BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_A13 (1026 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 54 2e-07 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 48 2e-05 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 47 2e-05 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 47 3e-05 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 47 3e-05 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 47 3e-05 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 45 1e-04 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 43 3e-04 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 43 3e-04 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 43 5e-04 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 42 6e-04 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 42 6e-04 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 42 6e-04 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 42 0.001 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 42 0.001 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 41 0.001 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 41 0.001 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 41 0.002 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 40 0.002 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 39 0.006 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 39 0.006 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 38 0.009 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 38 0.013 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 38 0.013 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 38 0.013 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 38 0.013 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 38 0.013 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 38 0.013 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 37 0.030 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 37 0.030 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.030 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.030 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 36 0.040 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 36 0.040 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.040 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.053 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 36 0.053 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.053 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 36 0.053 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 36 0.053 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 36 0.053 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 36 0.053 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 36 0.053 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.053 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.053 SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.070 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.070 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.070 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 36 0.070 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 36 0.070 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.070 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.092 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.092 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 35 0.092 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 35 0.092 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 35 0.12 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 35 0.12 SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 35 0.12 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 35 0.12 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 31 0.13 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) 34 0.16 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 34 0.16 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 34 0.21 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 34 0.21 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 34 0.21 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 34 0.21 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 34 0.21 SB_51094| Best HMM Match : VWA (HMM E-Value=0) 34 0.21 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 34 0.21 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 34 0.21 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 33 0.28 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.28 SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 0.35 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 33 0.37 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 33 0.37 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_55337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_46720| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 33 0.49 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 33 0.49 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) 33 0.49 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 33 0.49 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) 32 0.65 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.65 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 32 0.65 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 32 0.65 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 32 0.65 SB_58050| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.65 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.65 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.86 SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) 32 0.86 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 32 0.86 SB_53480| Best HMM Match : Sigma70_r1_1 (HMM E-Value=5.7) 31 1.1 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) 31 1.1 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 31 1.1 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 31 1.1 SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 31 1.1 SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_5034| Best HMM Match : Extensin_2 (HMM E-Value=0.0055) 31 1.5 SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 31 1.5 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 31 1.5 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 31 1.5 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 31 1.5 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 31 1.5 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.0 SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.0 SB_35308| Best HMM Match : VWA (HMM E-Value=1.1e-20) 31 2.0 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 31 2.0 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.0 SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.0 SB_16908| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.0 SB_15415| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.0 SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.0 SB_47680| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.0 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 31 2.0 SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) 31 2.0 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.0 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 30 2.6 SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_18621| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_56440| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) 30 2.6 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 30 2.6 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) 30 2.6 SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) 30 2.6 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 30 2.6 SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) 30 2.6 SB_40225| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 2.9 SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) 30 3.5 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_34304| Best HMM Match : HR1 (HMM E-Value=3.2) 30 3.5 SB_19562| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_6248| Best HMM Match : KH_1 (HMM E-Value=1.6e-41) 30 3.5 SB_5778| Best HMM Match : Gag_MA (HMM E-Value=1.2) 30 3.5 SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_31266| Best HMM Match : PKI (HMM E-Value=1) 30 3.5 SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 30 3.5 SB_21796| Best HMM Match : COLFI (HMM E-Value=0) 30 3.5 SB_20903| Best HMM Match : Extensin_2 (HMM E-Value=0.3) 30 3.5 SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) 30 3.5 SB_38133| Best HMM Match : TolA (HMM E-Value=0.38) 25 3.7 SB_55442| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 4.4 SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) 29 4.6 SB_51223| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_41312| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_37501| Best HMM Match : SCP (HMM E-Value=1.2e-19) 29 4.6 SB_36777| Best HMM Match : VWA (HMM E-Value=0) 29 4.6 SB_26832| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_3546| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-29) 29 4.6 SB_58047| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_45113| Best HMM Match : CemA (HMM E-Value=6) 29 6.1 SB_38223| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_35820| Best HMM Match : TRAP_240kDa (HMM E-Value=0.006) 29 6.1 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) 29 6.1 SB_25350| Best HMM Match : Collagen (HMM E-Value=0) 29 6.1 SB_23868| Best HMM Match : Gal_Lectin (HMM E-Value=1.4e-05) 29 6.1 SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_13751| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) 29 6.1 SB_58404| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_55443| Best HMM Match : Homeobox (HMM E-Value=2.3e-26) 29 6.1 SB_52268| Best HMM Match : SecA_PP_bind (HMM E-Value=0.33) 29 6.1 SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) 29 6.1 SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) 29 6.1 SB_33704| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) 29 6.1 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_18739| Best HMM Match : YhhN (HMM E-Value=7.3) 29 6.1 SB_14695| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) 29 6.1 SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) 29 6.1 SB_58915| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.0 SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.0 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.0 SB_51163| Best HMM Match : Adeno_PIX (HMM E-Value=0.96) 29 8.0 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 29 8.0 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 29 8.0 SB_31182| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.0 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.0 SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.0 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 29 8.0 SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.0 SB_41601| Best HMM Match : zf-C2H2 (HMM E-Value=0.0019) 29 8.0 SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.0 SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) 29 8.0 SB_28137| Best HMM Match : rve (HMM E-Value=0.00026) 29 8.0 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.0 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.0 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 29 8.0 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 29 8.0 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 29 8.0 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 54.8 bits (126), Expect = 1e-07 Identities = 45/170 (26%), Positives = 45/170 (26%) Frame = +3 Query: 459 GXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXX 638 G P T PP PP P PP PP PP P P P Sbjct: 82 GHPPTNFSPNPPYPPPPY---PPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNA 138 Query: 639 XXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPL 818 P P P P P P P P Sbjct: 139 PYPPSPNAPYPPPPNPPYPPPLYPPPPN---PPPPNAPYPPPPYPPPPNP--------PY 187 Query: 819 XXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPP P PPP P P PP AP PPP Sbjct: 188 PPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPP 237 Score = 52.8 bits (121), Expect = 4e-07 Identities = 42/169 (24%), Positives = 42/169 (24%) Frame = +3 Query: 429 GXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXX 608 G PP P P P PPP P PPPP PP P P P Sbjct: 81 GGHPPTNFSPNPPYPPPPYPPYPPPPPY----PPPPNPPYPPPP--------NAPYPPPP 128 Query: 609 XXXXTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRP 788 P P P P P P P Sbjct: 129 NPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYP 188 Query: 789 XAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPP 935 P P PPPP PP P PPP P P PP Sbjct: 189 PPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPP 237 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 P PPPP PP P P P PP P PP P PPP A Sbjct: 93 PYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPP---YPPPPNA 138 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP PP PP P P PP P PPP Sbjct: 147 PYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPP 178 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PP PPP PP P P PP P PPP Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPPYPPPP 120 Score = 37.9 bits (84), Expect = 0.013 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPP----PXPXXGXAPPP 967 P PPP PP PP P P PP P P PPP Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPP 127 Score = 37.9 bits (84), Expect = 0.013 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P PP PPPP P PPP P P PP P PP+ Sbjct: 93 PYPPPPYPPYPPPPPYPPPPN--PPYPPPPNAPYPPPPNPPYPPPPNAPYPPS 143 Score = 37.9 bits (84), Expect = 0.013 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXX-PXXXPPRAPRXAXXPPPAA 974 P P PPPP PP P P PP P PP P PPP A Sbjct: 118 PPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNA 172 Score = 36.7 bits (81), Expect = 0.030 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPP--PXXPXXXPXP 223 P P P + P PPP + PP PPPP P P P P Sbjct: 139 PYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPP 182 Score = 35.9 bits (79), Expect = 0.053 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPP-PPPXXPXXXPXP 223 PP P P PPP + PP PP PPP P P P Sbjct: 157 PPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPP 199 Score = 33.9 bits (74), Expect = 0.21 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P P + PP PPPP P P P Sbjct: 134 PPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYP 175 Score = 33.9 bits (74), Expect = 0.21 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPP-PXWXPPXXP--PPPPXXPXXXP 217 PP P P P + PP P + PP P PPPP P P Sbjct: 164 PPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPP 206 Score = 33.1 bits (72), Expect = 0.37 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPP--PXWXPPXXPPPPPXXPXXXPXP 223 P P P + P + PP P PP P PPP P P P Sbjct: 93 PYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPP 136 Score = 32.7 bits (71), Expect = 0.49 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 PP P P P PP P P PPP P P P Sbjct: 95 PPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPP 135 Score = 32.7 bits (71), Expect = 0.49 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPPXXP-PPPPXXPXXXP 217 P P P PL+ PPP PP P PPPP P P Sbjct: 147 PYPPPPNPPYPPPLYP-PPPNPPPPNAPYPPPPYPPPPNP 185 Score = 32.7 bits (71), Expect = 0.49 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 440 PXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 P A P P P PP P P PPP P P P Sbjct: 167 PPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPP 206 Score = 32.3 bits (70), Expect = 0.65 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXP-PPPPXXPXXXP 217 PP P P P + PPP PP P PPPP P P Sbjct: 92 PPYPPPPY-----PPYPPPPPYPPPPNPPYPPPPNAPYPPP 127 Score = 32.3 bits (70), Expect = 0.65 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPP-PPPXXPXXXPXP 223 PP P P P PPP P PP PPP P P P Sbjct: 149 PPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPP 191 Score = 31.9 bits (69), Expect = 0.86 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 113 PXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P F P + PP PP P PPP P P P Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPP 120 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P P + P PPP PP PPP P P P Sbjct: 186 PYPPPPNPPYPPPPNAPNPPPP-NPPYPPPPNAPNPPYPPPP 226 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = +2 Query: 440 PXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXP-XPXPXPXXXXF 574 P A P P P PP P P PP P P P P F Sbjct: 196 PPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNPQF 241 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P + PP PP PPP P P P Sbjct: 196 PPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPP 237 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPP-PPPXPP 545 P P PP PP P PP PPP P Sbjct: 212 PPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P P + P PP P PP PP P P P Sbjct: 123 PYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPP 164 Score = 29.5 bits (63), Expect = 4.6 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWX----PPXXPPPPPXXPXXXPXP 223 P P P + P PPP PP P PPP P P P Sbjct: 170 PNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPP 215 Score = 28.7 bits (61), Expect = 8.0 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P + PP PP PP P P P Sbjct: 180 PPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPP 221 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 54.0 bits (124), Expect = 2e-07 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PPPPPPP P PPP PP P PP P A PPP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 53.2 bits (122), Expect = 3e-07 Identities = 22/52 (42%), Positives = 23/52 (44%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PPPPPPP + P PPP PP P PP P PPP Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 50.4 bits (115), Expect = 2e-06 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPP PP P PPP PP P PP AP PPP Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 49.2 bits (112), Expect = 5e-06 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPPPP P PPP PP P PP P PPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 49.2 bits (112), Expect = 5e-06 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPPP P PPPPP PP P P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 49.2 bits (112), Expect = 5e-06 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PPPPPP P PPP PP P PP P PPP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 49.2 bits (112), Expect = 5e-06 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PPP PPP P PPP PP P PP P PPP Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 48.8 bits (111), Expect = 7e-06 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PPPPPPP PPP PP P PP P PPP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 48.8 bits (111), Expect = 7e-06 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P P PPPPPPP P P P PP P PP A R A PP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 48.4 bits (110), Expect = 9e-06 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPPPPP P P P PP P PP P PPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 48.4 bits (110), Expect = 9e-06 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPPPPP P PP PP P PP P PPP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 48.4 bits (110), Expect = 9e-06 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPPPPP P PPP P P PP P PPP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 48.4 bits (110), Expect = 9e-06 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPPPPP P PPP P P PP P PPP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 48.4 bits (110), Expect = 9e-06 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPPPP P PPP PP P PP P PPP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 48.4 bits (110), Expect = 9e-06 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPPP P PPPPP PP P P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 48.4 bits (110), Expect = 9e-06 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP PPP PP P P PPP P PPP Sbjct: 401 PPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P PPP PPP + P PP PP P PP P PPPA Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPA 419 Score = 47.6 bits (108), Expect = 2e-05 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPPP P PPPPP PP P P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 47.6 bits (108), Expect = 2e-05 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPPP P PPPPP PP P P Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 47.6 bits (108), Expect = 2e-05 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPPP P PPPPP PP P P Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 47.6 bits (108), Expect = 2e-05 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPPP P PPPPP PP P P Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 47.2 bits (107), Expect = 2e-05 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P PPPPP P PPP PP P PP P PPPA Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPA 433 Score = 46.8 bits (106), Expect = 3e-05 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 P P P PPPPP P PPP PP P P P PPP A Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPA 433 Score = 46.4 bits (105), Expect = 4e-05 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P PPPPP P PPPPP PP P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPP 401 Score = 46.0 bits (104), Expect = 5e-05 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVR 572 PP P P PPPPP P PPPP PP P P +R Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALR 435 Score = 45.2 bits (102), Expect = 9e-05 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P +P PPPPP P PPPP PP P P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 45.2 bits (102), Expect = 9e-05 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P P PPP P PPPPP PP P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 45.2 bits (102), Expect = 9e-05 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPPP P PPPPP PP P Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 44.8 bits (101), Expect = 1e-04 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 PPP PPP PP P PPP P PPP+ Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQ 394 Score = 44.8 bits (101), Expect = 1e-04 Identities = 19/34 (55%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXA-PPPR 970 P PPP PPP PP P P PPP P A PPR Sbjct: 409 PPPPPPPPPPAPPPPPPPPPPPPPALRLACAPPR 442 Score = 44.4 bits (100), Expect = 2e-04 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP P PPPPP PP P P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 44.4 bits (100), Expect = 2e-04 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPP P P PPPPP PP P P Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 44.4 bits (100), Expect = 2e-04 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PP PP P PPPPP PP P P Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 44.4 bits (100), Expect = 2e-04 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPPP P PPPPP P P P Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 44.4 bits (100), Expect = 2e-04 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPPP P PP PP PP P P Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 44.4 bits (100), Expect = 2e-04 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPPP P P PPP PP P P Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 44.0 bits (99), Expect = 2e-04 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +3 Query: 453 GXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 G P PPPPP P PPPPP PP P P Sbjct: 360 GINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQP 395 Score = 41.9 bits (94), Expect = 8e-04 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP PP PPPPP P P P Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP PP PPPPP P P P Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPPXXXR 981 P PP P PPPPP P PP P P P PPP R Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALR 435 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P PPPPP P PPPPP P P P Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP PP PPPPP P P P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP PP PPPPP P P P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP PP PPPPP P P P Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP PP PPPPP P P P Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 38.3 bits (85), Expect = 0.010 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PP PP PPPPP P P P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 38.3 bits (85), Expect = 0.010 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXP 217 PP P P P PPP PP PPPPP P P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 38.3 bits (85), Expect = 0.010 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXP 217 PP P P P PPP PP PPPPP P P Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 37.9 bits (84), Expect = 0.013 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPP-PXPPXXPXP 560 P P PPPP P PPPP P PP P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPP 397 Score = 37.9 bits (84), Expect = 0.013 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP PP PPPP P P P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 37.9 bits (84), Expect = 0.013 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP PP PPPPP P P Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 37.5 bits (83), Expect = 0.017 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP PP P PPP P P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 37.5 bits (83), Expect = 0.017 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP PP PPPPP P P Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 37.5 bits (83), Expect = 0.017 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP PP P PPP P P P Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXP 205 PP P P P PPP PP PPPPP P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 36.7 bits (81), Expect = 0.030 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRF 575 PP P P PP PP P PPPPP P +RF Sbjct: 400 PPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPPRLRF 445 Score = 35.9 bits (79), Expect = 0.053 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXP 217 PP P P P PPP PP PPPPP P P Sbjct: 395 PPPPPPPPPPPPPP--PPPPPPPPPPAPPPPPPPPPPPPP 432 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 49.6 bits (113), Expect = 4e-06 Identities = 35/106 (33%), Positives = 36/106 (33%), Gaps = 1/106 (0%) Frame = -3 Query: 733 GPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXXXXXXGRXPPPXXXKRTXXGX 554 G PPP G P G G P P A G PPP + G Sbjct: 491 GQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQ-PPPGAGQGGGPPPPGAGQ---GGG 546 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGV-XGXPXPXXXGGXXPPPP 419 G G G G G G GGGP G G P P G PPPP Sbjct: 547 PPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPP 592 Score = 49.2 bits (112), Expect = 5e-06 Identities = 47/147 (31%), Positives = 48/147 (32%), Gaps = 2/147 (1%) Frame = -3 Query: 853 GGGGGGGXGXXXRGXXPXPPAXGRXXRGXXXXXXXXXXXXGPPPPPXGXXXXGXPXGPGX 674 GGG G G G PP G G GPPPP G P G G Sbjct: 485 GGGQGWGQPPPGAGQGGGPPPPGAGQGG------------GPPPPGAGQGWGQPPPGAGQ 532 Query: 673 PXAPXAPXARXXXXXLXVXXXXXXGRXPPPXXXKRTXXGXGXXG-GXGGGGGXXXXGXGG 497 P P A G PPP + G G G G GGG G G Sbjct: 533 GGGPPPPGA------------GQGGGPPPPGAGQ----GWGQPPPGAGQGGGPPPPGAGQ 576 Query: 496 GGGPXXX-GVXGXPXPXXXGGXXPPPP 419 GG P G G P P G PPPP Sbjct: 577 GGPPPPGAGQEGPPPPGAGQGGGPPPP 603 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/62 (37%), Positives = 24/62 (38%) Frame = -1 Query: 600 GXPPPPXXXNXXXXGXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGGXXPPP 421 G PPPP G G GGG G GGG P G G + P G PP Sbjct: 512 GGPPPPGAGQGWGQPP-PGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPP 570 Query: 420 PP 415 PP Sbjct: 571 PP 572 Score = 41.9 bits (94), Expect = 8e-04 Identities = 28/88 (31%), Positives = 28/88 (31%), Gaps = 3/88 (3%) Frame = +3 Query: 279 PGGXGXG-GPPXPXNPXGXXXXXXXXXXXXXXXXXXXXQXTXXXXGGGGGGGXXPPXXXG 455 P G G G G P P G Q G G GG PP G Sbjct: 516 PPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAG 575 Query: 456 XGXPXTP--XXXGPPPPPXPXXXXPPPP 533 G P P GPPPP PPPP Sbjct: 576 QGGPPPPGAGQEGPPPPGAGQGGGPPPP 603 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = -1 Query: 600 GXPPPPXXXNXXXXGXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGGXXPPP 421 G PPPP G G G G G G G G GP G G P G PP Sbjct: 534 GGPPPPGAGQG---GGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPP 590 Query: 420 PP 415 PP Sbjct: 591 PP 592 Score = 40.7 bits (91), Expect = 0.002 Identities = 27/87 (31%), Positives = 27/87 (31%), Gaps = 3/87 (3%) Frame = -3 Query: 541 GXGGGGGXXXXGXGGGGGPXXXGV---XGXPXPXXXGGXXPPPPPPPXXXXVXCXXXXXX 371 G G GGG G G GGGP G G P P G PPPP Sbjct: 496 GAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQG 555 Query: 370 XXXXXXXXXXXXXXPXGFXGXGGPPXP 290 P G GGPP P Sbjct: 556 WGQPPPGAGQGGGPPPPGAGQGGPPPP 582 Score = 40.7 bits (91), Expect = 0.002 Identities = 27/87 (31%), Positives = 27/87 (31%), Gaps = 2/87 (2%) Frame = +3 Query: 279 PGGXGXGGPPXPXNPXGXXXXXXXXXXXXXXXXXXXXQXTXXXXGGGGGG-GXXPPXXXG 455 PG GGPP P G Q G G G G PP Sbjct: 506 PGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQ 565 Query: 456 XGXPXTP-XXXGPPPPPXPXXXXPPPP 533 G P P G PPPP PPPP Sbjct: 566 GGGPPPPGAGQGGPPPPGAGQEGPPPP 592 Score = 39.9 bits (89), Expect = 0.003 Identities = 33/116 (28%), Positives = 34/116 (29%), Gaps = 8/116 (6%) Frame = +3 Query: 411 GGGGGGGXXPPXXXGXGXPXTP--XXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXX 584 GGG G G PP G P P G PPPP PPP P Sbjct: 485 GGGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQG 544 Query: 585 GGGXRPXXXXXXTXXXXXXXRAXG----AXGAXGXPGPXGXPXXXXPXGG--GGGP 734 GG P + G G G P P P G GGGP Sbjct: 545 GGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGP 600 Score = 39.9 bits (89), Expect = 0.003 Identities = 32/111 (28%), Positives = 32/111 (28%), Gaps = 3/111 (2%) Frame = +3 Query: 279 PGGXGXGGPPXPXNPXGXXXXXXXXXXXXXXXXXXXXQX--TXXXXGGGGGGGXXPPXXX 452 PG GGPP P G Q G GGG P Sbjct: 495 PGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQ 554 Query: 453 GXGXPXT-PXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRP 602 G G P G PPPP PPPP P P GGG P Sbjct: 555 GWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGA---GQGGGPPP 602 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -1 Query: 546 GXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGGXXPPPPP 415 G G GGG G GGG P G G + P G PPPP Sbjct: 496 GAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPP 539 Score = 37.1 bits (82), Expect = 0.023 Identities = 25/87 (28%), Positives = 25/87 (28%), Gaps = 1/87 (1%) Frame = +3 Query: 279 PGGXGXGGPPXPXNPXGXXXXXXXXXXXXXXXXXXXXQXTXXXXGGGGGGGXXPPXXXGX 458 PG GGPP P G Q G G GG PP Sbjct: 528 PGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQE 587 Query: 459 GXPXT-PXXXGPPPPPXPXXXXPPPPP 536 G P G PPPP PPP Sbjct: 588 GPPPPGAGQGGGPPPPGAGQGWGLPPP 614 Score = 36.7 bits (81), Expect = 0.030 Identities = 27/104 (25%), Positives = 28/104 (26%) Frame = -3 Query: 601 GRXPPPXXXKRTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPP 422 G PPP + G G G G GGG P G G P P G P Sbjct: 500 GGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQP 559 Query: 421 PPPPXXXXVXCXXXXXXXXXXXXXXXXXXXXPXGFXGXGGPPXP 290 PP P G GGPP P Sbjct: 560 PPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPP 603 Score = 36.3 bits (80), Expect = 0.040 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -1 Query: 600 GXPPPPXXXNXXXXGXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGGXXPPP 421 G PP G G GGG G G G P G G P G PPP Sbjct: 522 GWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPP 581 Query: 420 P 418 P Sbjct: 582 P 582 Score = 35.5 bits (78), Expect = 0.070 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -1 Query: 600 GXPPPPXXXNXXXXGXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGGXXPPP 421 G PP G G GGG G G G P G G P G PP Sbjct: 489 GWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPP 548 Query: 420 PP 415 PP Sbjct: 549 PP 550 Score = 35.5 bits (78), Expect = 0.070 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -1 Query: 600 GXPPPPXXXNXXXXGXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGGXXPPP 421 G PPPP G G G G G GGG P G G P G P Sbjct: 501 GGPPPPGAGQGGGPPP-PGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQP 559 Query: 420 PP 415 PP Sbjct: 560 PP 561 Score = 34.3 bits (75), Expect = 0.16 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGV---XGXPXPXXXGGXXPPPP 419 G G G G G G G GGGP G G P P G PPP Sbjct: 481 GKVPGGGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPP 528 Score = 33.9 bits (74), Expect = 0.21 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPPPP 416 GG G G G GGG P G G P P G PPP Sbjct: 486 GGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPP 528 Score = 31.9 bits (69), Expect = 0.86 Identities = 27/98 (27%), Positives = 28/98 (28%), Gaps = 1/98 (1%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPX-PPA 791 G G +GG G GGG A G G G G G PP Sbjct: 522 GWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPP 581 Query: 790 XGRXXRGXXXXXXXXXXXXGPPPPPXGXXXXGXPXGPG 677 G G GPPPP G P G G Sbjct: 582 PGAGQEG--PPPPGAGQGGGPPPPGAGQGWGLPPPGSG 617 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGGXXPPPPP 415 G G G G G G GGG P G G P G PPP Sbjct: 481 GKVPGGGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPP 528 Score = 31.5 bits (68), Expect = 1.1 Identities = 32/111 (28%), Positives = 33/111 (29%), Gaps = 4/111 (3%) Frame = +3 Query: 654 GAXGAXGXPGPXGXPXXXXPXGG---GGGPXXXXXXXXXXXXPRXXRPXAG-GXGXXPLX 821 GA G P P P G GGGP P P AG G G P Sbjct: 507 GAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPP----PGAGQGWGQPPPG 562 Query: 822 XXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 PPPP PPP PP A + PPP A Sbjct: 563 AGQGGGPPPP--------GAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGA 605 Score = 31.5 bits (68), Expect = 1.1 Identities = 31/110 (28%), Positives = 33/110 (30%), Gaps = 3/110 (2%) Frame = +3 Query: 654 GAXGAXGXPGPXGXPXXXXPXGG---GGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXX 824 GA G P P P G GGGP P P AG G P Sbjct: 518 GAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPP----PGAGQGGGPPPPG 573 Query: 825 XPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 PPPP A PPP PP A + PPP + Sbjct: 574 AGQGGPPPPG-------AGQEGPPPPGAGQGGGPPPPGAGQGWGLPPPGS 616 Score = 31.1 bits (67), Expect = 1.