQFPAGGPAP 527 >SPAC1D4.11c |lkh1|kic1|dual specificity protein kinase Lkh1|Schizosaccharomyces pombe|chr 1|||Manual Length = 690 Score = 25.8 bits (54), Expect = 9.9 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 PL P PPP P P P P P PP P Sbjct: 144 PLPVSCQPVLRPPPVPQVPSHWYPVSLPSPNLPHQPISKPPVIP 187 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.310 0.152 0.543 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,382,926 Number of Sequences: 5004 Number of extensions: 47390 Number of successful extensions: 978 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 62 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 540 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 535245848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 43 (21.9 bits)
- SilkBase 1999-2023 -