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -1 Query: 552 GXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGGXXPPPPPPP 409 G G G G G G G G GP G G P G PPP Sbjct: 481 GKVPGGGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPP 528 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +2 Query: 416 GGGGGXXPPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXP 541 G G G PP + P P G PP P PP P Sbjct: 562 GAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPP 603 Score = 29.9 bits (64), Expect = 3.5 Identities = 23/74 (31%), Positives = 23/74 (31%), Gaps = 6/74 (8%) Frame = -1 Query: 600 GXPPPPXXXNXXXX---GXGXGXGX---GGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXG 439 G PPPP G G G G G G G G GP G G P G Sbjct: 545 GGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPG 604 Query: 438 GXXPPPPPPPXXXL 397 PPP L Sbjct: 605 AGQGWGLPPPGSGL 618 Score = 29.5 bits (63), Expect = 4.6 Identities = 19/68 (27%), Positives = 19/68 (27%), Gaps = 4/68 (5%) Frame = +2 Query: 776 GXXPXRGGGGXXPPXXXXXXXXXXXXXXXXXXPRXPPPXP----PPXPPXXPXPXPPPXP 943 G P G G PP PPP PP P PPP Sbjct: 535 GPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGA 594 Query: 944 XXGXAPPP 967 G PPP Sbjct: 595 GQGGGPPP 602 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 49.6 bits (113), Expect = 4e-06 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +3 Query: 411 GGGGGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 G GGGG PP P P PPP P PPPPP P P P Sbjct: 337 GTSGGGGVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPP 386 Score = 48.0 bits (109), Expect = 1e-05 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 2/57 (3%) Frame = +3 Query: 396 TXXXXGGGGGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP--XPPXXPXP 560 T GGGG PP P P PPPPP PPPPP PP P P Sbjct: 334 TVVGTSGGGGVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPP 390 Score = 45.6 bits (103), Expect = 7e-05 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP---XPPXXPXP 560 PP P P GPPPPP P PPPPP PP P P Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = +3 Query: 795 GGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 GG P PP PPPP P PPP PP PP P PPP Sbjct: 341 GGGVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPP 398 Score = 43.6 bits (98), Expect = 3e-04 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPPP P PPP PP PP P PPP Sbjct: 365 PPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPP 408 Score = 42.3 bits (95), Expect = 6e-04 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP---XPPXXPXP 560 PP P P PPPPP P PPPPP PP P P Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPP 400 Score = 42.3 bits (95), Expect = 6e-04 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 PPPPPPP P PPP PP P PP P PP Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPP--PTNGPPPPPPPTNGPP 415 Score = 42.3 bits (95), Expect = 6e-04 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 PP G P P PPPP P PPPPP P P Sbjct: 376 PPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 414 Score = 42.3 bits (95), Expect = 6e-04 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 PP P P GPPPPP P PPPPP P Sbjct: 377 PPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/59 (35%), Positives = 22/59 (37%) Frame = +3 Query: 792 AGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 +GG G P PP PPP P PP PP P PP P PPP Sbjct: 339 SGGGGVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPP-PPPPPTNGPPPPPPPTNGPPP 396 Score = 37.9 bits (84), Expect = 0.013 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 3/55 (5%) Frame = +1 Query: 814 PXXXPPX---PPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 P PP PPPPPP P P PP P GP PPP Sbjct: 355 PSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 36.7 bits (81), Expect = 0.030 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 3/61 (4%) Frame = +1 Query: 796 GGXGXXPXXXPPXPPPPPPPXX---PXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPP 966 GG G P P PP PPP P PP PP P GP PP Sbjct: 340 GGGGVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPP-PTNGPPPPP 398 Query: 967 P 969 P Sbjct: 399 P 399 Score = 35.5 bits (78), Expect = 0.070 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +2 Query: 872 PRXPP---PXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PP P PPP P P P PPP PPP Sbjct: 376 PPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 34.3 bits (75), Expect = 0.16 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 6/55 (10%) Frame = +2 Query: 413 GGGGGGXXPPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPX------PXPXPXP 559 GGGG PP P P P PPP P PPP P P P Sbjct: 340 GGGGVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGP 394 Score = 33.5 bits (73), Expect = 0.28 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PP PP PPPP P P P Sbjct: 365 PPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPP 406 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAP 961 P P P PPP PP P PP G P Sbjct: 72 PSTPAPPPPPPPPSSGPPLPPSNGKCGRKP 101 Score = 32.7 bits (71), Expect = 0.49 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P PPP PP PPPP P P P Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPP--PPTNKPPPPPPPTNGPPP 386 Score = 32.7 bits (71), Expect = 0.49 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXPXGG 232 PP P P P PPP PP PPPP P P P G Sbjct: 354 PPSPPPPTNNTPPP----PPPTNKPPP-PPPPTNGPPPPPPPTNG 393 Score = 32.7 bits (71), Expect = 0.49 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXPXGG 232 PP P P P PPP PP PPPP P P P G Sbjct: 374 PPPPPPPTNGPPPP----PPPTNGPPP-PPPPTNGPPPPPPPTNG 413 Score = 32.3 bits (70), Expect = 0.65 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 459 GXPXTPXXXGPPPPPXPXXXXPPPPP 536 G P TP PPPPP P PP PP Sbjct: 70 GAPSTP---APPPPPPPPSSGPPLPP 92 Score = 32.3 bits (70), Expect = 0.65 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXPXG 229 PP P P P PP PP PPPP P P G Sbjct: 375 PPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPSEG 418 Score = 31.9 bits (69), Expect = 0.86 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P PPP P PPPPP P P Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPP 407 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P PPP PP PPPP P P P Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPP--PPTNGPPPPPPPTNGPPP 396 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 426 GGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXP 524 G PP P P GPPPPP P P Sbjct: 383 GPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 429 GXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPP 527 G PP G P P PPPP P PP Sbjct: 383 GPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = -3 Query: 508 GXGGGGG--PXXXGVXGXPXPXXXGGXXPPPPPP 413 G GGGG P P P PPPPPP Sbjct: 337 GTSGGGGVNPPPPPTNNPPSPPPPTNNTPPPPPP 370 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 48.4 bits (110), Expect = 9e-06 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +3 Query: 423 GGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 GG PP G P PP PP P PPPPP PP P P Sbjct: 949 GGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 42.3 bits (95), Expect = 6e-04 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +3 Query: 420 GGGGXXPPXXXGXGXPXTPXXXG---PPPPPXPXXXXPPPPPXPPXXPXP 560 GG PP G P P G PPPPP P PPP P P P Sbjct: 927 GGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPP 976 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +3 Query: 420 GGGGXXPPXXXGXGXPXTPXXXGP-PPPPXPXXXXPPPPPXPPXXP 554 GG PP G P P PPPP PPPPP PP P Sbjct: 949 GGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 38.3 bits (85), Expect = 0.010 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +3 Query: 420 GGGGXXPPXXXGXGXPXTPXXXG---PPPPPXPXXXXPPPPPXPPXXPXP 560 GG PP G P P G P PP P PPPPP P P Sbjct: 916 GGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPP 965 Score = 38.3 bits (85), Expect = 0.010 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +3 Query: 786 PXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P P PPPPPPP P PP PP PP P PP Sbjct: 937 PGGSAPSQPPPPGGNAPPPPPPPGGSAPP---PGGGAPPLPPPPGGSAPPPPPPPPPPPP 993 Query: 966 P 968 P Sbjct: 994 P 994 Score = 37.5 bits (83), Expect = 0.017 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 4/68 (5%) Frame = +3 Query: 411 GGGGGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXP----PXXPXPXXVRFX 578 GG PP P P P PPP P P PP P P P P Sbjct: 905 GGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAP 964 Query: 579 XXGGGXRP 602 GGG P Sbjct: 965 PPGGGAPP 972 Score = 36.7 bits (81), Expect(2) = 5e-04 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 532 GGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPPPPPP 410 GG GG P G P P GG PPPPPPP Sbjct: 949 GGNAPPPPPPPGGSAPPPGG-GAPPLPPPPGGSAPPPPPPP 988 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXP--XXXPPRAPRXAXXPPP 968 PPPPPPP P P P P PP P PPP Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPP 966 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 535 GGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPPPPPP 410 GG GG P G P P PPPPPPP Sbjct: 949 GGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPP 990 Score = 34.3 bits (75), Expect = 0.16 Identities = 22/75 (29%), Positives = 22/75 (29%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXPXGGXXXXXLXXEKXXXXX 277 PP P P P PPP P PPPP P P GG Sbjct: 921 PPPPPPGGNAPLPP----PPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPP 976 Query: 278 XGGXXXGGAPGPXKP 322 GG P P P Sbjct: 977 PGGSAPPPPPPPPPP 991 Score = 34.3 bits (75), Expect = 0.16 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 6/68 (8%) Frame = -1 Query: 594 PPPPXXXNXXXXGXGXGXGXG------GGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGGX 433 PPPP N G GG GG P G P G Sbjct: 922 PPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSA 981 Query: 432 XPPPPPPP 409 PPPPPPP Sbjct: 982 PPPPPPPP 989 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PP PPP P P PPP PPP Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPP 947 Score = 32.7 bits (71), Expect = 0.49 Identities = 23/77 (29%), Positives = 23/77 (29%), Gaps = 2/77 (2%) Frame = -3 Query: 502 GGGGGPXXXGVXGX--PXPXXXGGXXPPPPPPPXXXXVXCXXXXXXXXXXXXXXXXXXXX 329 GG P G P P GG P PPPPP Sbjct: 905 GGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAP 964 Query: 328 PXGFXGXGGPPXPXPPG 278 P G G PP P PPG Sbjct: 965 P---PGGGAPPLPPPPG 978 Score = 32.7 bits (71), Expect = 0.49 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPP P PP PP PP PPP Sbjct: 933 PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPP 976 Score = 32.3 bits (70), Expect = 0.65 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +2 Query: 773 PGXXPXRGGGGXXPPXXXXXXXXXXXXXXXXXXPRXPPPXPPPXPPXXPXPXPPPXPXXG 952 P P GG PP P PP P PP P P PPP G Sbjct: 942 PSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPP--PPGGSAPPPPPPPPPPPPPMRKLG 999 Score = 31.9 bits (69), Expect = 0.86 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 3/64 (4%) Frame = +3 Query: 786 PXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXP---XXXPPPXPPXXPXXXPPRAPRXAX 956 P G P P PPPP P PPP PP PP Sbjct: 914 PPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPL 973 Query: 957 XPPP 968 PPP Sbjct: 974 PPPP 977 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PP P PPPP P P P Sbjct: 953 PPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 29.1 bits (62), Expect = 6.1 Identities = 17/57 (29%), Positives = 17/57 (29%) Frame = +3 Query: 798 GXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 G P P PPPP P PPP P PP PPP Sbjct: 905 GGSESPSASPPGGSVPPPPPPPGGNAPLP---PPPPGGSAPSQPPPPGGNAPPPPPP 958 Score = 29.1 bits (62), Expect = 6.1 Identities = 22/77 (28%), Positives = 22/77 (28%), Gaps = 11/77 (14%) Frame = +2 Query: 773 PGXXPXRGGGGXXPPXXXXXXXXXXXXXXXXXXPRXPPPX----PPPX-------PPXXP 919 P P GG PP P PPP PPP PP Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGG 979 Query: 920 XPXPPPXPXXGXAPPPR 970 PPP P PP R Sbjct: 980 SAPPPPPPPPPPPPPMR 996 Score = 28.7 bits (61), Expect = 8.0 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 413 GGGGGGXXPPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 GG PP A P P PPP P PPP P P Sbjct: 927 GGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPP-PGGSAPPPGGGAPPLP 974 Score = 25.0 bits (52), Expect(2) = 5e-04 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = -3 Query: 727 PPPPXGXXXXGXPXGPGXPXAPXAP 653 PPPP G P PG P P Sbjct: 933 PPPPPGGSAPSQPPPPGGNAPPPPP 957 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 47.6 bits (108), Expect = 2e-05 Identities = 48/193 (24%), Positives = 49/193 (25%), Gaps = 5/193 (2%) Frame = +3 Query: 279 PGGXGXGGPPXPXNPXGXXXXXXXXXXXXXXXXXXXXQXTXXXXGGGGGGGXX----PPX 446 PG G GPP P P G G G G PP Sbjct: 640 PGPPGPKGPPGPNGPLGPPGESGPAGNAGGVGYQGNHGNPAGVQGPNGQPGPPGINGPPG 699 Query: 447 XXGX-GXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXT 623 G G P P GP PP P PP PP P P P G P Sbjct: 700 QIGEMGPPGLPGPPGPASPPSP--PGPPGPPGPNGPPGPNGP--LGPPGECGPAGNAGGV 755 Query: 624 XXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGX 803 G+ G G PGP G G G P P G Sbjct: 756 GCQGHHGNPAGSQGPNGQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGP 815 Query: 804 GXXPLXXXPXPPP 842 P P PP Sbjct: 816 KGPPGPNGPLGPP 828 Score = 44.8 bits (101), Expect = 1e-04 Identities = 47/189 (24%), Positives = 47/189 (24%), Gaps = 1/189 (0%) Frame = +3 Query: 279 PGGXGXGGPPXPXNPXGXXXXXXXXXXXXXXXXXXXXQXTXXXXGGGGGGGXXPPXXXGX 458 PG G GP P P G G G G PP G Sbjct: 51 PGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIGPPGLPGPNGVNG--PPGELGD 108 Query: 459 -GXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXX 635 G P P GP PP P PP P P P G P Sbjct: 109 MGPPGPPGPPGPQMPPGPPGLPGPPGPAGP----PGTNGELGPPGDVGPPGNPGGPGLQG 164 Query: 636 XXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXP 815 G G G PGP G P G G P P A G P Sbjct: 165 NHGNPAGIQGPNGLPGPNGPLGPPGPPGDMGPPGLPGPQGPQMPPGPPGLPGAPGPKGPP 224 Query: 816 LXXXPXPPP 842 P PP Sbjct: 225 GTNGPLGPP 233 Score = 43.2 bits (97), Expect = 3e-04 Identities = 58/234 (24%), Positives = 61/234 (26%), Gaps = 4/234 (1%) Frame = +3 Query: 279 PGGXGXGGPPXPXNPXGXXXXXXXXXXXXXXXXXXXXQXTXXXXGGGGGGGXXPPXXXGX 458 PG G GPP P P G G G P G Sbjct: 103 PGELGDMGPPGPPGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGPPGDVGPPGNPGGPGL 162 Query: 459 -GXPXTPXXX-GPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXX 632 G P GP P P P PP PP P + G P Sbjct: 163 QGNHGNPAGIQGPNGLPGPNG--PLGPPGPPGDMGPPGL--PGPQGPQMPPGPPGLPG-- 216 Query: 633 XXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXX 812 A G G G GP G P P G GGP P+ G G Sbjct: 217 -----APGPKGPPGTNGPLGPPGDVGPPGNPGGP-GYQGNHGNPAGPQGPNGLPGPNGIL 270 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXP--PP 968 PP PP P PP PP P P+ P P PP Sbjct: 271 ------GPPGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPP 318 Score = 42.3 bits (95), Expect = 6e-04 Identities = 54/233 (23%), Positives = 55/233 (23%), Gaps = 3/233 (1%) Frame = +3 Query: 279 PGGXGXGGPPXPXNPXGXXXXXXXXXXXXXXXXXXXXQXTXXXXGGGGGGGXXPPXXXGX 458 PG G GPP P G G G PP G Sbjct: 349 PGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGP 408 Query: 459 -GXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXX 635 G P P G P P P PP P G Sbjct: 409 PGNPGGPGYQGNHGNPA-GPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPP 467 Query: 636 XXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXP 815 A G G G GP G P P G GGP P+ G G Sbjct: 468 GLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGP-GYQGNHGNPAGPQGPNGQPGPPGIN- 525 Query: 816 LXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXP--PP 968 PP P P PP PP P P P P PP Sbjct: 526 -----GPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPLGPP 573 Score = 41.5 bits (93), Expect = 0.001 Identities = 51/230 (22%), Positives = 53/230 (23%), Gaps = 1/230 (0%) Frame = +3 Query: 279 PGGXGXGGPPXPXNPXGXXXXXXXXXXXXXXXXXXXXQXTXXXXGGGGGGGXXPPXXXGX 458 PG G GPP P G G G PP G Sbjct: 434 PGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGP 493 Query: 459 -GXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXX 635 G P P G P P P PP P G Sbjct: 494 PGNPGGPGYQGNHGNPA-GPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPP 552 Query: 636 XXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXP 815 A G G G GP G P P G GGP P + G G Sbjct: 553 GLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGP----GYQGNHGNPAGPQGPNGQPGPPG 608 Query: 816 LXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 + P P PP PP P P P PP Sbjct: 609 VNGPPGEIGEIGPAGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 658 Score = 41.1 bits (92), Expect = 0.001 Identities = 30/99 (30%), Positives = 30/99 (30%), Gaps = 5/99 (5%) Frame = +3 Query: 279 PGGXGXGGPPXPXNPXGXXXXXXXXXXXXXXXXXXXXQXTXXXXGGGGGGGXX----PPX 446 PG G GPP P P G G G G PP Sbjct: 810 PGPPGPKGPPGPNGPLGPPGECGPAGNAGGVGCQGNHGNPAGSQGPNGQPGPPGINGPPG 869 Query: 447 XXGX-GXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 G G P P GP PP P PP PP P P P Sbjct: 870 QVGEMGPPGLPGPPGPASPPSP--PGPPGPPGPKGPPGP 906 Score = 40.7 bits (91), Expect = 0.002 Identities = 54/233 (23%), Positives = 55/233 (23%), Gaps = 3/233 (1%) Frame = +3 Query: 279 PGGXGXGGPPXPXNPXGXXXXXXXXXXXXXXXXXXXXQXTXXXXGGGGGGGXXPPXXXGX 458 PG G GPP P G G G PP G Sbjct: 264 PGPNGILGPPGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGP 323 Query: 459 -GXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXX 635 G P P G P P P PP P G Sbjct: 324 PGNPGGPGYQGNHGNPA-GPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPP 382 Query: 636 XXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXP 815 A G G G GP G P P G GGP P+ G G Sbjct: 383 GLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGP-GYQGNHGNPAGPQGPNGQPGPPGIN- 440 Query: 816 LXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXP--PP 968 PP P P PP PP P P P P PP Sbjct: 441 -----GPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPLGPP 488 Score = 39.9 bits (89), Expect = 0.003 Identities = 39/143 (27%), Positives = 39/143 (27%), Gaps = 1/143 (0%) Frame = +3 Query: 495 PPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXXXXRAXGAXGAXG 674 PPP P PPPPP PP P F G P G G G Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPG--FPGPQGPNGPKGPPGLPGPPG----PPGFQGPPG 82 Query: 675 XP-GPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXXXPXPPPPPP 851 P G G P P G G P P P P P PP P Sbjct: 83 NPAGAIGPPGLPGPNGVNGPP----GELGDMGPPGPPGPPGPQMPPGP-PGLPGPPGPAG 137 Query: 852 PXXXXXXRAXPXXXPPPXPPXXP 920 P P PP P P Sbjct: 138 PPGTNGELGPPGDVGPPGNPGGP 160 Score = 39.9 bits (89), Expect = 0.003 Identities = 50/190 (26%), Positives = 50/190 (26%), Gaps = 8/190 (4%) Frame = +3 Query: 417 GGGGGXXPPXXXGXGXPXTPXXXGPP----PPPXPXXXXPPPPPX----PPXXPXPXXVR 572 G G PP G P P GPP PP P PP P PP P P V Sbjct: 43 GPPGPDGPPGFPGPQGPNGPK--GPPGLPGPPGPPGFQGPPGNPAGAIGPPGLPGPNGVN 100 Query: 573 FXXXGGGXRPXXXXXXTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXX 752 G G G G PGP G P G G Sbjct: 101 GPP---GELGDMGPPGPPGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGPPGDVGPPGNP 157 Query: 753 XXXXXXPRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXP 932 P AG G L P PP P P P PP P Sbjct: 158 GGPGLQGNHGNP-AGIQGPNGLPGPNGPLGPPGPPGDMGPPGLPGPQGPQMPPGPPGL-- 214 Query: 933 PRAPRXAXXP 962 P AP P Sbjct: 215 PGAPGPKGPP 224 Score = 39.5 bits (88), Expect = 0.004 Identities = 52/204 (25%), Positives = 53/204 (25%), Gaps = 36/204 (17%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPP----------PPXPPXXP-XPXXVRFXXXGGGXRPXXX 611 P P PPPPP P PP P PP P P F G Sbjct: 30 PPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIG 89 Query: 612 XXXTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXG-----GGGGPXXXXXXXXXXXXPR 776 G G G PGP G P P G G GP P Sbjct: 90 PPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGPPG 149 Query: 777 XXRPXA--GGXG---------------XXPLXXXPXPPPPPPPXXXXXXRAXPXXXP-PP 902 P GG G P P PP PP P PP Sbjct: 150 DVGPPGNPGGPGLQGNHGNPAGIQGPNGLPGPNGPLGPPGPPGDMGPPGLPGPQGPQMPP 209 Query: 903 XPPXXPXXXPPRAPRXAXXP--PP 968 PP P P+ P P PP Sbjct: 210 GPPGLPGAPGPKGPPGTNGPLGPP 233 Score = 39.1 bits (87), Expect = 0.006 Identities = 57/241 (23%), Positives = 60/241 (24%), Gaps = 11/241 (4%) Frame = +3 Query: 279 PGGXGXGGPPXPXNPXGXXXXXXXXXXXXXXXXXXXXQXTXXXXGGGGGGGXXPPXXXGX 458 PG G GPP P G G G PP G Sbjct: 179 PGPNGPLGPPGPPGDMGPPGLPGPQGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGP 238 Query: 459 ----GXPXTPXXXGPPPPPXPXXXXPPP-----PPXPPXXPXPXXVRFXXXGGGXRPXXX 611 G P G P P P P PP PP P + G P Sbjct: 239 PGNPGGPGYQGNHGNPAGPQGPNGLPGPNGILGPPGPPGDMGPPGL--PGPPGPQMPPGP 296 Query: 612 XXXTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPX 791 A G G G GP G P P G GGP P+ Sbjct: 297 PGLPG-------APGPKGPPGTNGPLGPPGDVGPPGNPGGP-GYQGNHGNPAGPQGPNGQ 348 Query: 792 AGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXP--P 965 G G PP P P PP PP P P+ P P P Sbjct: 349 PGPPGIN------GPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGP 402 Query: 966 P 968 P Sbjct: 403 P 403 Score = 36.7 bits (81), Expect = 0.030 Identities = 62/258 (24%), Positives = 64/258 (24%), Gaps = 29/258 (11%) Frame = +3 Query: 279 PGGXGXGGPPX----PXNPXGXXXXXXXXXXXXXXXXXXXXQXTXXXXGGGGGGGXXPPX 446 PG G GPP P NP G G G P Sbjct: 564 PGINGPLGPPGEAGPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGVNGPPGEIGEIGPAG 623 Query: 447 XXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGG-----------G 593 G P +P PP PP P PP P P P GG G Sbjct: 624 LPGPPGPASPP--SPPGPPGPPGPKGPPGPNGPLGPPGESGPAGNAGGVGYQGNHGNPAG 681 Query: 594 XRPXXXXXXTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGG--GPXXXXXXXXXXX 767 + G G G PGP G P G G GP Sbjct: 682 VQGPNGQPGPPGINGPPGQIGEMGPPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLG 741 Query: 768 XPRXXRPX--AGGXGXX-----PLXXX-PXPPPPPP----PXXXXXXRAXPXXXPPPXPP 911 P P AGG G P P P PP P P PP P Sbjct: 742 PPGECGPAGNAGGVGCQGHHGNPAGSQGPNGQPGPPGINGPPGQVGEMGPPGLPGPPGPA 801 Query: 912 XXPXXXPPRAPRXAXXPP 965 P P P PP Sbjct: 802 SPPSPPGPPGPPGPKGPP 819 Score = 36.3 bits (80), Expect = 0.040 Identities = 28/107 (26%), Positives = 29/107 (27%) Frame = -3 Query: 733 GPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXXXXXXGRXPPPXXXKRTXXGX 554 GPP PP G P PG P P P G Sbjct: 271 GPPGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGP 330 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPPPPP 413 G G G G G G P G+ G P P G P PP Sbjct: 331 GYQGNHGNPAGP----QGPNGQPGPPGINGPPGPLGDVGPPGLPGPP 373 Score = 35.1 bits (77), Expect = 0.092 Identities = 32/109 (29%), Positives = 33/109 (30%), Gaps = 2/109 (1%) Frame = -3 Query: 733 GPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXXXXXXGRXPPPXXXKRTXXGX 554 GPP PP G P GP P P P G PP Sbjct: 186 GPPGPPGDMGPPGLP-GPQGPQMPPGPPGLPGAPG-PKGPPGTNGPLGPPGDV----GPP 239 Query: 553 GXXGGXG--GGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPPPPP 413 G GG G G G G G P G+ G P P G P PP Sbjct: 240 GNPGGPGYQGNHGNPAGPQGPNGLPGPNGILGPPGPPGDMGPPGLPGPP 288 Score = 33.1 bits (72), Expect = 0.37 Identities = 27/101 (26%), Positives = 27/101 (26%) Frame = +3 Query: 663 GAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXXXPXPPP 842 G G PGP G P P G G P AG G P PP Sbjct: 808 GPPGPPGPKGPPGPNGPLGPPGECGPAGNAGGVGCQGNHGNP-AGSQGP---NGQPGPPG 863 Query: 843 PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P P PP P P P P PP Sbjct: 864 INGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPP 904 Score = 33.1 bits (72), Expect = 0.37 Identities = 25/104 (24%), Positives = 27/104 (25%) Frame = +3 Query: 654 GAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXXXPX 833 G G G GP G P P G GG P + G G + P Sbjct: 814 GPKGPPGPNGPLGPPGECGPAGNAGG----VGCQGNHGNPAGSQGPNGQPGPPGINGPPG 869 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P PP PP P P P PP Sbjct: 870 QVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGCLGPP 913 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 P P PP PP P P PP P PP Sbjct: 713 PGPASPPSPPGPPGPPGPNGPPGPNGPLGPP 743 Score = 32.7 bits (71), Expect = 0.49 Identities = 27/105 (25%), Positives = 28/105 (26%), Gaps = 2/105 (1%) Frame = +3 Query: 654 GAXGAXGXPGPXGXPXXXXPXG--GGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXXX 827 G G G GP G P P G GG G P G G Sbjct: 729 GPNGPPGPNGPLGPPGECGPAGNAGGVGCQGHHGNPAGSQGPNGQPGPPGINGPPGQVGE 788 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXP 962 PP P P + P PP P P P P P Sbjct: 789 MGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPPGECGP 833 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 P P PP PP P P PP P PP Sbjct: 798 PGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 828 Score = 32.3 bits (70), Expect = 0.65 Identities = 27/101 (26%), Positives = 27/101 (26%) Frame = +3 Query: 672 GXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXXXPXPPPPPP 851 G PGP G P P G G P P P G PP P Sbjct: 43 GPPGPDGPPGFPGPQGPNG-PKGPPGLPGPPGPPGFQGPPGNPAGAI------GPPGLPG 95 Query: 852 PXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 P PP PP P P P PP A Sbjct: 96 PNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGPPGPA 136 Score = 32.3 bits (70), Expect = 0.65 Identities = 27/107 (25%), Positives = 28/107 (26%) Frame = -3 Query: 733 GPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXXXXXXGRXPPPXXXKRTXXGX 554 GPP P G P PG P P P G Sbjct: 356 GPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGP 415 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPPPPP 413 G G G G G G P G+ G P P G P PP Sbjct: 416 GYQGNHGNPAGPQ----GPNGQPGPPGINGPPGPLGDVGPPGLPGPP 458 Score = 32.3 bits (70), Expect = 0.65 Identities = 36/153 (23%), Positives = 37/153 (24%), Gaps = 3/153 (1%) Frame = -3 Query: 727 PPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXXXXXXGRXPPPXXXKRTXXGXGX 548 PP P G P GP P P P G P + G Sbjct: 633 PPSPPGPPGPPGPKGPPGPNGPLGPPGESGPAG-NAGGVGYQGNHGNPAGVQGPNGQPGP 691 Query: 547 XGGXGGGGGXXXXGXGGGGGPXXXGVXGXP--XPXXXGGXXPPPPPPPXXXXVXCXXXXX 374 G G G G G GP P P G PP P P C Sbjct: 692 PGINGPPGQIGEMGPPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGPPGECGPAGN 751 Query: 373 XXXXXXXXXXXXXXXPXGFXGXGGPP-XPXPPG 278 G G GPP PPG Sbjct: 752 AGGVGCQGHHGNPAGSQGPNGQPGPPGINGPPG 784 Score = 31.9 bits (69), Expect = 0.86 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 PPPPPP A P PP P P P+ P PP Sbjct: 29 PPPPPP------YEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPP 66 Score = 31.9 bits (69), Expect = 0.86 Identities = 31/106 (29%), Positives = 31/106 (29%) Frame = -3 Query: 730 PPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXXXXXXGRXPPPXXXKRTXXGXG 551 PPPPP G P PG P P P G PP G Sbjct: 38 PPPPPGPPGPDGPPGFPG-PQGPNGPKG----------PPGLPGPPGPPGFQGPPGNPAG 86 Query: 550 XXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPPPPP 413 G G G G G P G G P P G PP PP Sbjct: 87 AIGPPGLPGPN-----GVNGPPGELGDMGPPGPPGPPGPQMPPGPP 127 Score = 31.9 bits (69), Expect = 0.86 Identities = 27/107 (25%), Positives = 28/107 (26%) Frame = -3 Query: 733 GPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXXXXXXGRXPPPXXXKRTXXGX 554 GPP P G P PG P P P G Sbjct: 441 GPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGP 500 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPPPPP 413 G G G G G G P G+ G P P G P PP Sbjct: 501 GYQGNHGNPAGPQ----GPNGQPGPPGINGPPGPLGDVGPPGLPGPP 543 Score = 30.7 bits (66), Expect = 2.0 Identities = 27/105 (25%), Positives = 28/105 (26%) Frame = -3 Query: 727 PPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXXXXXXGRXPPPXXXKRTXXGXGX 548 PP P G P GP P P P G P + G Sbjct: 803 PPSPPGPPGPPGPKGPPGPNGPLGPPGECGPAG-NAGGVGCQGNHGNPAGSQGPNGQPGP 861 Query: 547 XGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPPPPP 413 G G G G G GP G P P G P PP Sbjct: 862 PGINGPPGQVGEMGPPGLPGP--PGPASPPSPPGPPGPPGPKGPP 904 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 896 PPXPPXXPXPXPPPXPXXGXAPP 964 PP PP P PPP P PP Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPP 51 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAP--PP 967 P P P PP PP P P P P P PP Sbjct: 795 PGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 828 Score = 29.5 bits (63), Expect = 4.6 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +2 Query: 152 PPPXWXPPXXPPPP-PXXPXXXPXPXG 229 PPP PP P PP P P P P G Sbjct: 32 PPPYEAPPPPPGPPGPDGPPGFPGPQG 58 Score = 29.5 bits (63), Expect = 4.6 Identities = 28/106 (26%), Positives = 28/106 (26%) Frame = -3 Query: 733 GPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXXXXXXGRXPPPXXXKRTXXGX 554 GPP PP G P PG P P P G Sbjct: 113 GPPGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGPPGDVGPPGNPGGPGLQGNHGNPAGI 172 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPPPP 416 G G G G G P G G P P G PP PP Sbjct: 173 QGPNGLPGPNGP----LGPPGPPGDMGPPGLPGP--QGPQMPPGPP 212 Score = 29.1 bits (62), Expect = 6.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 896 PPXPPXXPXPXPPPXPXXGXAPP 964 PP PP P P PP P PP Sbjct: 111 PPGPPGPPGPQMPPGPPGLPGPP 133 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAP 961 P P P P PP P P PP P P Sbjct: 707 PGLPGPPGPASPPSPPGPPGPPGPNGPPGP 736 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAP 961 P P P P PP P P PP P P Sbjct: 792 PGLPGPPGPASPPSPPGPPGPPGPKGPPGP 821 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAP 961 P P P P PP P P PP P P Sbjct: 877 PGLPGPPGPASPPSPPGPPGPPGPKGPPGP 906 Score = 28.7 bits (61), Expect = 8.0 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXP--XXGXAPPP 967 P P P PP PP P P P P G PP Sbjct: 115 PGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGPP 148 Score = 28.7 bits (61), Expect = 8.0 Identities = 27/107 (25%), Positives = 27/107 (25%) Frame = -3 Query: 733 GPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXXXXXXGRXPPPXXXKRTXXGX 554 GPP P G P PG P P P G Sbjct: 526 GPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGP 585 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPPPPP 413 G G G G G G P GV G P G P PP Sbjct: 586 GYQGNHGNPAGPQ----GPNGQPGPPGVNGPPGEIGEIGPAGLPGPP 628 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 47.2 bits (107), Expect = 2e-05 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP PP P P P PPP P G APPP Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPP 333 Score = 44.4 bits (100), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 420 GGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 GGG PP G P PPPP P PPPPP PP P Sbjct: 286 GGGAPVPPPPPADGSAPAP-----PPPPPPGGAPPPPPPPPPPPP 325 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +2 Query: 887 PXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP P P PPP P G APPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPP 316 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 417 GGGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 G PP G P P PPPPP P PPPP PP Sbjct: 299 GSAPAPPPPPPPGGAPPPPP----PPPPPPPGDGGAPPPPPPP 337 Score = 39.1 bits (87), Expect = 0.006 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 P PPPPPPP A P PPP PP PP P Sbjct: 302 PAPPPPPPPGG-----APPPPPPPPPPPPGDGGAPPPPP 335 Score = 35.9 bits (79), Expect = 0.053 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 410 GGGGGGGXXPPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 GGG PP A P P G PPP P P P P P P Sbjct: 286 GGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 35.1 bits (77), Expect = 0.092 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXP 943 P PPP PPP P P PPP P Sbjct: 314 PPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 34.3 bits (75), Expect = 0.16 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 3/52 (5%) Frame = +2 Query: 413 GGGGGGXXPPXXXG---ARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 GGG PP G A P P P PPP P P P P P P Sbjct: 286 GGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 33.5 bits (73), Expect = 0.28 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 829 PXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 P PPPPP PP PP G P PPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 33.1 bits (72), Expect = 0.37 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P P P PPP PP PPPPP P P Sbjct: 292 PPPPPADGSAPAPP-PPPPPGGAPPPPPPPPPPPPGDGGAP 331 Score = 32.7 bits (71), Expect = 0.49 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXP 205 P P P P PPP P PPPPP P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPP 324 Score = 32.7 bits (71), Expect = 0.49 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -3 Query: 487 PXXXGVXGXPXPXXXGGXXPPPPPPP 410 P P P GG PPPPPPP Sbjct: 296 PADGSAPAPPPPPPPGGAPPPPPPPP 321 Score = 32.3 bits (70), Expect = 0.65 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXP 908 P P PPPPPPP A P PPP P Sbjct: 309 PPGGAPPPPPPPPPPPPGDGGAPP---PPPPP 337 Score = 31.9 bits (69), Expect = 0.86 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = +3 Query: 786 PXAGGXGXXPLXXXPXPP---PPPPPXXXXXXRAXPXXXPPPXPP 911 P G P P PP PPPPP PPP PP Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 30.3 bits (65), Expect = 2.6 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPX---PPXXPXP 560 P G G P P PPP PPPPP PP P P Sbjct: 281 PDIVTGGGAPVPP----PPPADGSAPAPPPPPPPGGAPPPPPPP 320 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 4/42 (9%) Frame = +3 Query: 489 PPPPPX----PXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRP 602 PPPPP P PPPP P P P GG P Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPP 333 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -3 Query: 487 PXXXGVXGXPXPXXXGGXXPPPPPPP 410 P G P P G PPPPPPP Sbjct: 295 PPADGSAPAPPPPPPPGGAPPPPPPP 320 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 460 PXPXXXGGXXPPPPPPP 410 P P G PPPPPPP Sbjct: 306 PPPPPGGAPPPPPPPPP 322 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -1 Query: 453 PXXXGGXXPPPPPPP 409 P GG PPPPPPP Sbjct: 307 PPPPGGAPPPPPPPP 321 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPP 196 PP P P P PPP PPPPP Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 460 PXPXXXGGXXPPPPPPP 410 P P G PPPPPPP Sbjct: 321 PPPPPGDGGAPPPPPPP 337 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 46.8 bits (106), Expect = 3e-05 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PPP PP P P PPP P PPP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAP 961 P PPP PPP PP P P PP P P Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PPPPP P PPPPP PP P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTP 706 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PPPPP P PPPPP P P P Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPP 708 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PPPPP P PPPPP P P P Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPP 709 Score = 37.9 bits (84), Expect = 0.013 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 P PPPPPPP PPP PP P AP Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAP 722 Score = 37.9 bits (84), Expect = 0.013 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPP 545 P P PPPPP P PPPP PP Sbjct: 689 PPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 37.1 bits (82), Expect = 0.023 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P PPPPP P PPP P P P P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 36.7 bits (81), Expect = 0.030 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P P PPPPP P PPP PP P Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 36.7 bits (81), Expect = 0.030 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P P PPPPP P PPPP P P Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 36.3 bits (80), Expect = 0.040 Identities = 22/76 (28%), Positives = 24/76 (31%), Gaps = 1/76 (1%) Frame = +2 Query: 467 PHPXXXGPXPPPXPRXXXPXPPPXPXPXPXPXXXXFXXXGGGGXPXXXXXXNXQXXXXXP 646 P P P PPP P P PP P P P G P N Q P Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQPPPP 744 Query: 647 XXXRXRGXGRAXA-PG 691 + G+A PG Sbjct: 745 GQLPGQQPGQAGGRPG 760 Score = 36.3 bits (80), Expect = 0.040 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 P PPP PPP PP P P P PP Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 35.9 bits (79), Expect = 0.053 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXP 932 P P PPPPPPP + P PP PP P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAP 722 Score = 35.9 bits (79), Expect = 0.053 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P PPPPP P P PP PP P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 35.5 bits (78), Expect = 0.070 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXP-PXXPXXXPPRAP 944 P PPPPPPP P PPP P P P PP P Sbjct: 683 PPPPPPPPPP--------PPPPPPPPPQPSTPPPPPPSTP 714 Score = 35.1 bits (77), Expect = 0.092 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 P+ PPPPPP P PPP PP P PP P Sbjct: 675 PIPIQTMVPPPPPP-------PPPPPPPPPPPPPQPSTPPPPPP 711 Score = 35.1 bits (77), Expect = 0.092 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP PP PPPPP P P P Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPP 709 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 P PPPPPPP + PPP P P +P Sbjct: 687 PPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 P PPP PPP P P P P P P Sbjct: 692 PPPPPPPPPPQPSTPPPPPPSTPPVQQSGAP 722 Score = 32.7 bits (71), Expect = 0.49 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P + PPP PP PPPPP P P Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPP 708 Score = 32.3 bits (70), Expect = 0.65 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +2 Query: 416 GGGGGXXPPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXP 553 GGG + P P PPP P P PPP P P P Sbjct: 658 GGGQTISVNPSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQP 703 Score = 31.9 bits (69), Expect = 0.86 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP PP PPPPP P P Sbjct: 687 PPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 31.9 bits (69), Expect = 0.86 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP P P P P P PP G P Sbjct: 694 PPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P P P PPPPP PP P P Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPPPPPPPPPPP 698 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P PP P P PPP P P P Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQP 703 Score = 29.1 bits (62), Expect = 6.1 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 4/46 (8%) Frame = +2 Query: 107 PXPXXXFXXXPLFXXPPPXWXPPXXPP----PPPXXPXXXPXPXGG 232 P P P PPP PP PP PPP P P G Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSG 720 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 494 PPPXPRXXXPXPPPXPXPXPXP 559 PPP P P PPP P P P P Sbjct: 683 PPPPP----PPPPPPPPPPPPP 700 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 46.8 bits (106), Expect = 3e-05 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PPP PP P P PPP P PPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 46.8 bits (106), Expect = 3e-05 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PPP PP P P PPP P PPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 46.4 bits (105), Expect = 4e-05 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PPP PP P P PPP P PPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 45.6 bits (103), Expect = 7e-05 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 P PPP PPP PP P P PPP P PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 44.4 bits (100), Expect = 2e-04 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +3 Query: 459 GXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 G P PPPPP P PPPPP PP P P Sbjct: 459 GVGQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 43.2 bits (97), Expect = 3e-04 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P P PPPPP P PPPPP PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 42.7 bits (96), Expect = 5e-04 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +3 Query: 453 GXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 G P P PPPPP P PPPP PP P P Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 41.9 bits (94), Expect = 8e-04 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +3 Query: 453 GXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 G G P PPPPP P PPPPP P P P Sbjct: 459 GVGQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +3 Query: 411 GGGGGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXP 542 G G G PP P P PPPPP P PPPPP P Sbjct: 455 GDTEGVGQAPPPPPPPPPPPPPPPPPPPPPPPP--FPPPPPPTP 496 Score = 38.7 bits (86), Expect = 0.007 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = +3 Query: 798 GXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 G G P P PPPPPPP P PPP PP P PP P Sbjct: 459 GVGQAPPPPPPPPPPPPPP---------PPPPPPPPPPFPP--PPPPTP 496 Score = 35.1 bits (77), Expect = 0.092 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP PP PPPPP P P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 35.1 bits (77), Expect = 0.092 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP PP PPPPP P P P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFP 489 Score = 35.1 bits (77), Expect = 0.092 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP PP PPPPP P P P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 35.1 bits (77), Expect = 0.092 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP PP PPPPP P P P Sbjct: 469 PPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 35.1 bits (77), Expect = 0.092 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP PP PPPPP P P P Sbjct: 470 PPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 35.1 bits (77), Expect = 0.092 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP PP PPPPP P P P Sbjct: 473 PPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 33.9 bits (74), Expect = 0.21 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXP 205 PP P P P PPP PP PPPPP P Sbjct: 464 PPPPPPPPPPPPPP---PPPPPPPPPPFPPPPPPTP 496 Score = 31.9 bits (69), Expect = 0.86 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 488 PXPPPXPRXXXPXPPPXPXPXPXPXXXXF 574 P PPP P P PPP P P P P F Sbjct: 464 PPPPPPP----PPPPPPPPPPPPPPPPPF 488 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 46.8 bits (106), Expect = 3e-05 Identities = 41/172 (23%), Positives = 43/172 (25%), Gaps = 2/172 (1%) Frame = +3 Query: 459 GXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXX 638 G P P PP P PPPP P P + G RP Sbjct: 193 GPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLA-PPPTGSSRPLPAPPPGENRPP 251 Query: 639 XXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPL 818 G G P P G P P P Sbjct: 252 PPMRGPTSG--GEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPA 309 Query: 819 XXXPX--PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPPPP P PP P PP + R A PPP Sbjct: 310 PPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPP 361 Score = 42.3 bits (95), Expect = 6e-04 Identities = 45/185 (24%), Positives = 48/185 (25%), Gaps = 5/185 (2%) Frame = +3 Query: 429 GXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXX 608 G PP G P PPPP P PPP P G P Sbjct: 145 GAPPPPDRGGQLAKKPSQGSFPPPP-PMGKPPPPSGNKPTFG-----NSRTSTNGPPPPP 198 Query: 609 XXXXTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRP 788 R+ G GP P G P P P Sbjct: 199 HSRHGSAPPPPERSSGPPPPPPGRGP-SQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGP 257 Query: 789 XAGGXGXXPLXXXPXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXA 953 +GG P P P PPPPP + PP PP P P A Sbjct: 258 TSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQG-PPLPPSRDQAPAPPPPLNA 316 Query: 954 XXPPP 968 PPP Sbjct: 317 TPPPP 321 Score = 37.1 bits (82), Expect = 0.023 Identities = 43/168 (25%), Positives = 43/168 (25%), Gaps = 5/168 (2%) Frame = +2 Query: 47 PLXNXKMXGNLXXXXXXPPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXX---P 217 P N GN PP P P P PPP PPPP P P Sbjct: 177 PSGNKPTFGNSRTSTNGPPPP-PHSRHGSAP----PPPERSSGPPPPPPGRGPSQRSLAP 231 Query: 218 XPXGGXXXXXLXX--EKXXXXXXGGXXXGGAPGPXKPXXXXXXXXXXXXXXXXXXXXXXT 391 P G E G GG P P K T Sbjct: 232 PPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPK------NAPPPPKRGSSNPPPPPT 285 Query: 392 XNXXXXGGGGGGGXXPPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPP 535 G PP A P P P PPP R P PPP Sbjct: 286 RGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPP 333 Score = 37.1 bits (82), Expect = 0.023 Identities = 47/192 (24%), Positives = 49/192 (25%), Gaps = 11/192 (5%) Frame = +3 Query: 426 GGXXPPXXXGXGXPXTPXXXGP------PPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXG 587 G PP G P P GP PPP P PPP P P +R G Sbjct: 203 GSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPP--MRGPTSG 260 Query: 588 GGXRPXXXXXXTXXXXXXXRAXGAXGAXGXPG-PXGXPXXXXPXGGGGGPXXXXXXXXXX 764 G P G P P P Sbjct: 261 G--EPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATP 318 Query: 765 XXPRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXP--PPXPPXXPXXXPP- 935 P R PL PPPPP R+ P P P P P PP Sbjct: 319 PPPPPSRDQVP-LPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPG 377 Query: 936 -RAPRXAXXPPP 968 R P PPP Sbjct: 378 RRPPSGKINPPP 389 Score = 32.7 bits (71), Expect = 0.49 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PPPPP P PP P P P P Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 32.3 bits (70), Expect = 0.65 Identities = 40/152 (26%), Positives = 41/152 (26%), Gaps = 6/152 (3%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPP------PXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXX 635 P G PPPP PPPP P PP P F G P Sbjct: 257 PTSGGEPPPPK---NAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPP 313 Query: 636 XXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXP 815 A P P P G P R P G P Sbjct: 314 L-----NATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTST-RSAPPPPPGRAPQP 367 Query: 816 LXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPP 911 L PPPPPP + P PPP PP Sbjct: 368 LGG---PPPPPPGRRPPSGKINP---PPPPPP 393 Score = 32.3 bits (70), Expect = 0.65 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 5/34 (14%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXP-----PPPPXPPXXPXP 560 P G PPPP P P PPPP PP P Sbjct: 365 PQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKP 398 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 893 PPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PP P P PPP G PP Sbjct: 2 PPPPPP--PGPPPPPSAPSGPVKPP 24 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPP 937 P PPP PPP P P PP Sbjct: 3 PPPPPPGPPPPPSAPSGPVKPP 24 Score = 29.9 bits (64), Expect = 3.5 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 840 PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 PPPPP RA PP PP P PP PPP A Sbjct: 357 PPPPPG-----RAPQPLGGPPPPP--PGRRPPSGKINPPPPPPPA 394 Score = 29.1 bits (62), Expect = 6.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPP 536 P P GPPPPP PPP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 28.7 bits (61), Expect = 8.0 Identities = 26/110 (23%), Positives = 27/110 (24%), Gaps = 3/110 (2%) Frame = -3 Query: 733 GPPPPPXGXXXXGXPXGP---GXPXAPXAPXARXXXXXLXVXXXXXXGRXPPPXXXKRTX 563 GPPPPP G P G AP + G PPP Sbjct: 214 GPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPP 273 Query: 562 XGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPPPPP 413 G G P P P PPPPPP Sbjct: 274 KRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPP 323 Score = 28.7 bits (61), Expect = 8.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 486 GPPPPPXPXXXXPPPPP 536 G PPP P PPPPP Sbjct: 462 GAPPPVPPSRGPPPPPP 478 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 46.8 bits (106), Expect = 3e-05 Identities = 41/172 (23%), Positives = 43/172 (25%), Gaps = 2/172 (1%) Frame = +3 Query: 459 GXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXX 638 G P P PP P PPPP P P + G RP Sbjct: 105 GPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLA-PPPTGSSRPLPAPPPGENRPP 163 Query: 639 XXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPL 818 G G P P G P P P Sbjct: 164 PPMRGPTSG--GEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPA 221 Query: 819 XXXPX--PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPPPP P PP P PP + R A PPP Sbjct: 222 PPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPP 273 Score = 42.3 bits (95), Expect = 6e-04 Identities = 45/185 (24%), Positives = 48/185 (25%), Gaps = 5/185 (2%) Frame = +3 Query: 429 GXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXX 608 G PP G P PPPP P PPP P G P Sbjct: 57 GAPPPPDRGGQLAKKPSQGSFPPPP-PMGKPPPPSGNKPTFG-----NSRTSTNGPPPPP 110 Query: 609 XXXXTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRP 788 R+ G GP P G P P P Sbjct: 111 HSRHGSAPPPPERSSGPPPPPPGRGP-SQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGP 169 Query: 789 XAGGXGXXPLXXXPXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXA 953 +GG P P P PPPPP + PP PP P P A Sbjct: 170 TSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQG-PPLPPSRDQAPAPPPPLNA 228 Query: 954 XXPPP 968 PPP Sbjct: 229 TPPPP 233 Score = 37.1 bits (82), Expect = 0.023 Identities = 43/168 (25%), Positives = 43/168 (25%), Gaps = 5/168 (2%) Frame = +2 Query: 47 PLXNXKMXGNLXXXXXXPPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXX---P 217 P N GN PP P P P PPP PPPP P P Sbjct: 89 PSGNKPTFGNSRTSTNGPPPP-PHSRHGSAP----PPPERSSGPPPPPPGRGPSQRSLAP 143 Query: 218 XPXGGXXXXXLXX--EKXXXXXXGGXXXGGAPGPXKPXXXXXXXXXXXXXXXXXXXXXXT 391 P G E G GG P P K T Sbjct: 144 PPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPK------NAPPPPKRGSSNPPPPPT 197 Query: 392 XNXXXXGGGGGGGXXPPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPP 535 G PP A P P P PPP R P PPP Sbjct: 198 RGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPP 245 Score = 37.1 bits (82), Expect = 0.023 Identities = 47/192 (24%), Positives = 49/192 (25%), Gaps = 11/192 (5%) Frame = +3 Query: 426 GGXXPPXXXGXGXPXTPXXXGP------PPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXG 587 G PP G P P GP PPP P PPP P P +R G Sbjct: 115 GSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPP--MRGPTSG 172 Query: 588 GGXRPXXXXXXTXXXXXXXRAXGAXGAXGXPG-PXGXPXXXXPXGGGGGPXXXXXXXXXX 764 G P G P P P Sbjct: 173 G--EPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATP 230 Query: 765 XXPRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXP--PPXPPXXPXXXPP- 935 P R PL PPPPP R+ P P P P P PP Sbjct: 231 PPPPPSRDQVP-LPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPG 289 Query: 936 -RAPRXAXXPPP 968 R P PPP Sbjct: 290 RRPPSGKINPPP 301 Score = 32.3 bits (70), Expect = 0.65 Identities = 40/152 (26%), Positives = 41/152 (26%), Gaps = 6/152 (3%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPP------PXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXX 635 P G PPPP PPPP P PP P F G P Sbjct: 169 PTSGGEPPPPK---NAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPP 225 Query: 636 XXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXP 815 A P P P G P R P G P Sbjct: 226 L-----NATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTST-RSAPPPPPGRAPQP 279 Query: 816 LXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPP 911 L PPPPPP + P PPP PP Sbjct: 280 LGG---PPPPPPGRRPPSGKINP---PPPPPP 305 Score = 32.3 bits (70), Expect = 0.65 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 5/34 (14%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXP-----PPPPXPPXXPXP 560 P G PPPP P P PPPP PP P Sbjct: 277 PQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKP 310 Score = 29.9 bits (64), Expect = 3.5 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 840 PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 PPPPP RA PP PP P PP PPP A Sbjct: 269 PPPPPG-----RAPQPLGGPPPPP--PGRRPPSGKINPPPPPPPA 306 Score = 28.7 bits (61), Expect = 8.0 Identities = 26/110 (23%), Positives = 27/110 (24%), Gaps = 3/110 (2%) Frame = -3 Query: 733 GPPPPPXGXXXXGXPXGP---GXPXAPXAPXARXXXXXLXVXXXXXXGRXPPPXXXKRTX 563 GPPPPP G P G AP + G PPP Sbjct: 126 GPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPP 185 Query: 562 XGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPPPPP 413 G G P P P PPPPPP Sbjct: 186 KRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPP 235 Score = 28.7 bits (61), Expect = 8.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 486 GPPPPPXPXXXXPPPPP 536 G PPP P PPPPP Sbjct: 374 GAPPPVPPSRGPPPPPP 390 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 46.0 bits (104), Expect = 5e-05 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAP 961 PR PPP PPP PP P P PPP G P Sbjct: 864 PRRPPPPPPPPPPPPPPPPPPPASSTGSTP 893 Score = 39.1 bits (87), Expect = 0.006 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPP 545 P PPPPP P PPPPP PP Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PR P PPP PP P P PPP P P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPPASSTGSTP 893 Score = 37.9 bits (84), Expect = 0.013 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXP 943 PR P PPP PP P P PPP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPP 883 Score = 35.9 bits (79), Expect = 0.053 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 492 PPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRP 602 PPPP P PPPPP PP P P GG P Sbjct: 867 PPPPPP----PPPPPPPPPPPPPASSTGSTPGGDKVP 899 Score = 33.5 bits (73), Expect = 0.28 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 495 PPPXPXXXXPPPPPXPPXXPXP 560 P P P PPPPP PP P P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPP 881 Score = 33.1 bits (72), Expect = 0.37 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 875 RXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 R P P P PP P P PPP P PPP Sbjct: 858 RRPRPRPRRPPPPPPPPPPPPPP---PPPPP 885 Score = 32.7 bits (71), Expect = 0.49 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P PP PPPPPPP P Sbjct: 864 PRRPPPPPPPPPPPPPP 880 Score = 32.7 bits (71), Expect = 0.49 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P PP PPPPPPP P Sbjct: 867 PPPPPPPPPPPPPPPPP 883 Score = 32.7 bits (71), Expect = 0.49 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P PP PPPPPPP P Sbjct: 868 PPPPPPPPPPPPPPPPP 884 Score = 32.7 bits (71), Expect = 0.49 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P PP PPPPPPP P Sbjct: 869 PPPPPPPPPPPPPPPPP 885 Score = 31.9 bits (69), Expect = 0.86 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 P P PP PPPPP P P P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 458 RXXPHPXXXGPXPPPXPRXXXPXPPPXPXP 547 R P P P PPP P P PPP P P Sbjct: 859 RPRPRPRRPPPPPPPPP---PPPPPPPPPP 885 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P P P P P P P P +P P Sbjct: 475 PRPHPSPHPSSNPSPNPSPNPSSDPSPNP 503 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXPXG 229 PPP PP PPPPP P G Sbjct: 870 PPPPPPPPPPPPPPPPASSTGSTPGG 895 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXPXGG 232 PPP PP PPPPP GG Sbjct: 869 PPPPPPPPPPPPPPPPPASSTGSTPGG 895 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P P PPPPPPP P Sbjct: 860 PRPRPRRPPPPPPPPPP 876 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P P PPPPPPP P Sbjct: 862 PRPRRPPPPPPPPPPPP 878 Score = 28.7 bits (61), Expect = 8.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 873 RAXPXXXPPPXPPXXPXXXPPRAP 944 R P PPP PP P PP P Sbjct: 861 RPRPRRPPPPPPPPPPPPPPPPPP 884 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 44.8 bits (101), Expect = 1e-04 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PPP PP P PPP P APPP Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAPPP 223 Score = 37.9 bits (84), Expect = 0.013 Identities = 21/51 (41%), Positives = 22/51 (43%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P+ P PPPPPPP P PPP PP P PP P PP Sbjct: 190 PMAGMPPPPPPPPPP------GFPGGAPPPPPP--PFGAPP-PPALNGGPP 231 Score = 36.3 bits (80), Expect = 0.040 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP PP P P P PPP G PPP Sbjct: 196 PPPPPPPPPGFPGGAPPPPPPP---FGAPPPP 224 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P PPPPP PPPPP P P P Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAPPP 223 Score = 33.9 bits (74), Expect = 0.21 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPP---XPPXXPXXXPPR 938 PPPPPPP P PPP PP PPR Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAPPPPALNGGPPR 232 Score = 31.9 bits (69), Expect = 0.86 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = +2 Query: 872 PRXPPPXPPPX-----PPXXPXPXPPPXPXXGXAPPPR 970 P PPP PPP PP P P P P PPR Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAPPPPALNGGPPR 232 Score = 31.9 bits (69), Expect = 0.86 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P PPPP P PPPPP P P Sbjct: 196 PPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 887 PXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P P P PPP G PPP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPP 214 Score = 29.5 bits (63), Expect = 4.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 P PP PPPPP P P P Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPP 213 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +2 Query: 152 PPPXWXPPXXP---PPPPXXPXXXPXP 223 PPP PP P PPPP P P P Sbjct: 197 PPPPPPPPGFPGGAPPPPPPPFGAPPP 223 Score = 29.1 bits (62), Expect = 6.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPP 536 P P G PPP P PPPP Sbjct: 201 PPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 Query: 460 PXPXXXGGXXPPPPPP 413 P P GG PPPPPP Sbjct: 202 PPPGFPGGAPPPPPPP 217 Score = 28.7 bits (61), Expect = 8.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 460 PXPXXXGGXXPPPPPPP 410 P P G PPPPPPP Sbjct: 201 PPPPGFPGGAPPPPPPP 217 Score = 27.1 bits (57), Expect(2) = 0.38 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -3 Query: 454 PXXXGGXXPPPPPPP 410 P G PPPPPPP Sbjct: 188 PSPMAGMPPPPPPPP 202 Score = 24.6 bits (51), Expect(2) = 0.38 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 Query: 328 PXGFXGXGGPPXPXPP 281 P GF G G PP P PP Sbjct: 203 PPGFPG-GAPPPPPPP 217 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 43.6 bits (98), Expect = 3e-04 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXP--PPXPPXXPXXXPPRAPRXAXXPPPA 971 P PPPP PP P P PP P P PP P A PPPA Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPA 99 Score = 38.7 bits (86), Expect = 0.007 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P PPPP A P PPP PP PP P A PPPA Sbjct: 58 PAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQP--APQPPPA 108 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRF 575 PP P PPPP P PPPP P P P F Sbjct: 67 PPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPHF 112 Score = 36.7 bits (81), Expect = 0.030 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 P P A P P PPPP P PPP PP P PP AP Sbjct: 53 PPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPP-PPAQPAPQPPPAP 109 Score = 36.3 bits (80), Expect = 0.040 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PP PPP PP PPP APPP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPP 77 Score = 36.3 bits (80), Expect = 0.040 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPP P PPPPP P P Sbjct: 66 PPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPP 106 Score = 36.3 bits (80), Expect = 0.040 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPP--PXPXXGXAPP 964 P PP PPP PP P PP P P APP Sbjct: 78 PAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 35.5 bits (78), Expect = 0.070 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P PPPP PPPPP P P P Sbjct: 57 PPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPP 97 Score = 35.5 bits (78), Expect = 0.070 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP PP PPPPP P P P Sbjct: 75 PPPPAAPPAAPPPPPPLPAPPPPP 98 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 P A P P PP P P PPP P P P P Sbjct: 58 PAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPP 98 Score = 34.3 bits (75), Expect = 0.16 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPX--PPPPPPPXXXXXXRAXPXXXPPPXPP 911 P P A P P PPPPPP A P PPP PP Sbjct: 62 PAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 33.5 bits (73), Expect = 0.28 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 PP A P P P PP P PPP P P P Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQP 105 Score = 31.9 bits (69), Expect = 0.86 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +3 Query: 894 PPPXPPXX-PXXXPPRAPRXAXXPPPAA 974 PPP PP P PP A A PPPAA Sbjct: 53 PPPSPPAAAPAAPPPPAAAPAAPPPPAA 80 Score = 30.7 bits (66), Expect = 2.0 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 3/55 (5%) Frame = +1 Query: 814 PXXXPPXPPPP---PPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 P PPPP PP P PP PP P P PPP Sbjct: 43 PHFISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPP 97 Score = 30.7 bits (66), Expect = 2.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXP 554 PPPPP P P PP P P Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAP 72 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P P P P PP PP P P Sbjct: 54 PPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAP 94 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P P P PPP P PPPP P P P Sbjct: 50 PPPPPPSPPAAAPA--APPPPAAAPAAPPPPAAPPAAPPPP 88 Score = 28.7 bits (61), Expect = 8.0 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 4/46 (8%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPP----XXPPPPPXXPXXXPXP 223 P P P P PP PP PPPPP P P P Sbjct: 62 PAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPP 107 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/49 (40%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPR--XAXXPPP 968 P PPPPPPP P PPP P PP +P+ A PPP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPP 742 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPPPPP P P P P PP P A PPP Sbjct: 710 PMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPP 756 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 6/51 (11%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPP------XXPXXXPPRAPRXAXXPPP 968 PPPPP P + P PPP PP P PP P A PPP Sbjct: 678 PPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPP 728 Score = 38.3 bits (85), Expect = 0.010 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 829 PXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 P PPPPPPP PP PP P G PPP Sbjct: 710 PMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPP 756 Score = 35.5 bits (78), Expect = 0.070 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 6/53 (11%) Frame = +3 Query: 804 GXXPLXXXPXPPP------PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 G P+ P PPP PPPP A PPP PP PP P Sbjct: 707 GTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPP 759 Score = 33.9 bits (74), Expect = 0.21 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 417 GGGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 G G PP G P PPPPP P PPPP P P Sbjct: 721 GCAGLPPPPPSPQPGCAGLPP---PPPPPPPGCAGLPPPPPPIDVP 763 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P PPPPP P PPP PP P Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPP 720 Score = 33.5 bits (73), Expect = 0.28 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +2 Query: 881 PPPXPPPXPPXX---PXPXPPPXPXXGXAPPP 967 PPP P P P P P PPP G PPP Sbjct: 726 PPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPP 757 Score = 33.1 bits (72), Expect = 0.37 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXP 542 PP P P PPPPP PPPPP P Sbjct: 701 PPPLLSGTLPMPPP---PPPPPPGCAGLPPPPPSP 732 Score = 32.7 bits (71), Expect = 0.49 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +1 Query: 826 PPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 PP PPPPPPP PP PP P G PPP Sbjct: 694 PPPPPPPPPPLLSGTLPM-------------PPPPPPPPPGCAGLPPP 728 Score = 31.9 bits (69), Expect = 0.86 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PPPPP P P P PP P P Sbjct: 697 PPPPPPPLLSGTLPMPPPPPPPPP 720 Score = 31.9 bits (69), Expect = 0.86 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +1 Query: 805 GXXPXXXPPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 G P PP PPPPP PP PP G P PPP Sbjct: 707 GTLPMPPPP--PPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPP 759 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +2 Query: 65 MXGNLXXXXXXPPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 + G L PP P P P PP PPPPP P P Sbjct: 705 LSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPP 757 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 5/24 (20%) Frame = +3 Query: 489 PPPPPXP-----XXXXPPPPPXPP 545 PPPPP P PPPPP PP Sbjct: 678 PPPPPLPVIEGSSLSVPPPPPPPP 701 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXP 547 PP G P P P PPP P PPP P P Sbjct: 702 PPLLSGTLPMPPP----PPPPPPGCAGLPPPPPSPQP 734 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 PP G + PPPPP P PP PP P Sbjct: 681 PPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPP 719 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPP---XXPPPPP 196 PP P P L PPP PP PPPPP Sbjct: 695 PPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPP 730 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 488 PXPPPXPRXXXPXPPPXPXPXP 553 P PPP P PPP P P P Sbjct: 713 PPPPPPPPGCAGLPPPPPSPQP 734 Score = 29.9 bits (64), Expect = 3.5 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 11/46 (23%) Frame = +3 Query: 465 PXTPXXXG-PPPPPXPXXXX-----PPPPPXP-----PXXPXPXXV 569 P P G PPPPP P PPPPP P P P P V Sbjct: 717 PPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDV 762 Score = 29.5 bits (63), Expect = 4.6 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 7/43 (16%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPP-------XXPPPPPXXP 205 PP P P L PPP PP PPPPP P Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPP 719 Score = 29.5 bits (63), Expect = 4.6 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPP 196 PP P P P PPP PPPPP Sbjct: 727 PPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPP 759 Score = 28.7 bits (61), Expect = 8.0 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXP 542 PP G P PPPP PPP P P Sbjct: 700 PPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQP 734 Score = 28.7 bits (61), Expect = 8.0 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +2 Query: 467 PHPXXXG-PXPPPXPRXXXPXPPPXPXPXPXPXXXXF 574 P P G P PPP P PP P P P F Sbjct: 732 PQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKPLF 768 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 43.2 bits (97), Expect = 3e-04 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PP PP P P PPP P PPP Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPP 232 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP PPP PP P P P P PPP Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPP 235 Score = 41.5 bits (93), Expect = 0.001 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +3 Query: 453 GXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 G P +P PPPP P PPPP PP P P Sbjct: 191 GTSHPTSPSQITQPPPPPPRPPPSPPPPPPPPSPSP 226 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXP-PPPPXPPXXPXP 560 P P PPPPP P P PPPP PP P P Sbjct: 208 PPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PR PP PPP PP P P PP P P P Sbjct: 209 PRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPP P P PP PP P PPR P A P P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPR-PLAAKLPEP 248 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P P P PPPPP P PPP PP P P PP Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPP 256 Score = 37.9 bits (84), Expect = 0.013 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXP--PXTPPXPXGGPXXPPP 969 P PP PPPPPPP P P PP P P PPP Sbjct: 208 PPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 36.7 bits (81), Expect = 0.030 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P PPP P PPP P PP P P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPP 232 Score = 36.3 bits (80), Expect = 0.040 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 PPPPPP R P PPP PP PP P + P AA Sbjct: 204 PPPPPP------RPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAA 243 Score = 36.3 bits (80), Expect = 0.040 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVR 572 P P PP PP P P PP PP P P R Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPR 239 Score = 35.9 bits (79), Expect = 0.053 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPP 935 P P PPPPPP A PPP P P PP Sbjct: 221 PPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 35.5 bits (78), Expect = 0.070 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPPPP P PP P PP P PP Sbjct: 216 PPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPP 260 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXP 205 PP P P P PPP PP PPPPP P Sbjct: 204 PPPPPPRPPPSPPP--PPPPPSPSPPRPPPPPPPSP 237 Score = 32.7 bits (71), Expect = 0.49 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 PP P P PP P P PPPPP PP Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRP-PPPPPPSPP 238 Score = 32.7 bits (71), Expect = 0.49 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXP 217 PPP PP PPPPP P P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSP 226 Score = 32.3 bits (70), Expect = 0.65 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP PP PPPPP P P Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRP 229 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P +P PPPPP P P P P P Sbjct: 212 PPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIP 252 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXX-PPPPPXPPXXP 554 PP P P PP PP P P PPP P P Sbjct: 217 PPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPP 256 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPP-PPXPPXXPXP 560 PP P P PP P PPP P PP P P Sbjct: 220 PPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 29.5 bits (63), Expect = 4.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 155 PPXWXPPXXPPPPPXXPXXXPXP 223 PP PP PPP P P P P Sbjct: 211 PPPSPPPPPPPPSPSPPRPPPPP 233 Score = 28.7 bits (61), Expect = 8.0 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPP 196 PP P P P P P PP PP PP Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP PP PPPP P P P Sbjct: 211 PPPS--PPPPPPPPSPSPPRPPPP 232 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 42.7 bits (96), Expect = 5e-04 Identities = 19/33 (57%), Positives = 19/33 (57%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 RGGG G GGG G G GG GGG GGG G Sbjct: 83 RGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGG 115 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G G GG GGG GGG G Sbjct: 94 GGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXR 815 GGG G GG G GG GGG G GGGGGGG G R Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFGGGGG--GGGGFGGGGGGGFGSRAR 132 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXR 815 A+ GG G GG G GG GGG G G GGGGG G R Sbjct: 78 ASVGGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFGSR 130 Score = 37.9 bits (84), Expect = 0.013 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -3 Query: 943 GARGGXXXGXXG-GXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 G RGG G G G GGG G GGGGGGG G G Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 37.9 bits (84), Expect = 0.013 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GG GGGGG G GGGGG G G Sbjct: 94 GGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 36.3 bits (80), Expect = 0.040 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXR 874 GGG G GGG G G GG GGG G R Sbjct: 102 GGGGGGGFGGGGGGGGGFGGGGGGGFGSRAR 132 Score = 34.7 bits (76), Expect = 0.12 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGGGG G GGGG G G GG Sbjct: 86 GFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 33.9 bits (74), Expect = 0.21 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -3 Query: 559 GXGXXGGXG-GGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG G GGGG G GGGGG G G GG Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 33.1 bits (72), Expect = 0.37 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG GGGGG G GGG G Sbjct: 105 GGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 32.3 bits (70), Expect = 0.65 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -3 Query: 574 KRTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 K+T G GG GGGG G GGG G G G Sbjct: 74 KKTRASVGGRGGGFGGGGGFGGGGGGGFGGGGGGGFG 110 Score = 31.9 bits (69), Expect = 0.86 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G G GGGGG GG GGG G Sbjct: 94 GGGGGGGFGGGGGGGFGGGGGGGGGFGGG 122 Score = 31.1 bits (67), Expect = 1.5 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -3 Query: 559 GXGXXGGXGGG-GGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G G GGG GG G GGGGG G G GG Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGG 123 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GG GGGG G GGG G G G Sbjct: 97 GGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G G GGG G G GGG G G GG Sbjct: 86 GFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 204 GXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G GGG G GG GGG G G G GG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGG 116 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGG G GGG G G G GG Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 204 GXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G GGGGG G GGG G G G GG Sbjct: 91 GGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG G GG G GG GGG G GGGGGGG G G Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Score = 41.9 bits (94), Expect = 8e-04 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 G G G GG G GG GGG G GGGGGGG G G Sbjct: 774 GDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G G GG GGG GGG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGG 800 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G G GG GGG GGG G Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGG 802 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 G G G GG G GG GGG G GGGGGGG G G Sbjct: 777 GDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G G GG GGG GGG G Sbjct: 839 GGGYADGDGGGGGGGGGGGGGGGGGGGGGGGG 870 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G GG G G GGG G GGGGGGG G G Sbjct: 817 GGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGG 868 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G GGG G G GG GGG GGG Sbjct: 847 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G GGG G G GG GGG GGG Sbjct: 848 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G GG G G G G G A GGGGGGG G G Sbjct: 813 GGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGG 864 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 G G G GG G GG GGG G GGGGGGG G Sbjct: 829 GYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 39.1 bits (87), Expect = 0.006 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G GG G GG GGG G G GGGG G G Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGG 822 Score = 39.1 bits (87), Expect = 0.006 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G G G GG GGG G G GGGGG G G Sbjct: 772 GGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGG 823 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGGGG G GGGGG G G GG Sbjct: 777 GDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGG 817 Score = 39.1 bits (87), Expect = 0.006 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG G GG G GG GGG G GGGGGG G G Sbjct: 782 GGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDG 833 Score = 38.7 bits (86), Expect = 0.007 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG G GG G G GGG G GGGGGGG G G Sbjct: 812 GGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGG 862 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 G G G GGG G G GG GGG GGG G Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGV 470 G G GG GGGGG G GGGGG GV Sbjct: 848 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGV 877 Score = 37.9 bits (84), Expect = 0.013 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GG GGGGG G GGGGG G G Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGG 802 Score = 37.9 bits (84), Expect = 0.013 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G GG G G GG G GGGGGGG G G Sbjct: 812 GGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGG 863 Score = 37.9 bits (84), Expect = 0.013 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGGG GG GGG G G G GG Sbjct: 812 GGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGG 853 Score = 37.9 bits (84), Expect = 0.013 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GG GGGGG G GGGGG G G Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 37.5 bits (83), Expect = 0.017 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGGG GG GGG G G G GG Sbjct: 777 GDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGG 818 Score = 36.7 bits (81), Expect = 0.030 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G G G GG G G GGGGGGG G G Sbjct: 815 GGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGG 866 Score = 35.9 bits (79), Expect = 0.053 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGGGG G GGG G G G GG Sbjct: 785 GGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Score = 35.9 bits (79), Expect = 0.053 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXX--GGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G GG G G GGG G GGGGGGG G G Sbjct: 823 GGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 35.1 bits (77), Expect = 0.092 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG G GG GG GGG G G GGG G G Sbjct: 793 GGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDG 839 Score = 35.1 bits (77), Expect = 0.092 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G G G GG G G GGGGGGG G G Sbjct: 821 GGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGG 872 Score = 35.1 bits (77), Expect = 0.092 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G G GGGGG G GGGGG G G Sbjct: 839 GGGYADGDGGGGGGGGGGGGGGGGGGGGGGGG 870 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 G G G GGGGG GG GGG G G G G Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDG 810 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G GGGGG GG GGG G G G GG Sbjct: 776 GGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGG 817 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G G GGG G G GGG G G G GG Sbjct: 785 GGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Score = 34.7 bits (76), Expect = 0.12 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G GG G GG GGG G GGG G G G Sbjct: 794 GGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADG 845 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G G GGG GG GGG G G G GG Sbjct: 774 GDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGG 815 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGGG GG GGG G G GG Sbjct: 783 GDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGG 824 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GG GGG G G GGGGG G G Sbjct: 796 GGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDG 827 Score = 34.3 bits (75), Expect = 0.16 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGG----GXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG G GG G GG GG G G GGGGGGG G G Sbjct: 805 GGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGG 860 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG GGGGG G G GGG Sbjct: 812 GGGGGGGGGGGGGGDGGGYGDGGG 835 Score = 33.5 bits (73), Expect = 0.28 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -1 Query: 222 GXGXXXGXXGGGG-GXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGG G GG GGG G G G GG Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGG 813 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG G GGG GGGGG G G GG Sbjct: 794 GGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGG 834 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG G GGG GGGGG G G GG Sbjct: 829 GYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGG 869 Score = 32.7 bits (71), Expect = 0.49 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G GG G G GG G GGG G G G G Sbjct: 789 GGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGG 840 Score = 32.7 bits (71), Expect = 0.49 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 6/58 (10%) Frame = -3 Query: 967 GGGXXAXRG-ARGGXXXGXXGGXGGGXXXGXARXXXXXXGGG-----GGGGXGXXXRG 812 GGG G GG G GG GGG G GGG GGGG G G Sbjct: 800 GGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGG 857 Score = 32.7 bits (71), Expect = 0.49 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGGG GG GGG G G G GG Sbjct: 839 GGGYADGDGGGGGGGGGGGGGGGGGGGGGGG----GGGGGGG 876 Score = 32.7 bits (71), Expect = 0.49 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GGGGG G GGGGG G G Sbjct: 841 GYADGDGGGGGGGGGGGGGGGGGGGGGGGGGG 872 Score = 32.3 bits (70), Expect = 0.65 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 195 GGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 GGGGG GG GGG G G G GG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGG 801 Score = 32.3 bits (70), Expect = 0.65 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G G G GGG G GGGGG G G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGG 800 Score = 32.3 bits (70), Expect = 0.65 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G G GGGG G GGGGG G G Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGG 801 Score = 31.9 bits (69), Expect = 0.86 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G G GGGGG G G GGG G G Sbjct: 806 GYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFG 837 Score = 31.9 bits (69), Expect = 0.86 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G G GGGGG GG GGG G Sbjct: 806 GYGDGDGGGGGGGGGGGGGGDGGGYGDGG 834 Score = 31.9 bits (69), Expect = 0.86 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G G GGG G GGG G G G GG Sbjct: 831 GDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGG 871 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G G GGG G GGG G G G GG Sbjct: 793 GGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGG 834 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGGG G GGG G G GG Sbjct: 814 GGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGG 854 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGG G GG GGG G G GG Sbjct: 818 GGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGG 859 Score = 30.3 bits (65), Expect = 2.6 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G G GGG G G GGG G G G GG Sbjct: 779 GGGGGDG-GGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGG 818 Score = 29.5 bits (63), Expect = 4.6 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G G GG GGG G G GGG G G Sbjct: 799 GGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGG 850 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 532 GGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 GGGG G GGGGG G G GG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGG 800 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 G G G GGG G G GGG G G G G Sbjct: 795 GGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGG 835 Score = 28.7 bits (61), Expect = 8.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G GGG G G GGG G G GG Sbjct: 780 GGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGG 820 Score = 28.7 bits (61), Expect = 8.0 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 G G G GGGG GG GGG G G G G Sbjct: 802 GDGGGYGDGDGGGG-GGGGGGGGGGDGGGYGDGGGFGDGGG 841 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 G G G GG G GG GGG G GGGGGGG G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGGGG G GGGGG G G GG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 697 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGGGG G GGGGG G G GG Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGGGG G GGGGG G G GG Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 37.9 bits (84), Expect = 0.013 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GG GGGGG G GGGGG G G Sbjct: 675 GGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 37.5 bits (83), Expect = 0.017 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG G GG G GG GGG G GGGGG G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 37.1 bits (82), Expect = 0.023 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGGG GG GGG G G G GG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 698 Score = 37.1 bits (82), Expect = 0.023 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGGG GG GGG G G G GG Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 37.1 bits (82), Expect = 0.023 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGGG GG GGG G G G GG Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 37.1 bits (82), Expect = 0.023 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G GG GGGGG G GGGGG G G GG Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 36.3 bits (80), Expect = 0.040 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G GG GGGGG G GGGGG G G GG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 35.1 bits (77), Expect = 0.092 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 G G G GGGGG GG GGG G G G G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGGG GG GGG G G G G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGGG GG GGG G G G G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 G G G GGGGG GG GGG G G G G Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G G GG GGGGG G GGG G G Sbjct: 680 GGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G GGGGG GG GGG G G G GG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G G GGG G G GGG G G G GG Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G G GGG G G GGG G G G GG Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G G GGG G G GGG G G G A G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG G GG G GG GGG G G G G G Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXG 439 G G G G GGG G G GGG G G G A G Sbjct: 671 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 33.5 bits (73), Expect = 0.28 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXG 106 G G G GGGGG GG GGG G G G Sbjct: 678 GGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 32.3 bits (70), Expect = 0.65 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 552 GXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G GGG G G GGG G G G GG Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 32.3 bits (70), Expect = 0.65 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 G G G GGGGG GG GGG G G G Sbjct: 676 GGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 31.9 bits (69), Expect = 0.86 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG GGGGG G G G G Sbjct: 687 GGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G GGG G G GGG G G G GG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 697 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G GGG G G GGG G G G GG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G G GG GGGGG G G G G Sbjct: 686 GGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = +2 Query: 773 PGXXPXRGGGGXXPPXXXXXXXXXXXXXXXXXXPRXPPPXPPPXPPXXPXPXPPPXPXXG 952 P P GG PP P P PPP PP P P PPP Sbjct: 155 PPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELA 214 Query: 953 XAPPP 967 PPP Sbjct: 215 APPPP 219 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 420 GGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 GG PP P PP P PPPPP PP P P Sbjct: 162 GGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPP 208 Score = 37.5 bits (83), Expect = 0.017 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = +3 Query: 813 PLXXXPXPP-PPPPPXXXXXXRAXPXXXPPPXPP--XXPXXXPPRAPRXAXXPPP 968 P+ P PPPPP P PPP P P PP AP PPP Sbjct: 100 PMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPP 154 Score = 37.5 bits (83), Expect = 0.017 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPP--XXPXXXPPRAPRXAXXPPP 968 P PPPP RA P PPP P P PP AP PPP Sbjct: 124 PSPPPPPTSPATRAPP--PPPPIAPATGGPPPPPPIAPATGGPPPP 167 Score = 37.1 bits (82), Expect = 0.023 Identities = 20/68 (29%), Positives = 21/68 (30%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRX 950 P P GG P P P P PPP PP P PP Sbjct: 154 PPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILEL 213 Query: 951 AXXPPPAA 974 A PPP + Sbjct: 214 AAPPPPGS 221 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPP 545 P GPPPPP P PPPPP PP Sbjct: 190 PPSGGPPPPPPP----PPPPPPPP 209 Score = 36.7 bits (81), Expect = 0.030 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 4/52 (7%) Frame = +3 Query: 426 GGXXPPXXXGXGX----PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 GG PP P P PPPP PPPPP PP P P + Sbjct: 162 GGPPPPPPIAPAATVPAPAVPLAAASPPPPS---GGPPPPPPPPPPPPPPPI 210 Score = 36.7 bits (81), Expect = 0.030 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXPXGGXXXXXLXXEKXXXXX 277 P P P PPP PP PPPPP P P G L K Sbjct: 177 PAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPPGSVLGAALTGIKSGVVG 236 Query: 278 XGG 286 GG Sbjct: 237 GGG 239 Score = 35.9 bits (79), Expect = 0.053 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P P P P PPP APPP Sbjct: 112 PPPRAPETPSQAPSPPPPPTSPATRAPPP 140 Score = 35.5 bits (78), Expect = 0.070 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P P GPPPPP PPP PP P Sbjct: 143 PIAPATGGPPPPPPIAPATGGPPPPPPIAP 172 Score = 35.1 bits (77), Expect = 0.092 Identities = 18/52 (34%), Positives = 20/52 (38%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGG 593 PP G G P P PPPPP PPPP ++ GGG Sbjct: 188 PPPPSG-GPPPPPPPPPPPPPPPILELAAPPPPGSVLGAALTGIKSGVVGGG 238 Score = 34.3 bits (75), Expect(2) = 0.003 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +3 Query: 678 PGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXXXPXPPPPPPP 854 P G P GGP P P A P P PPPPPPP Sbjct: 146 PATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPP 204 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P +P PPPPP PPP PP P Sbjct: 130 PTSPATRAPPPPPPIAPATGGPPPPPPIAP 159 Score = 33.1 bits (72), Expect = 0.37 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 6/58 (10%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXP----XXXPPPXPPXXP--XXXPPRAPRXAXXPPP 968 P P PPPP P P PPP PP P P P A PPP Sbjct: 133 PATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPP 190 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P TP PPPP PPP PP P Sbjct: 117 PETPSQAPSPPPPPTSPATRAPPPPPPIAP 146 Score = 32.3 bits (70), Expect = 0.65 Identities = 21/74 (28%), Positives = 21/74 (28%) Frame = -3 Query: 805 PXPPAXGRXXRGXXXXXXXXXXXXGPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXL 626 P PP R GPPPPP G P P P AP A Sbjct: 126 PPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPP-PPPPIAPAATVPAPAVPLA 184 Query: 625 XVXXXXXXGRXPPP 584 G PPP Sbjct: 185 AASPPPPSGGPPPP 198 Score = 31.9 bits (69), Expect = 0.86 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 455 ARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 A P P GP PPP P P PP P P Sbjct: 184 AAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPP 218 Score = 31.1 bits (67), Expect = 1.5 Identities = 21/68 (30%), Positives = 22/68 (32%), Gaps = 1/68 (1%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXP-PXXPXXXPPRAPR 947 PR + P P PPPP P PP P P PP AP Sbjct: 114 PRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAP- 172 Query: 948 XAXXPPPA 971 A P PA Sbjct: 173 AATVPAPA 180 Score = 30.7 bits (66), Expect = 2.0 Identities = 27/107 (25%), Positives = 30/107 (28%) Frame = -3 Query: 730 PPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXXXXXXGRXPPPXXXKRTXXGXG 551 PPPPP P P P +P R + G PPP T Sbjct: 110 PPPPPRAPETPSQ--APSPPPPPTSPATRAPPPPPPIAPATG-GPPPPPPIAPAT----- 161 Query: 550 XXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPPPPPP 410 GG + P GG PPPPPPP Sbjct: 162 -----GGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPP 203 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXA 958 P PPP PPP P PPP G A Sbjct: 198 PPPPPPPPPPPPILELAAPPPPGSVLGAA 226 Score = 29.5 bits (63), Expect(2) = 0.11 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -1 Query: 453 PXXXGGXXPPPPPPP 409 P GG PPPPPPP Sbjct: 189 PPPSGGPPPPPPPPP 203 Score = 29.1 bits (62), Expect = 6.1 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 8/49 (16%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGP----PPPPXP----XXXXPPPPPXPPXXPXP 560 PP P P P PPPP P PPPPP P P Sbjct: 129 PPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVP 177 Score = 28.7 bits (61), Expect = 8.0 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 3/58 (5%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXP---XPXPXXXXFXXXGGGGXP 601 PP A P P PP P P PPP P P P GG P Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPP 167 Score = 26.2 bits (55), Expect(2) = 0.90 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -1 Query: 453 PXXXGGXXPPPPPPP 409 P G PPPPPPP Sbjct: 190 PPSGGPPPPPPPPPP 204 Score = 25.0 bits (52), Expect(2) = 0.003 Identities = 13/46 (28%), Positives = 13/46 (28%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRP 602 P P P P PPPP P P GG P Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPP 153 Score = 24.2 bits (50), Expect(2) = 0.90 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 429 PPPPPPPXXXL 397 PPPPPPP L Sbjct: 201 PPPPPPPPPIL 211 Score = 24.2 bits (50), Expect(2) = 0.11 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 429 PPPPPPPXXXL 397 PPPPPPP L Sbjct: 203 PPPPPPPILEL 213 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G G GG GGG GGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G G GG GGG GGG G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G G GG GGG GGG G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G G GG GGG GGG G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G G GG GGG GGG G Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 37.9 bits (84), Expect = 0.013 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GG GGGGG G GGGGG G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 37.9 bits (84), Expect = 0.013 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GG GGGGG G GGGGG G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 37.9 bits (84), Expect = 0.013 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GG GGGGG G GGGGG G G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 37.9 bits (84), Expect = 0.013 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GG GGGGG G GGGGG G G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 37.9 bits (84), Expect = 0.013 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GG GGGGG G GGGGG G G Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 37.5 bits (83), Expect = 0.017 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -3 Query: 934 GGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG G GG GGG G GGGGGGG G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 35.5 bits (78), Expect = 0.070 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 934 GGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 GG G GG GGG G GGGGGGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 35.1 bits (77), Expect = 0.092 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 931 GXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 G G GG GGG G GGGGGGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 919 GXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 G GG GGG G GGGGGGG G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 33.1 bits (72), Expect = 0.37 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 541 GXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G GGGGG G GGGGG G G GG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 32.7 bits (71), Expect = 0.49 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 910 GGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG GGG G GGGGGGG G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 32.3 bits (70), Expect = 0.65 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 195 GGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 GGGGG GG GGG G G G GG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 32.3 bits (70), Expect = 0.65 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 195 GGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 GGGGG GG GGG G G G GG Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 32.3 bits (70), Expect = 0.65 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 195 GGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 GGGGG GG GGG G G G GG Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 31.9 bits (69), Expect = 0.86 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G G GGGGG GG GGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 160 Score = 31.9 bits (69), Expect = 0.86 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G G GGGGG GG GGG G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 161 Score = 31.9 bits (69), Expect = 0.86 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G G GGGGG GG GGG G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 162 Score = 31.9 bits (69), Expect = 0.86 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G G GGGGG GG GGG G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 31.9 bits (69), Expect = 0.86 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G G GGGGG GG GGG G Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 31.9 bits (69), Expect = 0.86 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G G GGGGG GG GGG G Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 31.9 bits (69), Expect = 0.86 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G G GGGGG GG GGG G Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 31.9 bits (69), Expect = 0.86 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G G GGGGG GG GGG G Sbjct: 140 GGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 204 GXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 G GGGGG GG GGG G G G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 204 GXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 G GGGGG GG GGG G G G G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 204 GXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G GGGGG GG GGG G G G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 216 GXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXG 106 G G GGGGG GG GGG G G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG G GG G G GGG G GGGGGGG G Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 37.5 bits (83), Expect = 0.017 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G GG GGGGG G GGGGG G G GG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGG 100 Score = 36.7 bits (81), Expect = 0.030 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = -3 Query: 943 GARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPPAXGRXXRG 770 G GG G GG GGG G GGGGGG G G GR G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFG 119 Score = 36.7 bits (81), Expect = 0.030 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG GGGGG G GGGGG Sbjct: 88 GGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 36.3 bits (80), Expect = 0.040 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGGGG G GGGG G G GG Sbjct: 69 GGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 35.9 bits (79), Expect = 0.053 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G G GG G GGG G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDG 93 Score = 35.9 bits (79), Expect = 0.053 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG G GG G GG G G GGGGGG G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 35.1 bits (77), Expect = 0.092 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G GG G GG GG G GGG GGG G G Sbjct: 62 GGGGGG--GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGGG G GGG G G G GG Sbjct: 67 GGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGG 108 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 204 GXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G GGGGG GG GGG G G G GG Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGG 99 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGGGG GGGG G G GG Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGG 108 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G G G GGGGG G GGGGG G Sbjct: 86 GDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 33.5 bits (73), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 195 GGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 GGGGG GG GGG G G G GG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGG 94 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGGGG G GGG G G GG Sbjct: 67 GGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGG 107 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGGG G G GGG G G GG Sbjct: 72 GGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 32.7 bits (71), Expect = 0.49 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 552 GXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G GGG G G GGG G G G GG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGG 100 Score = 32.7 bits (71), Expect = 0.49 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 216 GXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 G G GGGGG GG GGG G G G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGG 100 Score = 32.3 bits (70), Expect = 0.65 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G GG G GGG G GGGGG G G Sbjct: 83 GDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGGG GGG G G G GG Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G G GGG G G GGG G G GG Sbjct: 69 GGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G G GGG G GGG G G G GG Sbjct: 70 GGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 204 GXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G GGGGG GG GGG G G GG Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGG 98 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 204 GXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G GGGGG GG GGG G G GG Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGG 100 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXR 874 GGG G GGG G G GG GGG G R Sbjct: 88 GGGGDGGGGGGGGDG-GGGGGGGGGGVGRAR 117 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 G G G GGG GG GGG G G G G Sbjct: 72 GGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G GGGGG GG GGG G Sbjct: 86 GDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPP 966 P PP PPPPPPP P P PP P P PP Sbjct: 102 PPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPP 152 Score = 39.9 bits (89), Expect = 0.003 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPP 545 P PPPPP P PPPPP PP Sbjct: 97 PACCAPPPPPPPPPPPPPPPPPPP 120 Score = 38.3 bits (85), Expect = 0.010 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPP 937 PPP PPP PP P P PPP Sbjct: 102 PPPPPPPPPPPPPPPPPPP 120 Score = 37.5 bits (83), Expect = 0.017 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPP 545 P P PPPP P PPPPP PP Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPP 119 Score = 35.9 bits (79), Expect = 0.053 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 4/28 (14%) Frame = +2 Query: 872 PRXPP----PXPPPXPPXXPXPXPPPXP 943 P PP P PPP PP P P PPP P Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P PP PPPPP PP P P Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPP 116 Score = 32.7 bits (71), Expect = 0.49 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PP PP PPPPP P P P Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPP 119 Score = 32.3 bits (70), Expect = 0.65 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +3 Query: 786 PXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPP 911 P + P P PPPPPPP P PPP PP Sbjct: 88 PTSCAPACPPACCAPPPPPPPPP---------PPPPPPPPPP 120 Score = 31.9 bits (69), Expect = 0.86 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 12/53 (22%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXP------------XXXXPPPPPXPPXXPXP 560 PP P P PPPPP P P PPP PP P P Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAP 148 Score = 31.9 bits (69), Expect = 0.86 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 137 PLFXXPPPXWXPPXXPPPPPXXP 205 P PPP PP PPPPP P Sbjct: 97 PACCAPPPPPPPPPPPPPPPPPP 119 Score = 31.1 bits (67), Expect = 1.5 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXP 205 PPP PP PPPPP P Sbjct: 103 PPPPPPPPPPPPPPPPPP 120 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PP P P PPP P PPP Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 29.9 bits (64), Expect = 3.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P PP P PPP P PPP Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPP 116 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 7/43 (16%) Frame = +3 Query: 828 PXPPPPPPPXXXXXX-------RAXPXXXPPPXPPXXPXXXPP 935 P PPPPPPP + PP PP P PP Sbjct: 138 PPPPPPPPPAPCMPPCHQTQVVHSVQLHASPPGPPPAPMPAPP 180 Score = 29.5 bits (63), Expect = 4.6 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P PP P P PPP P PPP Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPPP 119 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 170 PPXXPPPPPXXPXXXPXP 223 PP PPPPP P P P Sbjct: 103 PPPPPPPPPPPPPPPPPP 120 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPPPP P PPP P PP A PPP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPP 704 Score = 37.9 bits (84), Expect = 0.013 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 414 GGGGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP 536 GG GG PP P P PPPPP PPPPP Sbjct: 669 GGQAGGAPPPPP-----PPLPGGAAPPPPPPIGGGAPPPPP 704 Score = 35.9 bits (79), Expect = 0.053 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 P PP PPPPPP PP PP G P PPP Sbjct: 656 PEAGPPPPPPPPP--GGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 33.5 bits (73), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP 536 PP G P PPPPP P PPPPP Sbjct: 665 PPPPGGQAGGAPP----PPPPPLPGGAAPPPPP 693 Score = 33.1 bits (72), Expect = 0.37 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +3 Query: 471 TPXXXGPPPPPXP---XXXXPPPPPXPPXXPXPXXVRFXXXGGGXRP 602 TP PPPPP P PPPP PP GGG P Sbjct: 655 TPEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPP 701 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -3 Query: 487 PXXXGVXGXPXPXXXGGXXPPPPPP 413 P G P P GG PPPPPP Sbjct: 681 PPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -3 Query: 490 GPXXXGVXGXPXPXXXGGXXPPPPPP 413 G G P P GG PPPPPP Sbjct: 669 GGQAGGAPPPPPPPLPGGAAPPPPPP 694 Score = 29.5 bits (63), Expect = 4.6 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXPXGG 232 PP P P P PPP PPPPP P P G Sbjct: 663 PPPPPPGGQAGGAPP-PPPPPLPGGAAPPPPPPIGGGAPPPPPPG 706 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 460 PXPXXXGGXXPPPPPPP 410 P P G PPPPPPP Sbjct: 666 PPPGGQAGGAPPPPPPP 682 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 5/32 (15%) Frame = +2 Query: 872 PRXPPPXP-----PPXPPXXPXPXPPPXPXXG 952 P PPP P PP PP PPP P G Sbjct: 677 PPPPPPLPGGAAPPPPPPIGGGAPPPPPPGFG 708 Score = 29.1 bits (62), Expect = 6.1 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +2 Query: 485 GPXPPPXPRXXXPX---PPPXPXPXPXPXXXXFXXXGGGGXP 601 GP PPP P PPP P P P GGG P Sbjct: 659 GPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAP 700 Score = 27.1 bits (57), Expect(2) = 0.23 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = -3 Query: 430 PPPPPPPXXXXVXCXXXXXXXXXXXXXXXXXXXXPXGFXGXGGPPXPXPPG 278 PPPPPPP P G GG P P PPG Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIG----GGAPPPPPPG 706 Score = 25.4 bits (53), Expect(2) = 0.23 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -3 Query: 439 GXXPPPPPPP 410 G PPPPPPP Sbjct: 659 GPPPPPPPPP 668 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P PP PP A P PPP P P P P A PPPA Sbjct: 162 PQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPA 207 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 P PPP P PP P PP P APP Sbjct: 179 PAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 33.5 bits (73), Expect = 0.28 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXP 920 P PP PPPP A P PP PP P Sbjct: 171 PFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPP 206 Score = 31.9 bits (69), Expect = 0.86 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXP 205 PP P P P PP PP PPPPP P Sbjct: 178 PPAPPPPGA----PAAPPAPPFGGPPSAPPPPPAPP 209 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P P P PP P PP P PP P Sbjct: 179 PAPPPPGAPAAPPAPPFGGPPSAPPPPPAP 208 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 PP P P GPP PPPPP PP Sbjct: 181 PPPPGAPAAPPAPPFGGPP-------SAPPPPPAPP 209 Score = 28.7 bits (61), Expect = 8.0 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 488 PXPPPXPRXXXPXPPPXPXPXPXPXXXXFXXXGGGG 595 P PPP P PP P P GGGG Sbjct: 179 PAPPPPGAPAAPPAPPFGGPPSAPPPPPAPPVGGGG 214 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 41.1 bits (92), Expect = 0.001 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P PPPPP P PPPPP PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 40.7 bits (91), Expect = 0.002 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 PPP PPP PP P PPP P PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P PPPPP PPPPP PP P P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P P PPPP P PPPPP PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP PPP PP P P PPP P PPP Sbjct: 1157 PPPPPPPPPP-PPSSPSPPPPPPP---PPPPP 1184 Score = 37.9 bits (84), Expect = 0.013 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPP 911 P PPPPPPP P PPP PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 37.9 bits (84), Expect = 0.013 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXP 920 PPPPPPP + P PPP PP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 35.9 bits (79), Expect = 0.053 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 4/28 (14%) Frame = +3 Query: 489 PPPPPXPXXXXP----PPPPXPPXXPXP 560 PPPPP P P PPPP PP P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 35.9 bits (79), Expect = 0.053 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXP 943 P PPP P PP P P PPP P Sbjct: 1163 PPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXP 932 PPPPPPP P PPP PP P P Sbjct: 1157 PPPPPPPPPPPPSSPSP---PPPPPPPPPPPTP 1186 Score = 31.9 bits (69), Expect = 0.86 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP PP P PPP P P P Sbjct: 1161 PPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP PP PPPPP P P P Sbjct: 1157 PPP---PPPPPPPPPSSPSPPPPP 1177 Score = 30.7 bits (66), Expect = 2.0 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 814 PXXXPPXPPPPPPP 855 P PP PPPPPPP Sbjct: 1171 PSPPPPPPPPPPPP 1184 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXP 217 PPP P PPPPP P P Sbjct: 1165 PPPPSSPSPPPPPPPPPPPPTP 1186 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P P PPPPPPP P Sbjct: 1166 PPPSSPSPPPPPPPPPP 1182 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P P PPPPPPP P Sbjct: 1167 PPSSPSPPPPPPPPPPP 1183 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P P PPPPPPP P Sbjct: 1168 PSSPSPPPPPPPPPPPP 1184 Score = 28.7 bits (61), Expect = 8.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP PP P PP P P P Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPPP 1183 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/51 (43%), Positives = 23/51 (45%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXR 815 GGG + G GG G GG GGG G R GG GGGG G R Sbjct: 185 GGGYRSGGGGYGGSKGGYGGGSGGG-GYGGGRGGGGYGGGHGGGGYGGGGR 234 Score = 33.9 bits (74), Expect = 0.21 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 +GGG G GG G GG GGG GG RG Sbjct: 184 QGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRG 216 Score = 33.9 bits (74), Expect = 0.21 Identities = 21/54 (38%), Positives = 23/54 (42%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 + GGG +G GG G GG GGG G GGGG GG G G Sbjct: 190 SGGGGYGGSKGGYGGGSGG--GGYGGGRGGG---GYGGGHGGGGYGGGGRHDYG 238 Score = 31.1 bits (67), Expect = 1.5 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 G G G RGG G GG GGG G R GG GGG Sbjct: 205 GSGGGGYGGGRGGGGYG--GGHGGGGYGGGGR--HDYGGGSKGGG 245 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G GG GGG G G G GGG G G Sbjct: 197 GSKGGYGGGSGGGGYGGGRGGGGYGGGHGG 226 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 RGGG GGG G G GGG GG Sbjct: 215 RGGGGYGGGHGGGGYGGGGRHDYGGGSKGG 244 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G GG G GGG G GGG G G G Sbjct: 204 GGSGGGGYGGGRGGGGYGGGHGGGGYGGGG 233 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 A GGG G GG G GG G G G A GGGGGGG G Sbjct: 39 ADGGGGGG--GGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDG 85 Score = 33.9 bits (74), Expect = 0.21 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 GG GGGGG G GGGGG G GG Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGG 76 Score = 32.3 bits (70), Expect = 0.65 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG G GG G G G G A GGG G G G Sbjct: 43 GGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDG 89 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 204 GXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G GGGGG GG GGG G GG Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGG 76 Score = 29.9 bits (64), Expect = 3.5 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 965 GGXXGPPXGXGGVXGGXXXXXXXXXXXXXXXXAXGXXGGGGGGGXGGXXXG 813 GG G G GG GG A G GGGGGG G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDG 91 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 863 GXXGGGGGGGXGGXXXGXXPXPPRARAXXPG 771 G GGGGGGG GG G A A G Sbjct: 47 GGGGGGGGGGGGGDGDGDGDGDANANADGGG 77 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 863 GXXGGGGGGGXGGXXXGXXPXPPRARAXXPG 771 G GGGGGGG GG G A A G Sbjct: 45 GGGGGGGGGGGGGGGDGDGDGDGDANANADG 75 Score = 28.7 bits (61), Expect = 8.0 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -2 Query: 968 GGGXXGPPXGXGGVXGGXXXXXXXXXXXXXXXXAXGXXGGGGGGGXGGXXXG 813 GGG G G GG GG A GGGGGGG G G Sbjct: 41 GGGGGG---GGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDG 89 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPPPP A PPP PP PP + PPP Sbjct: 281 PPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPP 325 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPPPP + PPP P PP P PPP Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPP 326 Score = 35.5 bits (78), Expect = 0.070 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXP 542 PPPPP P PPPPP P Sbjct: 312 PPPPPEPTSELPPPPPPP 329 Score = 33.5 bits (73), Expect = 0.28 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 492 PPPPXPXXXXPPPPPXPPXXPXP 560 PPPP P PPPPP P P Sbjct: 301 PPPPPPTDFAPPPPPPEPTSELP 323 Score = 32.7 bits (71), Expect = 0.49 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 4/28 (14%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXP----PXXPXP 560 PPPPP PPPPP P P P P Sbjct: 301 PPPPPPTDFAPPPPPPEPTSELPPPPPP 328 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 1/48 (2%) Frame = +1 Query: 829 PXPPPPPPPXXPXXXXXXXXXXXXXXXXXX-PPXTPPXPXGGPXXPPP 969 P PPPPPP P PP PP P PPP Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPP 327 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP G + PPPPP PPPP P P Sbjct: 285 PPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPP 325 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 453 GXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 G P P PPPP P PPP PP Sbjct: 298 GFQPPPPPPTDFAPPPPPPEPTSELPPPPPP 328 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXP 542 PP P G PPP P PPPP P Sbjct: 282 PPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPP 316 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 4/28 (14%) Frame = +2 Query: 872 PRXPP----PXPPPXPPXXPXPXPPPXP 943 P PP P PPP P P PPP P Sbjct: 302 PPPPPTDFAPPPPPPEPTSELPPPPPPP 329 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 429 GXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP 536 G PP G P PPPPP P PPPPP Sbjct: 344 GAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPP 379 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 6/54 (11%) Frame = +1 Query: 826 PPXPPP------PPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 PP PPP PPPP PP PP P GGP PPP Sbjct: 326 PPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPP 379 Score = 39.1 bits (87), Expect = 0.006 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 7/46 (15%) Frame = +3 Query: 429 GXXPPXXXGXGXPXTPXXX--GPPPPPXPXXXXPP-----PPPXPP 545 G PP G P P GPPPPP P PP PPP PP Sbjct: 352 GMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPP 397 Score = 38.7 bits (86), Expect = 0.007 Identities = 39/142 (27%), Positives = 40/142 (28%), Gaps = 4/142 (2%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXXXX 644 P P G PPP P PPPPP P P R G P + Sbjct: 287 PPPPPSRGAAPPP-PSRGAPPPPPSRGSAPPPPPARM---GTAPPPPPPSRSSQRPPPPS 342 Query: 645 RAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXX 824 R G P P P GG P P P G L Sbjct: 343 R--------GAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPP---PPPIEGRPPSSLGN 391 Query: 825 XPXPPPP----PPPXXXXXXRA 878 P PPPP PPP RA Sbjct: 392 PPPPPPPGRGAPPPGPMIPGRA 413 Score = 38.7 bits (86), Expect = 0.007 Identities = 33/109 (30%), Positives = 34/109 (31%), Gaps = 2/109 (1%) Frame = -3 Query: 730 PPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXXXXXXGRXPPPXXXKRTXXGXG 551 PPPP G P P AP P AR R PPP G Sbjct: 297 PPPPSRG----APPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMG 352 Query: 550 XXGGXGGGGGXXXXGXG--GGGGPXXXGVXGXPXPXXXGGXXPPPPPPP 410 GG GG P + G P P G PPPPPPP Sbjct: 353 MAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRP-PSSLGN--PPPPPPP 398 Score = 38.3 bits (85), Expect = 0.010 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 2/61 (3%) Frame = +3 Query: 426 GGXXPPXXXGXGXPXTPXXXG--PPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXR 599 G PP G P P G PPPPP PPPP P P GG Sbjct: 303 GAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAA 362 Query: 600 P 602 P Sbjct: 363 P 363 Score = 37.9 bits (84), Expect = 0.013 Identities = 22/64 (34%), Positives = 24/64 (37%), Gaps = 3/64 (4%) Frame = +3 Query: 786 PXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPP---XPPXXPXXXPPRAPRXAX 956 P + G P+ PPPPPPP P PPP PP PP P Sbjct: 348 PPSMGMAPPPVGGAAPPPPPPPPV------GGPPPPPPPIEGRPPSSLGNPPPPPPPGRG 401 Query: 957 XPPP 968 PPP Sbjct: 402 APPP 405 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 429 GXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP 536 G PP G P G PPPP PPPPP Sbjct: 284 GIQPPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPP 319 Score = 36.7 bits (81), Expect = 0.030 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 426 GGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP 536 G PP G P PPPPP PPPPP Sbjct: 294 GAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPP 330 Score = 35.5 bits (78), Expect = 0.070 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 5/65 (7%) Frame = +3 Query: 786 PXAGGXGXXPLXXXPXPPP-----PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRX 950 P G P P PPP PPPP A PPP PP PP R Sbjct: 291 PSRGAAPPPPSRGAPPPPPSRGSAPPPPP------ARMGTAPPPPPPSRSSQRPPPPSRG 344 Query: 951 AXXPP 965 A PP Sbjct: 345 APPPP 349 Score = 35.5 bits (78), Expect = 0.070 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +3 Query: 426 GGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 GG PP G P + PPPPP P PPP P P Sbjct: 372 GGPPPPPPPIEGRPPSSLGNPPPPPP-PGRGAPPPGPMIP 410 Score = 35.1 bits (77), Expect = 0.092 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 429 GXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 G PP G P P G PPP P PPP PP Sbjct: 294 GAAPPPP-SRGAPPPPPSRGSAPPPPPARMGTAPPPPPP 331 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PP PPP P G APPP Sbjct: 289 PPPSRGAAPPPPSRGAPPPPPSRGSAPPP 317 Score = 34.3 bits (75), Expect = 0.16 Identities = 18/61 (29%), Positives = 19/61 (31%) Frame = +3 Query: 786 PXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P + G P PPPPP R P P PP PP PP Sbjct: 308 PPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPP 367 Query: 966 P 968 P Sbjct: 368 P 368 Score = 33.9 bits (74), Expect = 0.21 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 843 PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPP P PP PP PP R PPP Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPP 328 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 PP GA P P G PPP P PPP P P P Sbjct: 339 PPPSRGA---PPPPSMGMAPPPVGGAAPPPPPPPPVGGPPP 376 Score = 32.7 bits (71), Expect = 0.49 Identities = 30/107 (28%), Positives = 32/107 (29%) Frame = -3 Query: 730 PPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXXXXXXGRXPPPXXXKRTXXGXG 551 PPPPP G P AP P +R G PPP R+ Sbjct: 287 PPPPPS----RGAAPPPPSRGAPPPPPSRGSAPP---PPPARMGTAPPPPPPSRSSQRPP 339 Query: 550 XXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPPPPPP 410 G G P P P GG PPPPPPP Sbjct: 340 PPSR----GAPPPPSMGMAPPPVGGAAPPPPPPPPVGG--PPPPPPP 380 Score = 32.7 bits (71), Expect = 0.49 Identities = 17/51 (33%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = +3 Query: 834 PPPP----PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 PPPP PPP PP PP P PP P PP++ Sbjct: 338 PPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSS 388 Score = 31.9 bits (69), Expect = 0.86 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +3 Query: 441 PXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPX---PPXXPXP 560 P G P P PPP PPPPP PP P P Sbjct: 338 PPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPP 380 Score = 31.1 bits (67), Expect = 1.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 456 APXXXGGXXPPPPPPP 409 AP GG PPPPPPP Sbjct: 354 APPPVGGAAPPPPPPP 369 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 420 GGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPP 533 G PP G P P PP P PPPP Sbjct: 312 GSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPP 349 Score = 30.3 bits (65), Expect = 2.6 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 6/52 (11%) Frame = +3 Query: 423 GGGXXPPXXXGXGXPXTPXXXGPPPP------PXPXXXXPPPPPXPPXXPXP 560 G PP P G PPP P P PPPP PP P Sbjct: 323 GTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGP 374 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 425 GGXXPPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 G PP A P P G PPP P P P P P Sbjct: 352 GMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPP 396 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/46 (30%), Positives = 16/46 (34%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 PPPPP + PPP P P R PPP+ Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPS 332 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G GGG G G GG GGG GGG Sbjct: 456 GGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 37.9 bits (84), Expect = 0.013 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GG G G GG GGG GGG G Sbjct: 452 GGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGG 483 Score = 36.7 bits (81), Expect = 0.030 Identities = 18/34 (52%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -1 Query: 969 RGG-GAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 RGG G G G G G G GG GGG GGG G Sbjct: 442 RGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGG 475 Score = 35.5 bits (78), Expect = 0.070 Identities = 18/34 (52%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGX--GXXGGXGGGXGGGXRG 871 GGG G GGG G G GG GGG GGG G Sbjct: 446 GGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGG 479 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 937 RGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 RGG G GG G G G GGG GGG G G Sbjct: 442 RGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGG 483 Score = 32.3 bits (70), Expect = 0.65 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 934 GGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 G G GG GGG G GGG GGG G G Sbjct: 439 GDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGG 479 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -3 Query: 961 GXXAXRGARGGXXXGXXGGXGG-GXXXGXARXXXXXXGGGGGGGXG 827 G RG GG G G GG G G GGG GGG G Sbjct: 437 GVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDG 482 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 216 GXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGG GG GGG G G GG Sbjct: 437 GVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGG 476 Score = 29.5 bits (63), Expect = 4.6 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 GGG G GG G GG GGG G GGG GGG Sbjct: 446 GGGDGGGGGDGGGD--GIDGGDGGGDGGGDG----GGDGGGDGGG 484 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -3 Query: 559 GXGXXGGXGGG-GGXXXXGXGGGGG 488 G G GG GGG GG G GGG G Sbjct: 458 GDGIDGGDGGGDGGGDGGGDGGGDG 482 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 571 RTXXGXGXXGGXGGGGGXXXXGXGGGG 491 R G G GG G GGG G GGG Sbjct: 442 RGGDGGGDGGGGGDGGGDGIDGGDGGG 468 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 39.1 bits (87), Expect = 0.006 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGG-GGGGXGXXXRG 812 GGG RG GG G GG GGG G GGG GGGG G G Sbjct: 157 GGGGYRGRGRGGGGYGG--GGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSG 207 Score = 37.1 bits (82), Expect = 0.023 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG RG GG G GGG G GGGG GG G G Sbjct: 129 GGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGG 180 Score = 35.9 bits (79), Expect = 0.053 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGG-GGGGXGXXXRG 812 +GGG G RGG G GGG G GGG GGGG G G Sbjct: 144 SGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYG 197 Score = 35.5 bits (78), Expect = 0.070 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG G GG G GG GG G GGG GG G Sbjct: 182 GGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 Score = 35.1 bits (77), Expect = 0.092 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGX--GGGXXXGXARXXXXXXGGG-GGGGXGXXXRG 812 GGG G R G GG GGG G R GGG GGGG G G Sbjct: 133 GGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHG 187 Score = 35.1 bits (77), Expect = 0.092 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG GGG G G GG GGG GG G Sbjct: 178 GGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYG 209 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G G GGGGG G GGGGG G G Sbjct: 190 GYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGG 221 Score = 34.3 bits (75), Expect = 0.16 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG G GG G G GGG G GGGGG G G G Sbjct: 172 GGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGG 222 Score = 34.3 bits (75), Expect = 0.16 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 GGG G GG G G GGG G GGGG GG Sbjct: 177 GGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGG 221 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGG GG GGG G G G GG Sbjct: 177 GGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGG 218 Score = 33.9 bits (74), Expect = 0.21 Identities = 22/54 (40%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGG--GXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG + G RGG G GG GG G G GGGG GG G G Sbjct: 139 GGGYRSGGGYRGGG--GYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGG 190 Score = 33.9 bits (74), Expect = 0.21 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGG GG GGG G G G GG Sbjct: 157 GGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGG 198 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGG GG GGG G G G GG Sbjct: 129 GGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGG 170 Score = 33.5 bits (73), Expect = 0.28 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG GGGG G GGGGG Sbjct: 178 GGGYGGGGHGGGGYGGGGYGGGGG 201 Score = 33.1 bits (72), Expect = 0.37 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 943 GARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGG 839 G RGG G GG GG G R GGGGG Sbjct: 126 GRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGG 160 Score = 32.7 bits (71), Expect = 0.49 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG G GG G G GG G GGGG GG G Sbjct: 172 GGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGG 218 Score = 32.7 bits (71), Expect = 0.49 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 G G G GGGGG GG GGG G G G Sbjct: 188 GGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 Score = 32.3 bits (70), Expect = 0.65 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGG--XGGGXRG 871 GGG G GGG G G GGG GGG RG Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRG 156 Score = 32.3 bits (70), Expect = 0.65 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGGGG G GGG G G GG Sbjct: 129 GGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGG 169 Score = 32.3 bits (70), Expect = 0.65 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 GGG GG G GG GGG GGG GGG Sbjct: 178 GGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGG 222 Score = 31.9 bits (69), Expect = 0.86 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGGG G GGGG G G GG Sbjct: 173 GGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGG 213 Score = 31.9 bits (69), Expect = 0.86 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG G GG G G GGG G + GGGG G G G Sbjct: 177 GGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGG 227 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 216 GXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGG GG GGG G G G GG Sbjct: 163 GRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGG 202 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG G GG G G GGG G GG G GG G G Sbjct: 167 GGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGG 217 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GG G GGG G GGGG G G Sbjct: 167 GGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGG 198 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 216 GXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGG GG GGG G G G GG Sbjct: 173 GGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGG 212 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 571 RTXXGXGXXGGXGGGGGXXXXGXGGGG 491 R G G GG GGGG G GGGG Sbjct: 164 RGRGGGGYGGGGYGGGGYGGGGHGGGG 190 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGG GG GGG G G GG Sbjct: 172 GGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGG 213 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRA 454 G G G GGG G G GGG G G G R+ Sbjct: 190 GYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRS 224 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 204 GXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G GGGGG G GGG G G G GG Sbjct: 153 GYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGG 188 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGG 491 G G GG GGGG G GGGG Sbjct: 163 GRGRGGGGYGGGGYGGGGYGGGG 185 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG G GGG G GGGG Sbjct: 205 GSGYGGGGGYGGGGYGGGRSGGGG 228 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G G GG G GGG G G GGG G Sbjct: 199 GGGGYGGSGYGGGGGYGGGGYGGGRSGGG 227 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 RGGG G GGG G GGG GG G Sbjct: 128 RGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGG 160 Score = 29.1 bits (62), Expect = 6.1 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQ---XXKXGXGXGG 97 G G G GGG G GG GGG G + G G GG Sbjct: 124 GGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGG 168 Score = 29.1 bits (62), Expect = 6.1 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGG-GPXXXGVXGXPXPXXXGG 437 G G GGGGG G GGGG G G G GG Sbjct: 150 GGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGG 189 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 GG G GGG G GGGG G G GG Sbjct: 167 GGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGG 202 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 216 GXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGG GG GGG G G G G Sbjct: 168 GGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSG 207 Score = 28.7 bits (61), Expect = 8.0 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGG GG GGG G + G G GG Sbjct: 135 GRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGG-GGYGGGG 175 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPP 545 P P P PPP P PPPPP PP Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 36.7 bits (81), Expect = 0.030 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 471 TPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 TP P PP P PPPPP PP P Sbjct: 224 TPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 33.5 bits (73), Expect = 0.28 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 3/27 (11%) Frame = +2 Query: 872 PRXPPPX---PPPXPPXXPXPXPPPXP 943 P PPP PPP P P P PPP P Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 33.1 bits (72), Expect = 0.37 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPX-PPXXPXPXXVR 572 P P P PPP PPPP PP P P V+ Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVK 251 Score = 33.1 bits (72), Expect = 0.37 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P P PPPPP PPPPP P P Sbjct: 225 PPPPAAPAPPPPPAAAPPPPPPPP-PVKKP 253 Score = 32.3 bits (70), Expect = 0.65 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +2 Query: 884 PPXPP---PXPPXXPXPXPPPXPXXGXAPPP 967 PP P P PP P PPP P PPP Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPP 245 Score = 32.3 bits (70), Expect = 0.65 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 893 PPPXPPXXPXPXPPPXPXXGXAPPP 967 P P PP P P PPP PPP Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPPPP 247 Score = 31.9 bits (69), Expect = 0.86 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXP 920 P PPPP P A P PPP P P Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +2 Query: 881 PPPXPP--PXPPXXPXPXPPPXPXXGXAPPP 967 P P PP P PP P PPP P PPP Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPP----PPPP 249 Score = 29.9 bits (64), Expect = 3.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 840 PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXP 932 P PPP P PPP PP P P Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 152 PPPXWXPPXXPPPPP 196 PPP PP PPPPP Sbjct: 235 PPPAAAPPPPPPPPP 249 Score = 29.1 bits (62), Expect = 6.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 488 PXPPPXPRXXXPXPPPXPXPXPXP 559 P PP P P PPP P P P Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPP 235 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P PPP PP PPPP P P Sbjct: 215 PPEPDYLEPTPPPPAAPAPPP---PPAAAPPPPPPPPPVKKP 253 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P PP PPPPPP P Sbjct: 237 PAAAPPPPPPPPPVKKP 253 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 37.9 bits (84), Expect = 0.013 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P G PPPP PPPPP PP P Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVP 675 Score = 36.7 bits (81), Expect = 0.030 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXG--PPPPPXPXXXXPPPPPXPP 545 PP G P P G PPPPP P P PP PP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPP 681 Score = 33.9 bits (74), Expect(2) = 0.009 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 466 GXPXPXXXGGXXPPPPPPP 410 G P P GG PPPPPPP Sbjct: 651 GIPPPPPGGGMFPPPPPPP 669 Score = 32.3 bits (70), Expect = 0.65 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 429 GXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXP 542 G PP G G P PPPPP PP PP P Sbjct: 650 GGIPPPPPGGGMFPPP----PPPPPGGGVPGPPKPPPP 683 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 893 PPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P P PPP P G P P Sbjct: 653 PPPPPGGGMFPPPPPPPPGGGVPGP 677 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 774 RXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPP 902 R P GG P PPPPPPP P PPP Sbjct: 643 RPPNPFFGGIPPPPPGGGMFPPPPPPPPGGGV--PGPPKPPPP 683 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 887 PXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 P PPP P P PPP P G PP+ Sbjct: 653 PPPPPGGGMFPPP-PPPPPGGGVPGPPK 679 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXP 943 PPP PPP P P PP P Sbjct: 663 PPPPPPPPGGGVPGPPKPPPP 683 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 468 GXXRAPXXXGGXXPPPPPPP 409 G P GG PPPPPPP Sbjct: 650 GGIPPPPPGGGMFPPPPPPP 669 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 887 PXPPPXPPXXPXPXPPPXPXXG 952 P PPP PP P PP P G Sbjct: 663 PPPPPPPPGGGVPGPPKPPPPG 684 Score = 23.4 bits (48), Expect(2) = 0.009 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -3 Query: 313 GXGGPPXPXPPG 278 G GPP P PPG Sbjct: 673 GVPGPPKPPPPG 684 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 37.9 bits (84), Expect = 0.013 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -3 Query: 946 RGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPPAXG 785 RG+ GG G GG G G G R G G GGG G G P G Sbjct: 254 RGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGG 307 Score = 34.7 bits (76), Expect = 0.12 Identities = 25/82 (30%), Positives = 25/82 (30%), Gaps = 1/82 (1%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGG-XRGXXXXXXXXXXXXXXXXXXGGXXPPPP 793 RG G G GGG G G G G G GGG RG GG Sbjct: 254 RGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQG 313 Query: 792 RXGXXPGXXXXRXXXXGXAXXP 727 G PG R G P Sbjct: 314 GMGRGPGGGWGRMQGGGMGRGP 335 Score = 32.3 bits (70), Expect = 0.65 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG RG G G G GGG G R GGG G G G Sbjct: 243 GGMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSG 289 Score = 32.3 bits (70), Expect = 0.65 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = -3 Query: 937 RGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPPAXGRXXRG 770 +GG G GG G G R G G GGG G G P G RG Sbjct: 312 QGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQGGGMGRGPGQGWGCRG 367 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 RG G GGG G G GG G G GGG Sbjct: 317 RGPGGGWGRMQGGGMGRGPGGGLGRGPGGG 346 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 +GGG G GGG G G GG G GGG Sbjct: 327 QGGGMG--RGPGGGLGRGPGGGWGRMQGGG 354 Score = 29.1 bits (62), Expect = 6.1 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -1 Query: 558 GXGXGXGXG-GGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G G G G G RG GGG G G G R P G Sbjct: 269 GRGQGRGMGRGPGGGWGRGSGGGWG-RMQGGGMGRGPGGGWG 309 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 37.9 bits (84), Expect = 0.013 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 568 TXXGXGXXGGXGGGGGXXXXGXGGGGG 488 T G G GG GGGGG G GGGGG Sbjct: 78 TDGGGGCGGGGGGGGGVGGGGGGGGGG 104 Score = 35.9 bits (79), Expect = 0.053 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G G G G G GG GGG GGG G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGG 104 Score = 35.9 bits (79), Expect = 0.053 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G GGG G G GG GGG GGG Sbjct: 80 GGGGC---GGGGGGGGGVGGGGGGGGGGG 105 Score = 33.9 bits (74), Expect = 0.21 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GG G G G GGG GGG G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGG 105 Score = 31.9 bits (69), Expect = 0.86 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -1 Query: 222 GXGXXXGXXG-GGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G G GGGG GG GGG G + G G G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDG 116 Score = 31.9 bits (69), Expect = 0.86 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G G GG GGG G Sbjct: 85 GGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDG 116 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G G GG GGG G G GGGG G Sbjct: 83 GCGGGGGGGGGVGGGGGGGGGGGDDCEDG 111 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXG 487 G G G G GGG G G GGG G Sbjct: 81 GGGCGGGGGGGGGVGGGGGGGGGG 104 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXG 466 G G G G GGG G G GGG G G Sbjct: 83 GCGGGGGGGGGVGGGGGGGGGGGDDCEDGGG 113 Score = 30.3 bits (65), Expect = 2.6 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG G GG G GG GGG G GGG G G Sbjct: 74 GGGDTDGGGGCGGGGGGG-GGVGGGGGGGGGGGDDCEDGGGDDGEDG 119 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G GG GGGG G GGGGG G Sbjct: 76 GDTDGGGGCGGGGGGGGGVGGGGGGGGGG 104 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGGPXXXG 473 GG GGGGG GGGGG G Sbjct: 82 GGCGGGGGGGGGVGGGGGGGGGGG 105 Score = 28.7 bits (61), Expect = 8.0 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 GGG G GG G GG GGG GG G Sbjct: 81 GGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDG 125 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 37.9 bits (84), Expect = 0.013 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPP 934 P PPP PPP PP P P PP Sbjct: 1308 PESPPPPPPPPPPPPPPPLPP 1328 Score = 37.5 bits (83), Expect = 0.017 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXP 943 PP PPP PP P P PPP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLP 1327 Score = 37.5 bits (83), Expect = 0.017 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PPPPP P PPPPP PP P P Sbjct: 1311 PPPPPPP----PPPPPPPPLPPTP 1330 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPP 545 P PPPPP P PPPPP PP Sbjct: 1307 PPESPPPPPPPP--PPPPPPPLPP 1328 Score = 32.7 bits (71), Expect = 0.49 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P PP PPPPPPP P Sbjct: 1307 PPESPPPPPPPPPPPPP 1323 Score = 32.7 bits (71), Expect = 0.49 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P PP PPPPPPP P Sbjct: 1308 PESPPPPPPPPPPPPPP 1324 Score = 32.7 bits (71), Expect = 0.49 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P PP PPPPPPP P Sbjct: 1311 PPPPPPPPPPPPPPPLP 1327 Score = 32.7 bits (71), Expect = 0.49 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P PP PPPPPPP P Sbjct: 1312 PPPPPPPPPPPPPPLPP 1328 Score = 31.9 bits (69), Expect = 0.86 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PP PP PPPPP P P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPPP PP P P Sbjct: 1307 PPESPPPP---PPPPPPPPPPPLP 1327 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAP 961 PP PP PP P P PPP P P Sbjct: 1307 PPESPPPPP--PPPPPPPPPPLPPTP 1330 Score = 29.5 bits (63), Expect = 4.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 896 PPXPPXXPXPXPPPXPXXGXAPPP 967 PP P P P PPP P P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 28.7 bits (61), Expect = 8.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P PP PPPPP P P Sbjct: 1314 PPPPPPPPPPPPLPPTP 1330 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 37.9 bits (84), Expect = 0.013 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -1 Query: 951 PXXGXGGGXGXGXXGGXGGGXGGGXRG 871 P G G G G G GG GGG GGG RG Sbjct: 335 PRGGSGRGGGGGGGGGGGGGGGGGGRG 361 Score = 37.9 bits (84), Expect = 0.013 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = -3 Query: 937 RGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXP 797 RGG G GG GGG G GGG GGG G RG P P Sbjct: 336 RGGSGRGGGGGGGGGGGGGGG-------GGGRGGGGGFSSRGRGPPP 375 Score = 36.7 bits (81), Expect = 0.030 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 RGG G GGG G G GG G G GGG Sbjct: 336 RGGSGRGGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 36.7 bits (81), Expect = 0.030 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG GGGGG G GGGGG Sbjct: 342 GGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 35.9 bits (79), Expect = 0.053 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 RGGG G GGG G G GG GGG G RG Sbjct: 341 RGGGGG---GGGGGGGGGGGGGRGGGGGFSSRG 370 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 571 RTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXP 452 R G G GG GGGGG G G GGG P P Sbjct: 336 RGGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRGPPP 375 Score = 32.7 bits (71), Expect = 0.49 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = -1 Query: 585 PXXXNXXXXGXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRA 454 P + G G G G GGG G RG GGG G R+ Sbjct: 335 PRGGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRGPPPRRS 378 Score = 32.3 bits (70), Expect = 0.65 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -3 Query: 541 GXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPP 422 G GGGGG G GGGGG G G G PPP Sbjct: 340 GRGGGGG----GGGGGGGGGGGGGRGGGGGFSSRGRGPPP 375 Score = 31.9 bits (69), Expect = 0.86 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G G GGGGG GG GGG G Sbjct: 342 GGGGGGGGGGGGGGGGGGRGGGGGFSSRG 370 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 863 GXXGGGGGGGXGGXXXGXXPXPPRARAXXP 774 G GGGGGGG GG G R R P Sbjct: 346 GGGGGGGGGGGGGGRGGGGGFSSRGRGPPP 375 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAP 451 G G G G GGG G G GGG G R P Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRGP 373 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGG 151 G G G GGGGG GG GGG Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGGG 363 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 228 PXGXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 P G G G GGGGG GG GGG G Sbjct: 335 PRG-GSGRGGGGGGGGGGGGGGGGGGRGGGG 364 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 204 GXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXG 106 G GGGGG GG GGG G G G Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 411 GGGGGGGXXPPXXXGXGXPXTPXXXGPPP 497 GGGGGGG G G + GPPP Sbjct: 347 GGGGGGGGGGGGGRGGGGGFSSRGRGPPP 375 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 37.9 bits (84), Expect = 0.013 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -3 Query: 946 RGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPPAXG 785 RG+ GG G GG G G G R G G GGG G G P G Sbjct: 10 RGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGG 63 Score = 35.9 bits (79), Expect = 0.053 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 RG G G GGG G G GG G G GGG Sbjct: 10 RGSGGGWGQGPGGGWGRGQGGGMGRGPGGG 39 Score = 33.5 bits (73), Expect = 0.28 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 +G G G GGG G G GG G G GGG Sbjct: 18 QGPGGGWGRGQGGGMGRGPGGGWGRGSGGG 47 Score = 33.1 bits (72), Expect = 0.37 Identities = 19/52 (36%), Positives = 20/52 (38%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 G G RG+ GG GG G G G R G G GGG G G Sbjct: 35 GPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGG 86 Score = 32.3 bits (70), Expect = 0.65 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 RG G G GGG G G GG G GGG Sbjct: 26 RGQGGGMGRGPGGGWGRGSGGGWGRMQGGG 55 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 RG G G GGG G GG G G GGG Sbjct: 34 RGPGGGWGRGSGGGWGRMQGGGMGRGPGGG 63 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 RG G GGG G G GG G G GGG Sbjct: 58 RGPGGGWGRMQGGGMGRGPGGGLGRGPGGG 87 Score = 29.9 bits (64), Expect = 3.5 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 G G RG GG G GG G G G R GGG G G G Sbjct: 19 GPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQ----GGGMGRGPG 61 Score = 29.5 bits (63), Expect = 4.6 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXG----GGXXXGXARXXXXXXGGGGGGGXG 827 G G RG GG G GG G GG G GGG G G G Sbjct: 27 GQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGGMGRGPG 77 Score = 29.1 bits (62), Expect = 6.1 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -1 Query: 558 GXGXGXGXG-GGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G G G G G RG GGG G G G R P G Sbjct: 25 GRGQGGGMGRGPGGGWGRGSGGGWG-RMQGGGMGRGPGGGWG 65 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 37.9 bits (84), Expect = 0.013 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPPPPPP 410 G GG G GGG GGGGG G PPPPPPP Sbjct: 468 GYGGGSGYGGG--SSSRGGGGGRSSSGGNSRSGGSSYKSSNPPPPPPP 513 Score = 37.1 bits (82), Expect = 0.023 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 546 GXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGGXXPPPPPPP 409 G G G G G GGG G G PPPPPPP Sbjct: 468 GYGGGSGYGGGSSSRGGGGGRSSSGGNSRSGGSSYKSSNPPPPPPP 513 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 37.5 bits (83), Expect = 0.017 Identities = 40/160 (25%), Positives = 40/160 (25%) Frame = +3 Query: 492 PPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXXXXRAXGAXGAX 671 PPP P PPP P P P G P GA Sbjct: 452 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGA-PHPRVPPPGAPHQRVPPPGAPHPR 510 Query: 672 GXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXXXPXPPPPPP 851 P P G P P G P P P P P PPP Sbjct: 511 -VP-PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHP--RVPPPGASHPRVPPPGA 566 Query: 852 PXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P PP P PP AP PP A Sbjct: 567 PHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGA 606 Score = 35.1 bits (77), Expect = 0.092 Identities = 39/168 (23%), Positives = 40/168 (23%), Gaps = 2/168 (1%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXT--XXXXXXXR 647 P P P P PPP PP P +R R T R Sbjct: 301 PPQYMPHPRMRPPTRIPPPGMGPPPRIPPPPIRAPVDVYPPRAPQGASQTPPYPGSHYSR 360 Query: 648 AXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXXX 827 G P G P P G P P P Sbjct: 361 VPPPDGPYTRALPPGEPYARMPPPGATHPRVPSPGASHPRVPPPGAPHPRVPPPGASHQR 420 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 PP P P P PP P P PP AP PP A Sbjct: 421 VRPPGAPHPRVPPPGAPHPRFPPPGAP--HPRVPPPGAPHPRVPPPGA 466 Score = 35.1 bits (77), Expect = 0.092 Identities = 39/163 (23%), Positives = 39/163 (23%), Gaps = 2/163 (1%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXXXX-RAXGAXG 665 PPP P PPPP P P P RA Sbjct: 317 PPPGMGPPPRIPPPPIRAPVDVYPPRAPQGASQTPPYPGSHYSRVPPPDGPYTRALPPGE 376 Query: 666 AXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXXX-PXPPP 842 P G P G P PR P A P P PP Sbjct: 377 PYARMPPPGATHPRVPSPGASHPRVPPPGAPH---PRVPPPGASHQRVRPPGAPHPRVPP 433 Query: 843 PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P P PP P PP AP PP A Sbjct: 434 PGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGA 476 Score = 33.9 bits (74), Expect = 0.21 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +3 Query: 804 GXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 G P P P PP P PPP PPRAP+ A PP Sbjct: 298 GYPPPQYMPHPRMRPPTRIPPPGMGPPPRIPPPPIRAPVDVYPPRAPQGASQTPP 352 Score = 33.9 bits (74), Expect = 0.21 Identities = 43/169 (25%), Positives = 43/169 (25%), Gaps = 5/169 (2%) Frame = +3 Query: 453 GXGXPXTPXXXGP----PPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXX 620 G P P P PPP P PPP P P P G P Sbjct: 445 GAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGA-PHQRVPP 503 Query: 621 TXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGG 800 GA P P G P P G P PR P A Sbjct: 504 PGAPHPRVPPPGAPHPR-VP-PPGAPHPRVPPPGAPHPRVPPPGAPH---PRVPPPGASH 558 Query: 801 XGXXPLXXX-PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 P P PPP P P PP P PP AP Sbjct: 559 PRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAP 607 Score = 33.5 bits (73), Expect = 0.28 Identities = 25/97 (25%), Positives = 26/97 (26%) Frame = +3 Query: 684 PXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXXXPXPPPPPPPXXX 863 P G P P G P P P P P PPP P Sbjct: 463 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQ--RVPPPGAPHPRVPPPGAPHPR 520 Query: 864 XXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 P PP P PP AP PP A+ Sbjct: 521 VPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAS 557 Score = 31.9 bits (69), Expect = 0.86 Identities = 41/170 (24%), Positives = 41/170 (24%), Gaps = 1/170 (0%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXP-PXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXXX 641 P P PPP PP P P P RF G P Sbjct: 404 PGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGA---PHPRVPPPGAPHPR 460 Query: 642 XRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLX 821 GA P P G P P G P P P P Sbjct: 461 VPPPGAPHPR-VP-PPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHP--RVPPPGA 516 Query: 822 XXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P PPP P P PP P PP A PP A Sbjct: 517 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGA 566 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 37.5 bits (83), Expect = 0.017 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = -3 Query: 973 AAGGGXXAXRG-ARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 A GGG G A GG G G GGG G GG GGGG G G Sbjct: 1774 AGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAG 1828 Score = 35.9 bits (79), Expect = 0.053 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG G GG G GG G G GG GGGG G Sbjct: 1800 GGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 Score = 34.3 bits (75), Expect = 0.16 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG A G GG G G GGG G A G GGG G G Sbjct: 1799 GGGGMA--GGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGG 1843 Score = 33.5 bits (73), Expect = 0.28 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G G GG GGGGG G G GGG G Sbjct: 1760 GGGGGGGMGGGGGMAGGGGGMGGGGMAAG 1788 Score = 33.5 bits (73), Expect = 0.28 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = -3 Query: 973 AAGGGXXAX-RGARGGXXXGXXG--GXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 AAGGG G GG G G G GGG G GG G GG G G Sbjct: 1786 AAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGG 1842 Score = 33.1 bits (72), Expect = 0.37 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G GG G G GGG G GGGG G G Sbjct: 1760 GGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMG 1811 Score = 32.3 bits (70), Expect = 0.65 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGGG GG GG G G GG Sbjct: 1766 GMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGG 1807 Score = 32.3 bits (70), Expect = 0.65 Identities = 22/66 (33%), Positives = 22/66 (33%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPPAX 788 GGG G GG GG GG G GGG GGG G G A Sbjct: 1770 GGGMAGGGGGMGGGGMAAGGGEFGGGE-GMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAG 1828 Query: 787 GRXXRG 770 G G Sbjct: 1829 GGMGAG 1834 Score = 31.9 bits (69), Expect = 0.86 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGG--GXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G G G GG GG G G GG GGG G G Sbjct: 1793 GGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 Score = 31.9 bits (69), Expect = 0.86 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G G GGGGG G G GGG G G Sbjct: 1797 GMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAG 1828 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGG 880 G GGG G G GG GG GGG Sbjct: 1757 GFGGGGGGGGMGGGGGMAGGG 1777 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGX--XXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGGG GG GGG G G G GG Sbjct: 1759 GGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGG 1802 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GG G GG G G G GGG GGG Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGG 1783 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGG G G G GG G G GG Sbjct: 1806 GGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/30 (50%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXG--XGGGGGPXXXGV 470 G GG GGGGG G GGGGG G+ Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGM 1785 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGGPXXXGVXG 464 GG GGGGG G GGG G+ G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGG 1782 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 910 GGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG GGG G GGGGG G G G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAG 1788 Score = 28.7 bits (61), Expect = 8.0 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 216 GXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G GGGG GG GGG G G GG Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGG 1795 Score = 28.7 bits (61), Expect = 8.0 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGG---XGGGXRG 871 GGG G GGG G GG GGG GGG G Sbjct: 1760 GGGGGGGMGGGGGMA-GGGGGMGGGGMAAGGGEFG 1793 Score = 28.7 bits (61), Expect = 8.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGGG G GGGG G G GG Sbjct: 1766 GMGGGGGMAGGGG----GMGGGGMAAGGGEFGGGEGMGGGG 1802 Score = 28.7 bits (61), Expect = 8.0 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGG G GGG G G+ GG Sbjct: 1795 GEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGG 1835 Score = 28.7 bits (61), Expect = 8.0 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 AGGG G GG G GG G G G G GGGGG Sbjct: 1804 AGGGGG--MGGGGGGMGG--GGEGMGAAGGGMGAGGEGGGAGGGGG 1845 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 37.1 bits (82), Expect = 0.023 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXP 554 PPPPP P P PPP PP P Sbjct: 84 PPPPPPPASNVPAPPPPPPVMP 105 Score = 34.3 bits (75), Expect = 0.16 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXP 943 PP PPP PP P PPP P Sbjct: 82 PPPPPPPPPASNVPAPPPPP 101 Score = 33.1 bits (72), Expect = 0.37 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXP 920 P P PPPPPPP A PPP PP P Sbjct: 77 PAAVIPPPPPPPPP-------ASNVPAPPPPPPVMP 105 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PPPPP P P PP PP P V Sbjct: 83 PPPPPPPPASNVPAPPPPPPVMPPQKV 109 Score = 31.9 bits (69), Expect = 0.86 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPP 937 PPP PPP P P PPP Sbjct: 83 PPPPPPPPASNVPAPPPPP 101 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 784 ARARGGXGXXPXXXPPXPPPPPPP 855 AR+R P P PPPPPPP Sbjct: 67 ARSRVETTDGPAAVIPPPPPPPPP 90 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 37.1 bits (82), Expect = 0.023 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXP 554 PPPPP P PPPPP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 35.5 bits (78), Expect = 0.070 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPP 934 PPP PPP PP P P PP Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 Score = 35.5 bits (78), Expect = 0.070 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPP 937 PP PPP PP P P PPP Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 Score = 34.3 bits (75), Expect = 0.16 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXP 943 PPP PPP PP P P P P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSP 75 Score = 33.9 bits (74), Expect = 0.21 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 893 PPPXPPXXPXPXPPPXPXXGXAPP 964 PPP PP P P PPP P + P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 33.9 bits (74), Expect = 0.21 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXP 554 PPPPP P PPPP P P Sbjct: 57 PPPPPPPPPPPPPPPSSSPSRP 78 Score = 33.5 bits (73), Expect = 0.28 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPP 937 P PPP PPP PP P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 32.7 bits (71), Expect = 0.49 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXP 217 PPP PP PPPPP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 32.7 bits (71), Expect = 0.49 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P PP PPPPPPP P Sbjct: 54 PPPPPPPPPPPPPPPPP 70 Score = 32.7 bits (71), Expect = 0.49 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 893 PPPXPPXXPXPXPPPXP 943 PPP PP P P PPP P Sbjct: 54 PPPPPPPPPPPPPPPPP 70 Score = 32.7 bits (71), Expect = 0.49 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXP 943 P PPP PPP PP P P P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 32.7 bits (71), Expect = 0.49 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P PP PPPPPPP P Sbjct: 55 PPPPPPPPPPPPPPPPP 71 Score = 31.9 bits (69), Expect = 0.86 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 896 PPXPPXXPXPXPPPXPXXGXAP 961 PP PP P P PPP P +P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPR 938 PPPPPPP PPP PP P P R Sbjct: 54 PPPPPPP-----------PPPPPPPPPPPSSSPSR 77 Score = 29.5 bits (63), Expect = 4.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXP 217 PPP PP PPPPP P Sbjct: 57 PPPPPPPPPPPPPPPSSSPSRP 78 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P PP PPPPPP P Sbjct: 59 PPPPPPPPPPPPPSSSP 75 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 170 PPXXPPPPPXXPXXXPXP 223 PP PPPPP P P P Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G GGG G GG GGG GGG Sbjct: 26 GGGHGGGHGYGGGPNGGGGGGGGGGGGGG 54 Score = 33.9 bits (74), Expect = 0.21 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G G G G G GG GGG GGG G Sbjct: 25 GGGGH---GGGHGYGGGPNGGGGGGGGGGGGG 53 Score = 33.5 bits (73), Expect = 0.28 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 R GG G G G G GG GGG GGG Sbjct: 23 RDGGGGHGGGHGYGGGPNGGGGGGGGGGGG 52 Score = 33.5 bits (73), Expect = 0.28 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G G GG G GGG G GGGGG G Sbjct: 26 GGGHGGGHGYGGGPNGGGGGGGGGGGGGG 54 Score = 33.5 bits (73), Expect = 0.28 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GG GGGG G GGGG G G Sbjct: 32 GHGYGGGPNGGGGGGGGGGGGGGDEDDSGKNG 63 Score = 32.3 bits (70), Expect = 0.65 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -3 Query: 910 GGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG GGG G GGGGGGG G Sbjct: 27 GGHGGGHGYGGGPNGGGGGGGGGGGGGG 54 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 910 GGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG G G G GGGGGGG G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGG 52 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXG 881 GGG G GG G GG GGG G Sbjct: 26 GGGHGGGHGYGGGPNGGGGGGGGGGGGGG 54 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +3 Query: 465 PXTPXXXGP-PPPPXPXXXXPPPPPXPPXXP 554 P TP P PPPP P PPPP PP P Sbjct: 898 PTTPKPTTPAPPPPLPLAPEPPPPLPPPPPP 928 Score = 33.5 bits (73), Expect = 0.28 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 9/61 (14%) Frame = +3 Query: 813 PLXXXPXPPP--PPPPXXXXXXRAXPXXXPP-------PXPPXXPXXXPPRAPRXAXXPP 965 PL P PPP PPPP R P P PP PP P PP Sbjct: 911 PLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPP 970 Query: 966 P 968 P Sbjct: 971 P 971 Score = 33.1 bits (72), Expect = 0.37 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVR 572 P P PPP P PPPP PP P P V+ Sbjct: 949 PTPPPPTSALPPPIPATQV-PPPPLPPLPPPPPPVQ 983 Score = 32.7 bits (71), Expect = 0.49 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 P PPPP PPP P P PP A PPA+ Sbjct: 949 PTPPPPTSALPPPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPPAS 994 Score = 31.9 bits (69), Expect = 0.86 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +2 Query: 872 PRXPPPXPP-PXPPXXPXPXPPPXP 943 P P P PP P P P P PPP P Sbjct: 903 PTTPAPPPPLPLAPEPPPPLPPPPP 927 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PP P P P P PPP P PPP Sbjct: 894 PPTTPTTPKPTTPAP-PPPLPLAPEPPPP 921 Score = 29.9 bits (64), Expect = 3.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 P P P P PP P PP P PP Sbjct: 898 PTTPKPTTPAPPPPLPLAPEPPPPLPPPPPP 928 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 4/49 (8%) Frame = +3 Query: 828 PXPPPP----PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXP 962 P PPPP PPP P PP PP P P + P Sbjct: 949 PTPPPPTSALPPPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPPASCMP 997 Score = 29.5 bits (63), Expect = 4.6 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 5/57 (8%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXP-----PXXPXXXPPRAPRXAXXPPP 968 P P P PPPP P PPP P P P +A PPP Sbjct: 898 PTTPKPTTPAPPPPLPLAP-EPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPP 953 Score = 29.5 bits (63), Expect = 4.6 Identities = 20/64 (31%), Positives = 21/64 (32%), Gaps = 12/64 (18%) Frame = +3 Query: 813 PLXXXPXPPPPPP--------PXXXXXXRAXPXXXPPPX----PPXXPXXXPPRAPRXAX 956 P P PPPPPP P + PPP PP P P P Sbjct: 916 PEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPPL 975 Query: 957 XPPP 968 PPP Sbjct: 976 PPPP 979 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP 536 PP P P PPPP P PPPPP Sbjct: 951 PPPPTSALPPPIPATQVPPPPLPP--LPPPPPP 981 Score = 28.7 bits (61), Expect = 8.0 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPP--PPXPXXXXPPPPPXPPXXP 554 PP P TP P P P P PPPPP P Sbjct: 894 PPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRP 934 Score = 28.7 bits (61), Expect = 8.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPP 196 P P P PL P P PP PPPPP Sbjct: 898 PTTPKPTTPAPPPPLPLAPEPP--PPLPPPPPP 928 Score = 28.7 bits (61), Expect = 8.0 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAP 961 P PPP P P P P PPP P P Sbjct: 906 PAPPPPLPLAPEPPPPLPPPPP-PIQTTRP 934 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 36.7 bits (81), Expect = 0.030 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G GGG G G GG GGG G G G Sbjct: 82 GGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 112 Score = 35.1 bits (77), Expect = 0.092 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG GGG G G GG G G GGG G Sbjct: 73 GGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGG 104 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G G G G G G GGG GGG Sbjct: 77 GGGCDGGGGDGDGGGGGDGDGGGGGDGGG 105 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G G G G G G GGG GGG Sbjct: 83 GGGDGDGGGGGDGDGGGGGDGGGGGDGGG 111 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G G G GGGGG G GGGG G Sbjct: 89 GGGGGDGDGGGGGDGGGGGDGGGGNDDDG 117 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 943 GARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 G GG G G GGG G GGG GGG Sbjct: 75 GDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGG 111 Score = 29.9 bits (64), Expect = 3.5 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG GG G GG G G G GGGG GG G G Sbjct: 73 GGGDGGGCDGGGGDGDGGGGGDGDGGGGGDG-------GGGGDGGGGNDDDG 117 Score = 29.9 bits (64), Expect = 3.5 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGGG G GGG G G G GG Sbjct: 73 GGGDGGGCDGGGGDG-DGGGGGDGDGGGGGDGGGGGDGGGG 112 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G GGG G G G GG G Sbjct: 89 GGGGGDGDGGGGGDGGGGGDGGGGNDDDG 117 Score = 29.5 bits (63), Expect = 4.6 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG G G GGG G GGGGG G G Sbjct: 51 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDG 97 Score = 29.5 bits (63), Expect = 4.6 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -3 Query: 553 GXXGGXGGGG--GXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G GG GGG G G GGGGG G G GG Sbjct: 70 GDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGG 110 Score = 29.1 bits (62), Expect = 6.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 943 GARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 G GG G G GGG G GGG GGG G G Sbjct: 70 GDDGGGDGGGCDG-GGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 112 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G G GGGG GG GGG G Sbjct: 89 GGGGGDGDGGGGGDGGGGGDGGGGNDDDG 117 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 36.7 bits (81), Expect = 0.030 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG GGGGG G GGGGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 36.7 bits (81), Expect = 0.030 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG GGGGG G GGGGG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 36.3 bits (80), Expect = 0.040 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGGXRG 871 G GGG G G GG GGG GGG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 36.3 bits (80), Expect = 0.040 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGGXRG 871 G GGG G G GG GGG GGG G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 36.3 bits (80), Expect = 0.040 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGGXRG 871 G GGG G G GG GGG GGG G Sbjct: 56 GGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 35.9 bits (79), Expect = 0.053 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G G GG GGG G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 35.1 bits (77), Expect = 0.092 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G GG GGGGG G GGGGG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G G GG GGGGG G GGG G G Sbjct: 56 GGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGGPXXXGVXG 464 GG GGGGG G GGGGG G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G G GGG G G GGG G G GG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDGDDDDGDDDDDDDDGG 94 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGG 151 G G G GGGGG GG GGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGG 151 G G G GGGGG GG GGG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 30.7 bits (66), Expect = 2.0 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 934 GGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG G GG GGG G GGGGGGG G G Sbjct: 53 GGGGGGGGGGGGGGGGGG---------GGGGGGGDGDDDDG 84 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXG 487 G G G G GGG G G GGG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 216 GXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G GGGGG GG GGG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 552 GXGXGXGGGXGXXXRGXGGGXGPXXXG 472 G G G GGG G G GGG G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 36.7 bits (81), Expect = 0.030 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G GGG G G GG GGG G G G Sbjct: 97 GGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 127 Score = 35.1 bits (77), Expect = 0.092 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG GGG G G GG G G GGG G Sbjct: 88 GGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGG 119 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G G G G G G GGG GGG Sbjct: 92 GGGCDGGGGDGDGGGGGDGDGGGGGDGGG 120 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G G G G G G GGG GGG Sbjct: 98 GGGDGDGGGGGDGDGGGGGDGGGGGDGGG 126 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G G G GGGGG G GGGG G Sbjct: 104 GGGGGDGDGGGGGDGGGGGDGGGGNDDDG 132 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 943 GARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 G GG G G GGG G GGG GGG Sbjct: 90 GDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGG 126 Score = 29.9 bits (64), Expect = 3.5 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG GG G GG G G G GGGG GG G G Sbjct: 88 GGGDGGGCDGGGGDGDGGGGGDGDGGGGGDG-------GGGGDGGGGNDDDG 132 Score = 29.9 bits (64), Expect = 3.5 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGGG G GGG G G G GG Sbjct: 88 GGGDGGGCDGGGGDG-DGGGGGDGDGGGGGDGGGGGDGGGG 127 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G GGG G G G GG G Sbjct: 104 GGGGGDGDGGGGGDGGGGGDGGGGNDDDG 132 Score = 29.5 bits (63), Expect = 4.6 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG G G GGG G GGGGG G G Sbjct: 66 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDG 112 Score = 29.5 bits (63), Expect = 4.6 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -3 Query: 553 GXXGGXGGGG--GXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G GG GGG G G GGGGG G G GG Sbjct: 85 GDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGG 125 Score = 29.1 bits (62), Expect = 6.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 943 GARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 G GG G G GGG G GGG GGG G G Sbjct: 85 GDDGGGDGGGCDG-GGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 127 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G G GGGG GG GGG G Sbjct: 104 GGGGGDGDGGGGGDGGGGGDGGGGNDDDG 132 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 36.7 bits (81), Expect = 0.030 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGGXR 874 RGGG G G G G G G GGG GGG R Sbjct: 315 RGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGR 346 Score = 33.9 bits (74), Expect = 0.21 Identities = 19/34 (55%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXG-GGXRG 871 RGGG GGG G G GG GGG G GG RG Sbjct: 311 RGGGRGGGYRSGGGGGYG--GGRGGGRGYGGGRG 342 Score = 32.7 bits (71), Expect = 0.49 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGG 845 GGG + G GG G GG GG G R GGG Sbjct: 98 GGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGG 138 Score = 30.7 bits (66), Expect = 2.0 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG G R G G GG GGG G R GGG G Sbjct: 312 GGGRGG--GYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGGGSRSG 356 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGX---GGGXGGGXR 874 G G G GGG G G GG GG GGG R Sbjct: 107 GYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGGRR 140 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/50 (32%), Positives = 18/50 (36%) Frame = -3 Query: 961 GXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 G G++GG GG GG G GGG GG G G Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGG 138 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 204 GXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G GGGG GG GGG G G GG Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGG 124 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 946 RGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 R RGG G GGG G GG GGGG Sbjct: 308 REQRGGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGG 345 Score = 28.7 bits (61), Expect = 8.0 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -3 Query: 946 RGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 RG RGG G GG G + G GGGG G G Sbjct: 88 RGERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGG 132 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 36.3 bits (80), Expect = 0.040 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGGXRG 871 G GGG G G GG GGG GGG G Sbjct: 306 GDGGGGGDGGGGGGGGGGGGGDGG 329 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 G G G GGG G G GG GGG G G Sbjct: 306 GDGGGGGDGGGGGGGGGGGGGDGGGDGDG 334 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 G G G G G G G GG GGG GGG Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGG 330 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG GGGGG G GGG G Sbjct: 309 GGGGDGGGGGGGGGGGGGDGGGDG 332 Score = 33.9 bits (74), Expect = 0.21 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G GGG G G GG G G G G Sbjct: 310 GGGDGGGGGGGGGGGGGDGGGDGDGDGDG 338 Score = 33.1 bits (72), Expect = 0.37 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXG 466 G G G G GGG G G GGG G G G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGGDG 332 Score = 31.9 bits (69), Expect = 0.86 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G GGG G G G G G G G Sbjct: 314 GGGGGGGGGGGGGDGGGDGDGDGDGDGDG 342 Score = 31.9 bits (69), Expect = 0.86 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G GGG G G G G G G G Sbjct: 318 GGGGGGGGGDGGGDGDGDGDGDGDGDGDG 346 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G G G GGG G G GGGGG G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGG 330 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 936 GGGXGXGXXGGXGGGXGGGXRG 871 G G G G GG GGG GGG G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGG 323 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 216 GXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 G G GGGG GG GGG G G G G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDG 340 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGGXRG 871 G G G G G G GGG GGG G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGG 325 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G GGG G G GG G G G G Sbjct: 309 GGGGDGGGGGGGGGGGGGDGG-GDGDGDG 336 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGGXRG 871 G GGG G G GG GGG GG G Sbjct: 308 GGGGGDGGGGGGG-GGGGGGDGGG 330 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 36.3 bits (80), Expect = 0.040 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXX--PPPXPPXXPXXXPPRAPRXAXXPPPAA 974 PPP PPP P PPP PP P A PPP A Sbjct: 537 PPPAPPPSVFAPSSGVPTPVTAPPPAPPPSVFAPSSAVPTPATAPPPVA 585 Score = 31.9 bits (69), Expect = 0.86 Identities = 38/186 (20%), Positives = 40/186 (21%), Gaps = 8/186 (4%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXX 617 PP P PPP P P P P F G P Sbjct: 381 PPPSVFASSSGVPTPVAAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPP 440 Query: 618 XTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAG 797 + + G P P P P G P P A Sbjct: 441 PSVFAS----SSGVPTPVTAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAA 496 Query: 798 --------GXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXA 953 G P PPP P PPP PP P Sbjct: 497 PPPSVFAPSSGVPTTVTAPPAAPPPSVFAPSSGVPTPVTEPPPAPPPSVFAPSSGVPTPV 556 Query: 954 XXPPPA 971 PPPA Sbjct: 557 TAPPPA 562 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PP P PP PP P APPP Sbjct: 332 PPVTEPAPPSSVVAPPPAVPTPATAPPP 359 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P PPP P PPP PP P PPP+ Sbjct: 377 PVKAPPPSVFASSSGVPTPVAAPPPAPPPSVFAPSSGVPTPVAAPPPS 424 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 36.3 bits (80), Expect = 0.040 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGG GG GGG G Q G G GG Sbjct: 101 GRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 Score = 35.5 bits (78), Expect = 0.070 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 6/51 (11%) Frame = -3 Query: 967 GGGXXAXRGARGGXXX-GXXGGXGGGXXX-----GXARXXXXXXGGGGGGG 833 GGG RG RGG G GG GGG G GGGGGGG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 Score = 35.5 bits (78), Expect = 0.070 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 3/35 (8%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGG---XGGGXRG 871 GGG G GGG G G GG GGG GGG G Sbjct: 93 GGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGG 127 Score = 33.1 bits (72), Expect = 0.37 Identities = 16/31 (51%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -3 Query: 574 KRTXXGXGXXGGXGGGGGXXXXG--XGGGGG 488 +R G G GG GGGGG G GGGGG Sbjct: 96 RRERGGRGGGGGYGGGGGYGGGGRSYGGGGG 126 Score = 33.1 bits (72), Expect = 0.37 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG G GGG G GGGGG Sbjct: 105 GGGYGGGGGYGGGGRSYGGGGGGG 128 Score = 32.3 bits (70), Expect = 0.65 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 RGGG G GGG G G GGG GGG Sbjct: 102 RGGGGG--YGGGGGYGGGGRSYGGGGGGGG 129 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 571 RTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 R G GG GGGGG G GGGG G G Sbjct: 91 RGGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGG 126 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGG 491 G G GG GGGG G GGGG Sbjct: 107 GYGGGGGYGGGGRSYGGGGGGGG 129 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G GG GGGGG GGGGG Sbjct: 117 GGRSYGGGGGGGGFYQDSYGGGGG 140 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 204 GXXGGGGGXXGGXXXGGGXXXXG 136 G GGGGG GG GGG G Sbjct: 100 GGRGGGGGYGGGGGYGGGGRSYG 122 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 35.9 bits (79), Expect = 0.053 Identities = 18/34 (52%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGG-GXRG 871 RG G G GGG G G G GGG GG G RG Sbjct: 133 RGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRG 166 Score = 34.7 bits (76), Expect = 0.12 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXG--GGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG RG GG G GG G GG G GG GGG G G Sbjct: 127 GGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGG 179 Score = 33.9 bits (74), Expect = 0.21 Identities = 23/66 (34%), Positives = 23/66 (34%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPPAX 788 G G GA GG G G GGG R GGG GG G RG Sbjct: 134 GRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGG-GGRGRGTGGGSRGG 192 Query: 787 GRXXRG 770 G RG Sbjct: 193 GGDGRG 198 Score = 33.1 bits (72), Expect = 0.37 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Frame = -3 Query: 970 AGGGXXAXRG-ARGGXX--XGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 AGGG G RGG G GG GGG G GGG G G RG Sbjct: 143 AGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRG 198 Score = 31.9 bits (69), Expect = 0.86 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGG 491 G G GG GG GG G GGGG Sbjct: 158 GEGGWGGRGGNGGGRGGGEGGGG 180 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 RGG G G G G G G G G GGG G Sbjct: 129 RGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGG 161 Score = 30.7 bits (66), Expect = 2.0 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGG-GXXXGXARXXXXXXGGGG-GGGXGXXXRGXXPXPP 794 G G A G G G GG GG G G GGGG G G G RG Sbjct: 138 GEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGR 197 Query: 793 AXGR 782 GR Sbjct: 198 GRGR 201 Score = 30.7 bits (66), Expect = 2.0 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGG-GXXXGXARXXXXXXGGGGGGGXG 827 GG G RGG G GG GG G G G G G G G Sbjct: 156 GGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRGRG 202 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G GG GGG G G G GGG G G Sbjct: 167 GNGGGRGGGEGGGGRGRGTGGGSRGGGGDG 196 Score = 29.5 bits (63), Expect = 4.6 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -3 Query: 559 GXGXXGGXG-GGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG G GGG G GG GG G G GG Sbjct: 146 GIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGG 187 Score = 29.1 bits (62), Expect = 6.1 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXG-GGXRG 871 RGG G G G G G GGG G GG RG Sbjct: 121 RGGVQRGGRGGWRGRGGGEGNGAGGGIGRGGGRG 154 Score = 29.1 bits (62), Expect = 6.1 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -1 Query: 558 GXGXGXGXGGGXG--XXXRGXGGGXGPXXXGXGXXR 457 G G G G GGG G G GGG G G G R Sbjct: 148 GRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGR 183 Score = 28.7 bits (61), Expect = 8.0 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -3 Query: 946 RGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 RG RGG G GG G G G R G G GGG G Sbjct: 126 RGGRGGWR-GRGGGEGNGAGGGIGRGG----GRGRGGGEG 160 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 35.9 bits (79), Expect = 0.053 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = -3 Query: 553 GXXGGXGGGGG-XXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G GG GGGGG G GGGGG G G P GG Sbjct: 223 GVPGGFGGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGG 262 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGGXRG 871 G GG G G GG GGG GG G Sbjct: 230 GGGGVWGNGGGGGGGGGYSGGGSG 253 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G G GGGGG GG G P G Sbjct: 231 GGGVWGNGGGGGGGGGYSGGGSGNPHYYACGG 262 Score = 29.9 bits (64), Expect = 3.5 Identities = 22/68 (32%), Positives = 23/68 (33%), Gaps = 3/68 (4%) Frame = -2 Query: 965 GGXXGPPXGXGG---VXGGXXXXXXXXXXXXXXXXAXGXXGGGGGGGXGGXXXGXXPXPP 795 GG GP G GG + GG G G GGGGG GG G P Sbjct: 197 GGAYGP-GGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGGGSGNP 255 Query: 794 RARAXXPG 771 A G Sbjct: 256 HYYACGGG 263 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGGXRG 871 G GGG G GG GGG GGG G Sbjct: 227 GFGGGGGVWGNGG-GGGGGGGYSG 249 Score = 29.1 bits (62), Expect = 6.1 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 228 PXGXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 P G G G G GGG GG GG G G G G Sbjct: 225 PGGFGGGGGVWGNGGGGGGGGGYSGG--GSGNPHYYACGGGGG 265 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 943 GARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 G GG GG GGG G GGGGG Sbjct: 229 GGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGG 265 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 35.9 bits (79), Expect = 0.053 Identities = 36/133 (27%), Positives = 38/133 (28%), Gaps = 3/133 (2%) Frame = +3 Query: 465 PXTPXXXGPPPPPX-PXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXXX 641 P P PPPP P PPP P P P + G +P Sbjct: 320 PAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPP----WATSNSGPKPLMSTPVQRPPGMR 375 Query: 642 XRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLX 821 G G G P P P P G P P P G P Sbjct: 376 PPGAG-NGPGGPPPPWSKPGGILP--GPPPPGPPMLNMAPSIPPWQTTP---GYIPPPPP 429 Query: 822 XXP--XPPPPPPP 854 P PPPPPPP Sbjct: 430 GFPQFQPPPPPPP 442 Score = 33.5 bits (73), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXP-XPPPXPXXGXAPPP 967 P PP PP P P PPP P APPP Sbjct: 320 PAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPP 352 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXP----PPXPPXXPXXXPPRAPRXAXXP 962 P PPPP PP P PP PP P PP P + P Sbjct: 398 PGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPPSDAP 446 Score = 32.7 bits (71), Expect = 0.49 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXP 554 PPPPP PPPPP P P Sbjct: 425 PPPPPGFPQFQPPPPPPPSDAP 446 Score = 32.3 bits (70), Expect = 0.65 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXP-XXXPPRAPRXAXXPPPAA 974 PPPP A P PP P P PP P PPP A Sbjct: 307 PPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPPWA 354 Score = 32.3 bits (70), Expect = 0.65 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 10/59 (16%) Frame = +3 Query: 414 GGGGGGXXPPXXXGXGXPXTPXXXGPP--------PP--PXPXXXXPPPPPXPPXXPXP 560 G G GG PP G P GPP PP P PPPP P P P Sbjct: 380 GNGPGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPP 438 Score = 29.5 bits (63), Expect = 4.6 Identities = 18/54 (33%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +3 Query: 813 PLXXXPXPPP---PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P P PPP PPPP + P PPP P PP A + P Sbjct: 315 PAAFAPAPPPSQAPPPP------KTIPSTLPPPPVPSATSAPPPWATSNSGPKP 362 Score = 29.5 bits (63), Expect = 4.6 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 P PP PP P P P PPP P R Sbjct: 421 PGYIPPPPPGFPQFQPPPPPPPSDAPWIERPKR 453 Score = 29.1 bits (62), Expect = 6.1 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPP-PXPXXXXP-PPPPXPP 545 PP G P GPPPP P P PPPP PP Sbjct: 371 PPGMRPPGAGNGPG--GPPPPWSKPGGILPGPPPPGPP 406 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P + PP P PPPPP P P P Sbjct: 400 PPPPGPPMLNMAPSI---PPWQTTPGYIPPPPPGFPQFQPPP 438 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 35.9 bits (79), Expect = 0.053 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PP PPP P P PPP P G PPP Sbjct: 195 PPPPPPGPGGIP---PPPPPIRGGVPPP 219 Score = 35.5 bits (78), Expect = 0.070 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PPPPP P PPPPP P P Sbjct: 196 PPPPPGPGGIPPPPPPIRGGVPPP 219 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPP 536 P P G PPPP P PPPP Sbjct: 197 PPPPGPGGIPPPPPPIRGGVPPPP 220 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +3 Query: 465 PXTPXXXG--PPPPPXPXXXXPPPPP 536 P P G PPPPP PPPPP Sbjct: 196 PPPPPGPGGIPPPPPPIRGGVPPPPP 221 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 35.9 bits (79), Expect = 0.053 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPPP P P P PP PP P PPP Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPPPP------PPEPPEECPPPPP 591 Score = 33.5 bits (73), Expect = 0.28 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPP 536 P + PPPPP P PPPPP Sbjct: 568 PPSEDPKPPPPPPEPPEECPPPPP 591 Score = 33.1 bits (72), Expect = 0.37 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +3 Query: 465 PXTPXXXGPPP-PPXPXXXXPPPPPXPPXXPXP 560 P P PPP PP PPPPP PP P Sbjct: 556 PPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPP 588 Score = 33.1 bits (72), Expect = 0.37 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 3/27 (11%) Frame = +2 Query: 872 PRXPP---PXPPPXPPXXPXPXPPPXP 943 P PP P PPP PP P PPP P Sbjct: 565 PPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P P PPP P P PPP PP P Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPPPPPPEPP 583 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 471 TPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 TP PPPPP P PP P P P Sbjct: 549 TPSEEPPPPPPGVDIPPPLPPSEDPKPPPP 578 Score = 31.1 bits (67), Expect = 1.5 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 9/41 (21%) Frame = +2 Query: 872 PRXPPPXPPP---XPPXXP------XPXPPPXPXXGXAPPP 967 P PP PPP PP P P PPP P PPP Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPP 590 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXP 542 PP P P PPPP P PPP P Sbjct: 557 PPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXPXGG 232 P P P PPPPP P P P G Sbjct: 566 PLPPSEDPKPPPPPPEPPEECPPPPPG 592 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 35.9 bits (79), Expect = 0.053 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +2 Query: 872 PRXP-PPXPPPXPPXXPXPXPPPXPXXG 952 P P PP PP PP P P PPP P G Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPPSGG 86 Score = 34.3 bits (75), Expect = 0.16 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 486 GPPPPPXPXXXXPPPPPXPPXXPXP 560 GP P P PPPPP PP P P Sbjct: 58 GPTVPIPPTLPPPPPPPPPPLPPPP 82 Score = 33.1 bits (72), Expect = 0.37 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXP 554 P PP P PPPPP PP P Sbjct: 62 PIPPTLPPPPPPPPPPLPPPPP 83 Score = 32.7 bits (71), Expect = 0.49 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P PP PPPPPPP P Sbjct: 64 PPTLPPPPPPPPPPLPP 80 Score = 32.3 bits (70), Expect = 0.65 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 453 GXGXPXTPXXXGPPPPPXPXXXXPPPPP 536 G P P PPPPP P PPPPP Sbjct: 58 GPTVPIPPTLPPPPPPPPP--PLPPPPP 83 Score = 31.9 bits (69), Expect = 0.86 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXPXGG 232 P P PP PPPPP P P P GG Sbjct: 62 PIPPTLPPPPPPPPP--PLPPPPPSGG 86 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 899 PXPPXXPXPXPPPXPXXGXAPP 964 P PP P P PPP P PP Sbjct: 62 PIPPTLPPPPPPPPPPLPPPPP 83 Score = 28.7 bits (61), Expect = 8.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P PP PPPPPP P Sbjct: 65 PTLPPPPPPPPPPLPPP 81 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 35.9 bits (79), Expect = 0.053 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 P+ P PPPPPPP P P P P P PP P Sbjct: 1655 PVFHYPAPPPPPPPAPGPPGPDGPMGLPGPQGPDGP-KGPPGPP 1697 Score = 33.1 bits (72), Expect = 0.37 Identities = 27/91 (29%), Positives = 27/91 (29%), Gaps = 1/91 (1%) Frame = +3 Query: 465 PXTPXXXGP-PPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXXX 641 P P P PPPP P PP P P P P G P Sbjct: 1652 PWYPVFHYPAPPPPPPPAPGPPGPDGPMGLPGP-----QGPDGPKGPPGPPGLPGPQGIP 1706 Query: 642 XRAXGAXGAXGXPGPXGXPXXXXPXGGGGGP 734 G G GP G P P GG G P Sbjct: 1707 GYPGAPAGPPGRDGPMGPP---GPSGGQGPP 1734 Score = 32.3 bits (70), Expect = 0.65 Identities = 32/115 (27%), Positives = 33/115 (28%), Gaps = 9/115 (7%) Frame = +3 Query: 417 GGGGGXXPPXXXGXGXPX-TPXXXGPPPPPXP-----XXXXPPPPP---XPPXXPXPXXV 569 G G PP G P P GPP PP P PP PP P P Sbjct: 1777 GASGVDGPPGLAGPQGPKGMPGPPGPPGPPGAIGWKGNPGNPAGPPGLDGPPGPPGPQGP 1836 Query: 570 RFXXXGGGXRPXXXXXXTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGP 734 + G P G G G PGP G P G G P Sbjct: 1837 K--GWPGVPGPPGPPGAYGWKGYPGNPAGPPGRDGIPGPPGRQGGKGPAGIPGIP 1889 Score = 31.9 bits (69), Expect = 0.86 Identities = 26/98 (26%), Positives = 27/98 (27%) Frame = -3 Query: 733 GPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXXXXXXGRXPPPXXXKRTXXGX 554 GPP PP G P P P P G PP Sbjct: 1801 GPPGPPGAIGWKGNPGNPAGPPGLDGPPGPPGPQG-PKGWPGVPGPPGPPGAYGWKGYPG 1859 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXG 440 G G G G GG GP G+ G P P G Sbjct: 1860 NPAGPPGRDGIPGPPGRQGGKGP--AGIPGIPGPGGVG 1895 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +2 Query: 137 PLFXXPPPXWXPPXXPPPP-PXXPXXXPXPXG 229 P+F P P PP P PP P P P P G Sbjct: 1655 PVFHYPAPPPPPPPAPGPPGPDGPMGLPGPQG 1686 Score = 30.3 bits (65), Expect = 2.6 Identities = 26/97 (26%), Positives = 27/97 (27%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXX 617 PP G P G P P P P PP PP P P + P Sbjct: 1664 PPPPPAPGPPGPDGPMGLPGPQGP--DGPKGPPGPPGLPGPQGIPGYPGAPAGPPGRDG- 1720 Query: 618 XTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGG 728 G G G GP G P G GG Sbjct: 1721 ----------PMGPPGPSGGQGPPGDMGSMGPMGMGG 1747 Score = 30.3 bits (65), Expect = 2.6 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = -3 Query: 805 PXPPAXGRXXRGXXXXXXXXXXXXGPPPPPXGXXXXGXPXGPGXPXAPXAPXAR 644 P PPA G GP PP G PG P AP P R Sbjct: 1665 PPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPPGR 1718 Score = 30.3 bits (65), Expect = 2.6 Identities = 26/86 (30%), Positives = 27/86 (31%) Frame = +3 Query: 654 GAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXXXPX 833 G GA G GP G P G G P P AG G L P Sbjct: 1774 GTQGASGVDGPPGLAGPQGPKGMPGPPGPPGPPGAIGWKGNPGNP-AGPPG---LDGPPG 1829 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPP 911 PP P P + P PP PP Sbjct: 1830 PPGPQGP------KGWPGVPGPPGPP 1849 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP P P P P P P G PP Sbjct: 1663 PPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPP 1694 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +2 Query: 164 WXPPXXPPPPPXXPXXXPXPXGGXXXXXLXXEKXXXXXXGGXXXGGAPGP 313 W P P PP P P P G L + G G PGP Sbjct: 1653 WYPVFHYPAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGP 1702 Score = 29.1 bits (62), Expect = 6.1 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = -3 Query: 847 GGGGGXGXXXRGXXPXPPAXGRXXRGXXXXXXXXXXXXGPPPPPXGXXXXGXPXGPGXPX 668 G G G P PP +G GPP PP G P PG P Sbjct: 1789 GPQGPKGMPGPPGPPGPPG-AIGWKGNPGNPAGPPGLDGPPGPPGPQGPKGWPGVPGPPG 1847 Query: 667 APXA 656 P A Sbjct: 1848 PPGA 1851 Score = 28.7 bits (61), Expect = 8.0 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 887 PXPPPXPPXXPXPXPPPXPXXGXAPP 964 P P PP P PP P G PP Sbjct: 1709 PGAPAGPPGRDGPMGPPGPSGGQGPP 1734 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 35.9 bits (79), Expect = 0.053 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +2 Query: 872 PRXP-PPXPPPXPPXXPXPXPPPXPXXG 952 P P PP PP PP P P PPP P G Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPPSGG 310 Score = 34.3 bits (75), Expect = 0.16 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 486 GPPPPPXPXXXXPPPPPXPPXXPXP 560 GP P P PPPPP PP P P Sbjct: 282 GPTVPIPPTLPPPPPPPPPPLPPPP 306 Score = 33.1 bits (72), Expect = 0.37 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXP 554 P PP P PPPPP PP P Sbjct: 286 PIPPTLPPPPPPPPPPLPPPPP 307 Score = 32.7 bits (71), Expect = 0.49 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P PP PPPPPPP P Sbjct: 288 PPTLPPPPPPPPPPLPP 304 Score = 32.3 bits (70), Expect = 0.65 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 453 GXGXPXTPXXXGPPPPPXPXXXXPPPPP 536 G P P PPPPP P PPPPP Sbjct: 282 GPTVPIPPTLPPPPPPPPP--PLPPPPP 307 Score = 31.9 bits (69), Expect = 0.86 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXPXGG 232 P P PP PPPPP P P P GG Sbjct: 286 PIPPTLPPPPPPPPP--PLPPPPPSGG 310 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 899 PXPPXXPXPXPPPXPXXGXAPP 964 P PP P P PPP P PP Sbjct: 286 PIPPTLPPPPPPPPPPLPPPPP 307 Score = 28.7 bits (61), Expect = 8.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P PP PPPPPP P Sbjct: 289 PTLPPPPPPPPPPLPPP 305 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 35.9 bits (79), Expect = 0.053 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 426 GGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 GG PP G PPPPP P PPPP PP Sbjct: 288 GGMLPPPFGGH------PAAAPPPPPLPAGVPAPPPPPPP 321 Score = 33.1 bits (72), Expect = 0.37 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPP 911 P P GG P P PPPPP P PPP PP Sbjct: 280 PPPPPPLTGGMLPPPFGGHPAAAPPPPP----LPAGVPAPPPPPPPP 322 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXP 943 P PP PPP P P P PPP P Sbjct: 299 PAAAPP-PPPLPAGVPAPPPPPPP 321 Score = 31.9 bits (69), Expect = 0.86 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 6/51 (11%) Frame = +3 Query: 828 PXPPPP------PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXP 962 P PPPP PPP A P PPP P P PP P P Sbjct: 280 PPPPPPLTGGMLPPPFGGHPAAAPP---PPPLPAGVPAPPPPPPPPMLGGP 327 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 PP G P PPP P P PP PP P Sbjct: 284 PPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 29.9 bits (64), Expect = 3.5 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 829 PXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 P PPPPP P PP PP P G P PPP Sbjct: 276 PTSQPPPPP--PLTGGMLPPPFGGHPAAAPPP--PPLPAGVPAPPPP 318 Score = 29.1 bits (62), Expect = 6.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP P PPPP P P P Sbjct: 292 PPPFGGHPAAAPPPPPLPAGVPAP 315 Score = 28.7 bits (61), Expect = 8.0 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPPP P P P P P P PPP Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAP-PPPPLPAGVPAPPPPPPP 321 Score = 28.7 bits (61), Expect = 8.0 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 10/42 (23%) Frame = +2 Query: 872 PRXPPPXPPPX------PPXX----PXPXPPPXPXXGXAPPP 967 P PP PPP PP P PPP P APPP Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPP 317 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 35.9 bits (79), Expect = 0.053 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXX--GGXGGGXXXGXARXXXXXXGGGGGGGXG 827 A GG RG + G G GG GGG G GGGGGG G Sbjct: 354 AGNGGNSCQRGGQSGGAAGTASMGGGGGGLQFGNQDYTSRLSYGGGGGGGG 404 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 +GG GGG G G GG GG GG G Sbjct: 262 KGGDRNQPGNAGGGAGEGSTGGPGGINAGGGGG 294 Score = 30.7 bits (66), Expect = 2.0 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGG---GXXXGXARXXXXXXGGGGGGG 833 GG A GG G GG GG G G + GGGGGG Sbjct: 263 GGDRNQPGNAGGGAGEGSTGGPGGINAGGGGGDSTTDSDDGAGGGGGG 310 >SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 35.5 bits (78), Expect = 0.070 Identities = 22/56 (39%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGX--GGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 ++ GG A GA GG G GG GGG G GG GGGG G G Sbjct: 414 SSAGGSSA--GASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTG 467 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 35.5 bits (78), Expect = 0.070 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXP-PXXPXXXPPRAPRXAXXP 962 PPPPPPP A P PPP P P P P P Sbjct: 6 PPPPPPPPIAAEFTAPPAPPPPPNPAPDVPAESVNTQPNSQAAP 49 Score = 33.1 bits (72), Expect = 0.37 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PPPPP PP P PP P P Sbjct: 9 PPPPPIAAEFTAPPAPPPPPNPAP 32 Score = 31.9 bits (69), Expect = 0.86 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PPPPP P PP PP P P Sbjct: 7 PPPPPPPIAAEFTAPPAPPPPPNP 30 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPP 911 PPPPPPP P PPP P Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPPNP 30 Score = 29.5 bits (63), Expect = 4.6 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 6/26 (23%) Frame = +2 Query: 884 PPXPPPXPP------XXPXPXPPPXP 943 PP PPP PP P P PPP P Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPPNP 30 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 35.5 bits (78), Expect = 0.070 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXA-RXXXXXXGGGGGGGXG 827 GGG G G G GG G G G A GGGG GG G Sbjct: 61 GGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVG 108 Score = 33.1 bits (72), Expect = 0.37 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGGG G GG G G G GG Sbjct: 61 GGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGG 101 Score = 32.7 bits (71), Expect = 0.49 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = -3 Query: 964 GGXXAXRGARG-GXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG G G G G GG G G G GG GGGG G G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGG 79 Score = 31.9 bits (69), Expect = 0.86 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G G GG GG G G GGGGG G Sbjct: 57 GCGCGGGNDGGNGGGGAGNGGGGGGAGNG 85 Score = 31.9 bits (69), Expect = 0.86 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G G G G G GGG GG G Sbjct: 78 GGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGG 109 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G GG G G G G G GGGG G G Sbjct: 35 GGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGG 86 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G GG G GGG G GG G G G GG Sbjct: 66 GGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGG 106 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGGG G G G G G G GG Sbjct: 31 GVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGG 71 Score = 30.7 bits (66), Expect = 2.0 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 G G A G G G GG GG G A G G GG G G Sbjct: 44 GNGGGAGNGV-GAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAG 94 Score = 30.3 bits (65), Expect = 2.6 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXG--GXGGGXXXGXARXXXXXXGGG--GGGGXG 827 GG G GG G G G GGG G A GG GGGG G Sbjct: 56 GGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSG 105 Score = 29.5 bits (63), Expect = 4.6 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 AG G A GG G GG G G G G G G G G Sbjct: 49 AGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGG 101 Score = 29.1 bits (62), Expect = 6.1 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GG GG G GGG G G G GG Sbjct: 57 GCGCGGGNDGGNGGGGAGNGGGGGGAGNG-GAAGAAGAGAGG 97 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 G G GG G G GG GG G G Sbjct: 86 GAAGAAGAGAGGNVGGGGSGGVGGNGGSG 114 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 35.5 bits (78), Expect = 0.070 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAPP 964 PP PPP P P P PPP P P Sbjct: 424 PPPPPPPAPLPPPPPPPPQPTTALPDP 450 Score = 35.5 bits (78), Expect = 0.070 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXP 542 PPPPP P PPPPP P Sbjct: 424 PPPPPPPAPLPPPPPPPP 441 Score = 35.5 bits (78), Expect = 0.070 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 492 PPPPXPXXXXPPPPPXPP 545 PPPP P PPPPP PP Sbjct: 424 PPPPPPPAPLPPPPPPPP 441 Score = 35.5 bits (78), Expect = 0.070 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXP 542 PPPPP P PPPPP P Sbjct: 426 PPPPPAPLPPPPPPPPQP 443 Score = 33.1 bits (72), Expect = 0.37 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PPPPP PPPPP P P Sbjct: 425 PPPPPPAPLPPPPPPPPQPTTALP 448 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXP-PXXPPPPPXXPXXXPXPXGG 232 P P P + PPP P P PPPPP P P G Sbjct: 409 PFPTPNRRRRRSLVQPPPPPPPAPLPPPPPPPPQPTTALPDPLQG 453 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 772 PGXXARARGGXGXXPXXXPPXPPPPPPPXXP 864 P R R P PP P PPPPP P Sbjct: 411 PTPNRRRRRSLVQPPPPPPPAPLPPPPPPPP 441 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P P PPPPPPP P Sbjct: 427 PPPPAPLPPPPPPPPQP 443 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 35.5 bits (78), Expect = 0.070 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 RGGG G GGG GG GGG GGG Sbjct: 52 RGGGRGGGRGGGGGFKSPRGGGRGGGRGGG 81 Score = 33.1 bits (72), Expect = 0.37 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 4/37 (10%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGG----XGGGXGGGXRG 871 RGGG G G G G G GG GGG GGG G Sbjct: 44 RGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGG 80 Score = 32.7 bits (71), Expect = 0.49 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 R G + G GGG G GG GGG GGG Sbjct: 34 RPGFSPRGAGRGGGRGGPRGGGRGGGRGGG 63 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -3 Query: 946 RGA-RGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 RGA RGG G GG GG G GG GGG G Sbjct: 40 RGAGRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGG 80 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 943 GARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 G RGG G GG G G G GGG GGG G Sbjct: 46 GGRGGPRGGGRGG-GRGGGGGFKSPRGGGRGGGRGGGRG 83 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXX-GXGGGGG 488 G G GG GGGGG G G GGG Sbjct: 53 GGGRGGGRGGGGGFKSPRGGGRGGG 77 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 35.5 bits (78), Expect = 0.070 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P P PPPP P P P P PPR P+ P P Sbjct: 1066 PSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTPAPRP 1117 Score = 35.1 bits (77), Expect = 0.092 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 872 PRXPP--PXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 P PP P PPP P P PPP PPPR Sbjct: 1055 PIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPR 1089 Score = 33.9 bits (74), Expect = 0.21 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +3 Query: 813 PLXXXPXPPP--PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PPP P PP PPP P P PP PPP Sbjct: 1035 PPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPP 1088 Score = 33.9 bits (74), Expect = 0.21 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXP--PPXPXXGXAPPPR 970 P PP P P P P P P P P APPPR Sbjct: 1040 PLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPR 1074 Score = 29.5 bits (63), Expect = 4.6 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P PP A P PPP P P P P PPP+ Sbjct: 1022 PTEQPVPPKRKASPPSAQPL--PPPRKPSPPPSAVPIPPPRKPSPPPS 1067 Score = 28.7 bits (61), Expect = 8.0 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 872 PRXPP--PXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 P PP P P P P P PP P AP PR Sbjct: 1084 PVPPPRQPDPIPTNPAHPTEPPPRQPKPTPAPRPR 1118 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 35.1 bits (77), Expect = 0.092 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPP-PXPXXGXAPPP 967 P PP PP PP P PP P P PPP Sbjct: 1020 PTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPP 1052 Score = 33.1 bits (72), Expect = 0.37 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPR 947 PP PP P PP PP P PP PR Sbjct: 1023 PPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQPR 1060 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAP 961 P PP PPP P P P PP P P Sbjct: 1027 PPTDPPTPPPTEPPTPPPTEPPTPPPTDPP 1056 Score = 31.9 bits (69), Expect = 0.86 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 P PP PP PP P PP P PR Sbjct: 1028 PTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQPR 1060 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPP-PPPXPPXXPXP 560 P P P PP P PP PPP P P P Sbjct: 1020 PTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPP 1052 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPP--PPXPPXXPXPXXVR 572 P T PP PP PPP PP PP P R Sbjct: 1023 PPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQPR 1060 Score = 28.7 bits (61), Expect = 8.0 Identities = 16/54 (29%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Frame = +3 Query: 786 PXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPP-XPPXXPXXXPPRAP 944 P +G P P P PP P PP PP P PP P Sbjct: 1002 PTSGPTNPGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDP 1055 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 35.1 bits (77), Expect = 0.092 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 5/50 (10%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXP--XXXPP---PXPPXXPXXXPPRAPRXAXXPPP 968 PPPPPPP R P PP P PP P P + + + P P Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVP 826 Score = 30.3 bits (65), Expect = 2.6 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 785 PXRGGGGXXPPXXXXXXXXXXXXXXXXXXPRXPPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 P R G PP P PPP P P P P P PP Sbjct: 748 PGRRPGVEWPPLAKSSSDGAAIDKKALGAPPPPPPPTKPATPRVPPNIPSRPPGARPTPP 807 Query: 965 P 967 P Sbjct: 808 P 808 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 423 GGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 G PP P P P PP PPPPP P P Sbjct: 775 GAPPPPPPPTKPATPRVPPNI-PSRPPGARPTPPPPPPGKPTKP 817 Score = 28.7 bits (61), Expect = 8.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPP 937 PR PP P P P P PPP Sbjct: 789 PRVPPNIPSRPPGARPTPPPPP 810 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 35.1 bits (77), Expect = 0.092 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGX-GGGXGGGXR 874 GG G GGG G G GG GGG GGG R Sbjct: 112 GGGRGGGGYGGGRGGGGYGGGRGGGYGGGRR 142 Score = 33.1 bits (72), Expect = 0.37 Identities = 20/51 (39%), Positives = 21/51 (41%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG + G GG G GG GG G R GGG GGG G G Sbjct: 94 GGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRG-----GGGYGGGRGGGYGG 139 Score = 32.7 bits (71), Expect = 0.49 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 G A GGG G GG GGG GGG G Sbjct: 90 GSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYG 121 Score = 32.3 bits (70), Expect = 0.65 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXR 815 AGG G G G GG GGG G GGG GGG G R Sbjct: 93 AGGYRSGGGGYGGSSRGGYGGGRGGGGYGGG--RGGGGYGGGRGGGYGGGRR 142 Score = 30.7 bits (66), Expect = 2.0 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 A G R GG GG GGG G G GGG G G Sbjct: 88 AGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGG 136 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 GG RG G GG GGG G GG GGG Sbjct: 109 GGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGGSKGGG 152 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G G GG GGGG G G GGG G Sbjct: 117 GGGYGGGRGGGGYGGGRGGGYGGGRRDYG 145 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G GG GGG G G G GGG G G Sbjct: 104 GGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGG 135 Score = 28.7 bits (61), Expect = 8.0 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = -3 Query: 961 GXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 G G+R G GG GG G GGG GG G Sbjct: 84 GERGAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGG 128 Score = 28.7 bits (61), Expect = 8.0 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 946 RGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 RGA G G G GG GGG GGG G G Sbjct: 86 RGAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYG 130 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGG 493 G G G G GGG G R GGG Sbjct: 126 GGGYGGGRGGGYGGGRRDYGGG 147 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 35.1 bits (77), Expect = 0.092 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 4/51 (7%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGG----GGGGXG 827 GGG + G GG G GG GG G R GGG GGG G Sbjct: 189 GGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKG 239 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G GGG G G GG GGG Sbjct: 213 GGGYGGGRGGGGGYGGGRRDYGGGSKGGG 241 Score = 30.3 bits (65), Expect = 2.6 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG + RG GG G GG GGG G GGG G G Sbjct: 197 GGYGGSSRGGYGGGRGG--GGYGGGRGGGGGYGGGRRDYGGGSKGGG 241 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = -3 Query: 943 GARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 G++GG GG GG G GGG GG G G Sbjct: 186 GSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGG 229 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = -3 Query: 559 GXGXXGGXGG--GGGXXXXGXGGGGG 488 G GG GG GGG G GGGGG Sbjct: 200 GGSSRGGYGGGRGGGGYGGGRGGGGG 225 Score = 28.7 bits (61), Expect = 8.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 RGGG G G G G G GG GGG G Sbjct: 182 RGGGGSQGGGYRSGGG-GYGGSSRGGYGGGRGG 213 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGG 493 G G G G GGG G R GGG Sbjct: 215 GYGGGRGGGGGYGGGRRDYGGG 236 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 34.7 bits (76), Expect = 0.12 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -3 Query: 574 KRTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPPPPPP 410 K T G GG GGG G G G G G G P G P PP P Sbjct: 3692 KYTYVEGGGYGGGGGGYGGGGGGYGDGTGGAAFGSAYAAVPVSGTGQPPAPPDIP 3746 Score = 34.3 bits (75), Expect = 0.16 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGGXXPPPPPPP 409 G G G G GGG G G G G G G P G P PP P Sbjct: 3698 GGGYGGG-GGGYGGGGGGYGDGTGGAAFGSAYAAVPVSGTGQPPAPPDIP 3746 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +3 Query: 828 PXPPP----PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 P PPP PPPP P P PP P PP AP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAP 164 Score = 32.7 bits (71), Expect = 0.49 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +2 Query: 872 PRXPPPXP-PPXPPXXPXPXPPPXPXXGXAPP 964 P PPP P P PP P P PP APP Sbjct: 134 PVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 32.3 bits (70), Expect = 0.65 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = +3 Query: 423 GGGXXPPXXXGX--GXPXTPXXXGPPPPPXPXXXXPPPPP--XPPXXP 554 GG PP G P TP GP PP P PP PP PP P Sbjct: 118 GGYVPPPPPTGTLPPPPVTPPP-GPETPPPPDTPAPPVPPTEAPPTAP 164 Score = 31.9 bits (69), Expect = 0.86 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 1/58 (1%) Frame = +3 Query: 795 GGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPP-XXPXXXPPRAPRXAXXPP 965 GG P PPPP P P PP PP P PP PP Sbjct: 118 GGYVPPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPPTGGSCVSKPP 175 Score = 31.9 bits (69), Expect = 0.86 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXG 952 P PPP P PP P PP P G Sbjct: 141 PETPPPPDTPAPPVPPTEAPPTAPPTG 167 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +3 Query: 453 GXGXPXTPXXXGPPPP-PXPXXXXPPPPPXPPXXPXP 560 G P P PPPP P PPPP P P P Sbjct: 119 GYVPPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVP 155 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXP---XPXGG 232 P P P P+ P P PP P PP P P P GG Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPPTGG 168 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 840 PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 PPPPP P PPP P P P P PP A Sbjct: 122 PPPPPTGTLPP---PPVTPPPGPETPPPPDTPAPPVPPTEAPPTA 163 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PP PPP P P P P P PP Sbjct: 133 PPVTPPPGPETPPPPDTPAPPVPPTEAPP 161 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 2/47 (4%) Frame = +2 Query: 425 GGXXPPXXXGARXXPHPXXX--GPXPPPXPRXXXPXPPPXPXPXPXP 559 GG PP P P GP PP P P PP P P Sbjct: 118 GGYVPPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAP 164 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXP-PPXPXXGXAPP 964 P PP P PP P P P P P APP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPP 153 Score = 29.1 bits (62), Expect = 6.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 896 PPXPPXXPXPXPPPXPXXGXAPPP 967 PP PP P PP P G PP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPP 145 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 P P PP PP P PPP PP Sbjct: 126 PTGTLPPPPVTPPPGPETPPPPDTPAPPVPP 156 Score = 28.7 bits (61), Expect = 8.0 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +3 Query: 786 PXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPP 911 P G P+ P P PPPP P PP PP Sbjct: 125 PPTGTLPPPPVTPPPGPETPPPPDTPAPP-VPPTEAPPTAPP 165 >SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 516 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G GGG G GG GGG GGG RG Sbjct: 403 GGRGGYRGRGGGRGY-YRGGRGGGRGGGGRG 432 Score = 28.7 bits (61), Expect = 8.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 571 RTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 R G G G GGG G G GGG G G G Sbjct: 400 RGRGGRGGYRGRGGGRGYYRGGRGGGRGGGGRGGRG 435 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P PPP PP P PPP P P P Sbjct: 449 PPLPSDEPPPLPPDEEKPPPPPAPALPPLPLP 480 Score = 33.5 bits (73), Expect = 0.28 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 PP P P PPPPP P PP P PP P Sbjct: 449 PPLPSDEPPPLPPDEEKPPPPPAPAL---PPLPLPPELP 484 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P PPP P PPPPP P P P Sbjct: 450 PLPSDEPPPLPPDEEKPPPPPAPALPPLP 478 Score = 32.3 bits (70), Expect = 0.65 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXP-XXGXAPP 964 P P PPP P P P PP P G +PP Sbjct: 461 PDEEKPPPPPAPALPPLPLPPELPGSPGDSPP 492 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P PP PP PPP P P P P Sbjct: 449 PPLPSDEPPPLPPDEEKPPPPPAPALPPLPLP 480 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P PPP + P PP P P PP P PPA Sbjct: 450 PLPSDEPPPLPPDEEKPPP----PPAPALPPLPLPPELPGSPGDSPPA 493 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPP PP P P P PP P P + PP Sbjct: 456 PPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPP 500 Score = 29.5 bits (63), Expect = 4.6 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPP-RAPRXAXXPP 965 PPPPP P A P PP P P PP +P+ PP Sbjct: 466 PPPPPAP-------ALPPLPLPPELPGSPGDSPPATSPKQPPLPP 503 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 PPP PP A P PPP P PP AP Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAP 214 Score = 33.9 bits (74), Expect = 0.21 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 PP G P PPPP P PPPP PP Sbjct: 180 PPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +2 Query: 881 PPPXPP---PXPPXXPXP-XPPPXPXXGXAPPP 967 PPP PP PP P PPP P PPP Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPP 211 Score = 29.5 bits (63), Expect = 4.6 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRF 575 P P PPP P PP PP P P F Sbjct: 181 PAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPPTF 217 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 31.1 bits (67), Expect = 1.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 826 PPXPPPPPPPXXP 864 PP PPPPPPP P Sbjct: 819 PPPPPPPPPPEEP 831 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P P P PPP P G PPP Sbjct: 884 PAVLPGLPGTPPITSPSSLPPPPPLQGYNPPP 915 Score = 29.1 bits (62), Expect = 6.1 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 826 PPXPPPPPPP 855 PP PPPPPPP Sbjct: 818 PPPPPPPPPP 827 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +3 Query: 459 GXPXTPXXXGPP--PPPXPXXXXPPPPP 536 G P TP P PPP P PPPP Sbjct: 889 GLPGTPPITSPSSLPPPPPLQGYNPPPP 916 Score = 27.5 bits (58), Expect(2) = 0.13 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 814 PXXXPPXPPPPPPP 855 P P PPPPPPP Sbjct: 813 PHEDSPPPPPPPPP 826 Score = 25.8 bits (54), Expect(2) = 0.13 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 835 PPPPPPPXXP 864 PPPPPPP P Sbjct: 818 PPPPPPPPPP 827 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 34.3 bits (75), Expect = 0.16 Identities = 19/66 (28%), Positives = 21/66 (31%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXXXXRAXGAXGA 668 PPP PPPPP P P + G RP + G G Sbjct: 1224 PPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGP 1283 Query: 669 XGXPGP 686 G PGP Sbjct: 1284 PGPPGP 1289 Score = 33.9 bits (74), Expect = 0.21 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPX---PXXXXPPPPPXPPXXPXP 560 PP G P PP PP P PP PP PP P P Sbjct: 1246 PPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGP 1289 Score = 33.9 bits (74), Expect = 0.21 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXP 217 PP P P F PPP PP PP PP P P Sbjct: 1253 PPPPPGMRPMPPQPPFMPPPPRMQPP-GPPGPPGPPGPQP 1291 Score = 31.9 bits (69), Expect = 0.86 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPP--PXPPXXPXXXPPRAPRXAXXPPP 968 P PPP PP P P P PP P PP PR PP Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPP--PRMQPPGPP 1281 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 PP P G PPPP PP PP P P Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPP 1273 Score = 30.7 bits (66), Expect = 2.0 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +3 Query: 429 GXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVR 572 G PP P P PPPP PP PP PP P P R Sbjct: 1251 GLPPPPPGMRPMPPQPPFM--PPPPRMQPPGPPGPPGPP-GPQPSNKR 1295 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXP 553 PP G R P P PP P PP P P P Sbjct: 1253 PPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +3 Query: 840 PPPPPXXXXXXRAXPXXXPPP--XPPXXPXXXPPRAPR 947 PPPPP P PPP PP P P P+ Sbjct: 1253 PPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQ 1290 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 PPP PP P PPP P PP Sbjct: 1237 PPPAMPPDGPPKFMGLPPPPPGMRPMPP 1264 Score = 28.7 bits (61), Expect = 8.0 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXP-PPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PP P P PP PP P PPR PP Sbjct: 1239 PAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMP--PPPRMQPPGPPGPP 1284 Score = 28.7 bits (61), Expect = 8.0 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXPXG 229 PP P P P PP PPPP P P P G Sbjct: 1242 PPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPG 1285 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P PP P PPP P P Sbjct: 1255 PPPGMRPMPPQPPFMPPPPRMQPPGPPGP 1283 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 34.3 bits (75), Expect = 0.16 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 A GGG A G G G GGG G GG GGG G G Sbjct: 246 ATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG 299 Score = 34.3 bits (75), Expect = 0.16 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 A GGG A G G G GGG G GG GGG G G Sbjct: 253 ATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG 306 Score = 34.3 bits (75), Expect = 0.16 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 A GGG A G G G GGG G GG GGG G G Sbjct: 274 ATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGG 327 Score = 34.3 bits (75), Expect = 0.16 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 A GGG A G G G GGG G GG GGG G G Sbjct: 281 ATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGG 334 Score = 34.3 bits (75), Expect = 0.16 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = -3 Query: 568 TXXGXGXXGGXGG--GGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXP 428 T G G GG GG GGG G GGG GV G GG P Sbjct: 310 TGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGP 358 Score = 33.9 bits (74), Expect = 0.21 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGGA G G G G GG GG GGG Sbjct: 243 GGGATGGGGGATGGGGGATGGGGGATGGG 271 Score = 33.9 bits (74), Expect = 0.21 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 A GGG A G G G GGG G GG GGG G Sbjct: 260 ATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 308 Score = 33.9 bits (74), Expect = 0.21 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 A GGG A G G G GGG G GG GGG G G Sbjct: 295 ATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGG 348 Score = 33.5 bits (73), Expect = 0.28 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 A GGG A G G G GGG G GG G GG G Sbjct: 316 ATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGGCG 364 Score = 33.1 bits (72), Expect = 0.37 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 A GGG A G GG G G GGG G A GGGGG G Sbjct: 267 ATGGGGGATGGG-GGATGGGGGATGGG---GGATGGGGGATGGGGGATG 311 Score = 33.1 bits (72), Expect = 0.37 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 1/64 (1%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGG-GGGXGXXXRGXXPXP 797 A GGG A G GG G G GGG GGG GGG G G P Sbjct: 302 ATGGGGGAT-GVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGS 360 Query: 796 PAXG 785 G Sbjct: 361 GGCG 364 Score = 32.7 bits (71), Expect = 0.49 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 568 TXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 T G G GG GG G GGGGGP G Sbjct: 331 TGGGGGATGGGGGVTGGGGGATGGGGGPGSGG 362 Score = 32.3 bits (70), Expect = 0.65 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 568 TXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGV 470 T G G GG GG G GGGGG GV Sbjct: 296 TGGGGGATGGGGGATGVGGGATGGGGGATGGGV 328 Score = 31.9 bits (69), Expect = 0.86 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 GGG G G G GG GG G GGGGG Sbjct: 243 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 287 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 568 TXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 T G G GG GG G GGGGG G Sbjct: 247 TGGGGGATGGGGGATGGGGGATGGGGGATGGG 278 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 568 TXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 T G G GG GG G GGGGG G Sbjct: 254 TGGGGGATGGGGGATGGGGGATGGGGGATGGG 285 Score = 30.7 bits (66), Expect = 2.0 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = -3 Query: 568 TXXGXGXXGGXGG--GGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 T G G GG GG GGG G GGG G G GG Sbjct: 261 TGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG 306 Score = 30.7 bits (66), Expect = 2.0 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = -3 Query: 568 TXXGXGXXGGXGG--GGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 T G G GG GG GGG G GGG G G GG Sbjct: 282 TGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGG 327 Score = 30.7 bits (66), Expect = 2.0 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = -3 Query: 568 TXXGXGXXGGXGG--GGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 T G G GG GG GGG G GGG G G GG Sbjct: 289 TGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGG 334 Score = 30.3 bits (65), Expect = 2.6 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG A G G G GGG G GG GGG G G Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG 292 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 961 GXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 G GA GG GG G G A GGGGG G Sbjct: 239 GRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATG 283 Score = 29.9 bits (64), Expect = 3.5 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 3/50 (6%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXG--GXGGGXXXGXARXXXXXXGG-GGGGG 833 A GGG A G GG G G G GGG G G GGGGG Sbjct: 288 ATGGGGGATGGG-GGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGG 336 Score = 29.5 bits (63), Expect = 4.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G G GG GG G GGGGG G Sbjct: 243 GGGATGGGGGATGGGGGATGGGGGATGGG 271 >SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) Length = 253 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/31 (51%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -2 Query: 863 GXXGGGGGGGXGGXXXGXXPXPP-RARAXXP 774 G GGGGGGG GG G PP R+R+ P Sbjct: 164 GGGGGGGGGGGGGRRGGGSMSPPRRSRSRSP 194 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGG 151 G G GGGGG GG GGG Sbjct: 158 GRNRRRGGGGGGGGGGGGGRRGGG 181 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +3 Query: 840 PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPP + P P P PP P P PPP Sbjct: 335 PPPPPPPSEDFYSMPSSLPMPSPPEDLYDAPATLPSPIMPPPP 377 Score = 33.9 bits (74), Expect = 0.21 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXP 554 PP PP P P PPP PP P Sbjct: 298 PPAPPLPNFTSPSPPPPPPLPP 319 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPP PP P PPP PP P P PPP Sbjct: 297 PPPAPPLPNFTSPSPPP---PPPLPPAMPAMDDLLPPEVLSPPPP 338 Score = 30.3 bits (65), Expect = 2.6 Identities = 18/63 (28%), Positives = 22/63 (34%) Frame = +3 Query: 783 RPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXP 962 +P +G G + P PPP PPP PP +AP P Sbjct: 232 KPVSGRLGLSNIK--PPPPPVPPPTIPSVPPGSETYVPPGSATYESMDSVNKAPVPPMTP 289 Query: 963 PPA 971 PPA Sbjct: 290 PPA 292 Score = 29.9 bits (64), Expect = 3.5 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PP PPP P P PP +PPP Sbjct: 285 PPMTPPPAVVTAPPPAPPLPNFTSPSPPP 313 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPP PP P P PP P P P P Sbjct: 311 PPPPPPLPPAMPAMDDLLPPEVLSPPPPPPPSEDFYSMPSSLPMPSP 357 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 33.9 bits (74), Expect = 0.21 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 471 TPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 TP PPPP P PPPPP PP P Sbjct: 72 TPPPLCAPPPPPP---PPPPPPPPPGAKKP 98 Score = 33.5 bits (73), Expect = 0.28 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXP 943 PPP P PP P P PPP P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPP 93 Score = 33.1 bits (72), Expect = 0.37 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 784 ARARGGXGXXPXXXPPXPPPPPPPXXP 864 A++ P PP PPPPPPP P Sbjct: 65 AKSMAAATPPPLCAPPPPPPPPPPPPP 91 Score = 31.9 bits (69), Expect = 0.86 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXP 205 PPP PP PPPPP P Sbjct: 73 PPPLCAPPPPPPPPPPPP 90 Score = 31.1 bits (67), Expect = 1.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 826 PPXPPPPPPPXXP 864 PP PPPPPPP P Sbjct: 80 PPPPPPPPPPPPP 92 Score = 31.1 bits (67), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXP 943 PPP PPP PP P P P Sbjct: 81 PPPPPPPPPPPPPGAKKPDDP 101 Score = 31.1 bits (67), Expect = 1.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 826 PPXPPPPPPPXXP 864 PP PPPPPPP P Sbjct: 81 PPPPPPPPPPPPP 93 Score = 30.7 bits (66), Expect = 2.0 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 814 PXXXPPXPPPPPPP 855 P PP PPPPPPP Sbjct: 79 PPPPPPPPPPPPPP 92 Score = 30.7 bits (66), Expect = 2.0 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 814 PXXXPPXPPPPPPP 855 P PP PPPPPPP Sbjct: 80 PPPPPPPPPPPPPP 93 Score = 30.7 bits (66), Expect = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPP 934 P PPP PPP PP P P Sbjct: 81 PPPPPPPPPPPPPGAKKPDDP 101 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 137 PLFXXPPPXWXPPXXPPPPP 196 P PPP PP PPPPP Sbjct: 74 PPLCAPPPPPPPPPPPPPPP 93 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPP 934 P PP PPP PP P P PP Sbjct: 75 PLCAPPPPPPPPP--PPPPPP 93 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 33.9 bits (74), Expect = 0.21 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 GG GGGGG G GGGGG G GG Sbjct: 468 GGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGG 503 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGGXRG 871 G GG G G GG GGG GG G Sbjct: 472 GGGGPNGAGGGGGGGGGYSGGASG 495 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 943 GARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGG 836 G GG GG GGG G A GGGGG Sbjct: 471 GGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGG 506 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGGXRG 871 G GGG G GG GGG GGG G Sbjct: 469 GFGGGGGPNGAGG-GGGGGGGYSG 491 Score = 29.5 bits (63), Expect = 4.6 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 6/35 (17%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGG------GXGGG 880 GGG G GGG G G GG G G GGG Sbjct: 472 GGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGG 506 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 P+ P P P PP P P PP P PP Sbjct: 177 PKPPAPSTIPTPPTPPAPPSPPIPTAPPTPP 207 Score = 33.5 bits (73), Expect = 0.28 Identities = 38/172 (22%), Positives = 40/172 (23%), Gaps = 4/172 (2%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXXXX 644 P P PP PP P PP P P P + P Sbjct: 186 PTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNP 245 Query: 645 RAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXX 824 P P P P P P P P Sbjct: 246 PMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIP-LAPPNPYIPPAPPNLF 304 Query: 825 XPXPPP----PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PP P A P PP PP PP P + P P Sbjct: 305 IPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPN--PSIPPAPPNPSIPPAP 354 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P PP PP P P PP P P P Sbjct: 186 PTPPTPPAPPSPPIPTAPPTPPMPETPLP 214 Score = 33.1 bits (72), Expect = 0.37 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +2 Query: 872 PRXPP-PXPPPXPPXXPXPXPPPXPXXGXAPP 964 P PP P PP PP P PP P APP Sbjct: 324 PTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPP 355 Score = 32.3 bits (70), Expect = 0.65 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +2 Query: 872 PRXPP-PXPPPXPPXXPXPXPPPXPXXGXAPP 964 P PP P PP PP P PP P APP Sbjct: 306 PSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPP 337 Score = 31.9 bits (69), Expect = 0.86 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +3 Query: 489 PPPPPXPXXXXPPP-PPXPPXXPXP 560 PP PP P PP PP PP P P Sbjct: 176 PPKPPAPSTIPTPPTPPAPPSPPIP 200 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +2 Query: 872 PRXPP-PXPPPXPPXXPXPXPPPXPXXGXAPP 964 P PP P PP PP P PP P APP Sbjct: 288 PLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPP 319 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PP P P PP PP P P P Sbjct: 315 PPAPPNPYIPTAPPNPSIPPAP-PNPSIPPAPPNPSIPPAP 354 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAP 961 P P P PP PP P PP P AP Sbjct: 195 PSPPIPTAPPTPPMPETPLPPGSPHIPPAP 224 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P TP PP P P PP P P P P Sbjct: 245 PPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNP 285 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXP--PPA 971 PP PP P P PP P P P P P PPA Sbjct: 176 PPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPA 223 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 P P P P PP P PP P APP Sbjct: 316 PAPPNPYIPTAPPNPSIPPAPPNPSIPPAPP 346 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +2 Query: 872 PRXPPPXPPPXP--PXXPXPXPPPXPXXGXAPP 964 P PP PP P P P PP P APP Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPP 204 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAP 961 P P P PP PP P PP P P Sbjct: 186 PTPPTPPAPPSPPIPTAPPTPPMPETPLPP 215 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 P PP P PP P PP P APP Sbjct: 271 PPAPPNPSIPAPPNPSIPLAPPNPYIPPAPP 301 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +2 Query: 872 PRXPPPXP-PPXPPXXPXPXPPPXPXXGXAPP 964 P PP P P PP P P PP P PP Sbjct: 330 PSIPPAPPNPSIPPAPPNPSIPPAPPNLFIPP 361 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 PP P P P PP P PP P P P Sbjct: 262 PPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAP 300 Score = 29.1 bits (62), Expect = 6.1 Identities = 38/169 (22%), Positives = 38/169 (22%), Gaps = 2/169 (1%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXXXX 644 P T P P P PP PP PP P Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPP 231 Query: 645 RAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRP--XAGGXGXXPL 818 A P P P P P P P A PL Sbjct: 232 APPNPSKAIATPNPP-MPETPLPP-ATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPL 289 Query: 819 XXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P P PP P A P PP PP P P PP Sbjct: 290 -APPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPP 337 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 33.9 bits (74), Expect = 0.21 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = +3 Query: 420 GGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXP----PXXPXP 560 G G P G P GPPP P PPPPP P P P P Sbjct: 192 GVGQHSGPYPGQPGMWGPPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 Score = 32.7 bits (71), Expect = 0.49 Identities = 30/108 (27%), Positives = 31/108 (28%) Frame = -3 Query: 733 GPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXXXXXXGRXPPPXXXKRTXXGX 554 GPPP G PG P A G+ P G Sbjct: 129 GPPPSYDSTMQQGGSYPPGQQPYP-GQQAYPGQPGASPQGQPYPGQSYPQGQEPYPEKGG 187 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPPPPPP 410 G G G G G GP G G P G PPPPPPP Sbjct: 188 YPPAGVGQHSGPYP-GQPGMWGPPPMG--GPPPMGGPPGGYPPPPPPP 232 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 417 GGGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP 536 G G PP G P PPPPP P P PP Sbjct: 202 GQPGMWGPPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPP 241 Score = 28.7 bits (61), Expect = 8.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 137 PLFXXPPPXWXPPXXPPPPPXXP 205 P PPP PP PPPP P Sbjct: 210 PPMGGPPPMGGPPGGYPPPPPPP 232 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 33.9 bits (74), Expect = 0.21 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 471 TPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 TP PPPP P PPPPP PP P Sbjct: 273 TPPPLCAPPPPPP---PPPPPPPPPGAKKP 299 Score = 33.5 bits (73), Expect = 0.28 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXP 943 PPP P PP P P PPP P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPP 294 Score = 33.1 bits (72), Expect = 0.37 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 784 ARARGGXGXXPXXXPPXPPPPPPPXXP 864 A++ P PP PPPPPPP P Sbjct: 266 AKSMAAATPPPLCAPPPPPPPPPPPPP 292 Score = 31.9 bits (69), Expect = 0.86 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXP 205 PPP PP PPPPP P Sbjct: 274 PPPLCAPPPPPPPPPPPP 291 Score = 31.1 bits (67), Expect = 1.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 826 PPXPPPPPPPXXP 864 PP PPPPPPP P Sbjct: 281 PPPPPPPPPPPPP 293 Score = 31.1 bits (67), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXP 943 PPP PPP PP P P P Sbjct: 282 PPPPPPPPPPPPPGAKKPDDP 302 Score = 31.1 bits (67), Expect = 1.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 826 PPXPPPPPPPXXP 864 PP PPPPPPP P Sbjct: 282 PPPPPPPPPPPPP 294 Score = 30.7 bits (66), Expect = 2.0 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 814 PXXXPPXPPPPPPP 855 P PP PPPPPPP Sbjct: 280 PPPPPPPPPPPPPP 293 Score = 30.7 bits (66), Expect = 2.0 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 814 PXXXPPXPPPPPPP 855 P PP PPPPPPP Sbjct: 281 PPPPPPPPPPPPPP 294 Score = 30.7 bits (66), Expect = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPP 934 P PPP PPP PP P P Sbjct: 282 PPPPPPPPPPPPPGAKKPDDP 302 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 137 PLFXXPPPXWXPPXXPPPPP 196 P PPP PP PPPPP Sbjct: 275 PPLCAPPPPPPPPPPPPPPP 294 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPP 934 P PP PPP PP P P PP Sbjct: 276 PLCAPPPPPPPPP--PPPPPP 294 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 33.9 bits (74), Expect = 0.21 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGGA G G G G GG GG GGG Sbjct: 58 GGGATGGGGGATGGGGGATGGHGGATGGG 86 Score = 33.9 bits (74), Expect = 0.21 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGGA G G G G GG GG GGG Sbjct: 93 GGGATGGGGGATGGGGGATGGHGGATGGG 121 Score = 33.5 bits (73), Expect = 0.28 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG GA GG G GG GG GGGG G G G Sbjct: 47 GGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATG 98 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 A GGG G G G GG GG G GGGGG Sbjct: 56 ATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGG 102 Score = 33.1 bits (72), Expect = 0.37 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 A GGG A G GG G G GGG G A GGGGG G Sbjct: 61 ATGGGGGATGGG-GGATGGHGGATGGG---GGATGDGGGATGGGGGATG 105 Score = 33.1 bits (72), Expect = 0.37 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 A GG G GG G G GGG G A GGGGG G Sbjct: 124 ATGGHGGATGGHGGATGGHGGATGGG---GGATGGGGGATGGGGGATG 168 Score = 32.7 bits (71), Expect = 0.49 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GG G GG G G GG GG GGG Sbjct: 44 GGHGGATGGGGGATGGGATGGGGGATGGG 72 Score = 32.3 bits (70), Expect = 0.65 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 A GG A G G G GG GG G GGGGG Sbjct: 42 ATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGG 88 Score = 32.3 bits (70), Expect = 0.65 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG GA GG GG G G A GGGGG G Sbjct: 66 GGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATG 112 Score = 32.3 bits (70), Expect = 0.65 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGG-GXXXGXARXXXXXXGGGGGGGXG 827 A GGG A G GG G G GG G G GG GGG G Sbjct: 117 ATGGGVGAT-GGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGGG 165 Score = 31.9 bits (69), Expect = 0.86 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGG-GXXXGXARXXXXXXGGGGGGGXGXXXRG 812 A GGG A G GG G G GG G G GG GGG G G Sbjct: 103 ATGGGGGAT-GGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGG 156 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGG 883 GGGA G G G G GG GG GG Sbjct: 86 GGGATGDGGGATGGGGGATGGGGGATGG 113 Score = 31.5 bits (68), Expect = 1.1 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 5/57 (8%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGG--GXXXGXARXXXXXXGGGG---GGGXGXXXRG 812 GGG G G G GG GG G G GGGG GGG G G Sbjct: 107 GGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGG 163 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGG 883 GGGA G G G G GG GG GG Sbjct: 107 GGGATGGHGGATGGGVGATGGHGGATGG 134 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGA G G G G GG GG GGG Sbjct: 136 GGATGGHGGATGGGGGATGGGGGATGGG 163 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 216 GXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXG 106 G G GGGGG GG GGG G G G Sbjct: 44 GGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHG 80 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 568 TXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 T G G GG GG G GGGGG G Sbjct: 62 TGGGGGATGGGGGATGGHGGATGGGGGATGDG 93 Score = 30.7 bits (66), Expect = 2.0 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 A GG A G G G GGG G GG GGG G Sbjct: 75 ATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVG 123 Score = 30.7 bits (66), Expect = 2.0 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 A GGG A G GG G G GGG GG GG G G Sbjct: 96 ATGGGGGA-TGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGG 148 Score = 30.3 bits (65), Expect = 2.6 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = -3 Query: 961 GXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGG--GGXGXXXRG 812 G G G G GG GG G GGGGG GG G G Sbjct: 34 GVVVGHGGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGG 85 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GGGGG G GGGG G G Sbjct: 45 GHGGATGGGGGATGGGATGGGGGATGGGGG 74 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGA G G G G GG G GGG G Sbjct: 40 GGATGGHGGATGGGGGATGGGATGGGGGATG 70 Score = 29.5 bits (63), Expect = 4.6 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -3 Query: 568 TXXGXGXXGGXGG--GGGXXXXGXGGGGGPXXXGVXG 464 T G G GG GG GGG G GGG G G Sbjct: 69 TGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATG 105 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 568 TXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 T G G GG GGG G GGG G G Sbjct: 50 TGGGGGATGGGATGGGGGATGGGGGATGGHGGATG 84 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGG 883 GGA G G G G GG GG GG Sbjct: 143 GGATGGGGGATGGGGGATGGGGGATGG 169 Score = 28.7 bits (61), Expect = 8.0 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 A GGG A G GG G G GGG G A GGG G G Sbjct: 82 ATGGGGGAT-GDGGGATGGGGGATGGG---GGATGGHGGATGGGVGATG 126 Score = 28.7 bits (61), Expect = 8.0 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 GGG G G G GG GG G GG GG Sbjct: 93 GGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGG 137 >SB_51094| Best HMM Match : VWA (HMM E-Value=0) Length = 3544 Score = 33.9 bits (74), Expect = 0.21 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 AGG A GG G G G G G GGGGGG Sbjct: 3271 AGGASAYMMSASGGGAAGSSGSIGAGAAGGAGAVAAVAVSGGGGGG 3316 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -1 Query: 936 GGGXGXGXXGGXGGGXGGGXRG 871 GGG G G GG GGG GG RG Sbjct: 515 GGGGGGGGGGGGGGGRGGRGRG 536 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 951 PXXGXGGGXGXGXXGGXGGGXGGG 880 P GGG G G GG GGG GG Sbjct: 509 PRRRRGGGGGGGGGGGGGGGGRGG 532 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 924 GXGXXGGXGGGXGGGXRG 871 G G GG GGG GGG RG Sbjct: 514 GGGGGGGGGGGGGGGGRG 531 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 535 GGGGGXXXXGXGGGGGPXXXG 473 GGGGG G GGGGG G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRG 534 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 33.9 bits (74), Expect = 0.21 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +3 Query: 465 PXTPXXXGPPPPPX-PXXXXPPPPPXPPXXPXP 560 P TP P P P PPPPP PP P P Sbjct: 340 PTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 32.7 bits (71), Expect = 0.49 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P PP PPPPPPP P Sbjct: 355 PQLGPPPPPPPPPPTPP 371 Score = 32.3 bits (70), Expect = 0.65 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPP 935 P P P PP P + P PPP PP P PP Sbjct: 335 PSTTTPTTPQPPTPTTP---KTHPQLGPPPPPPPPPPTPPP 372 Score = 31.1 bits (67), Expect = 1.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPP 937 P+ P PP PP P P PPP Sbjct: 351 PKTHPQLGPPPPPPPPPPTPPP 372 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +3 Query: 471 TPXXXGPPPPPXPXXXXP--PPPPXPPXXPXP 560 TP PP P P PPPP PP P P Sbjct: 339 TPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTP 370 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P+ P P P P P PPP P PPP Sbjct: 343 PQPPTPTTPKTHPQLGPPPPPPPPP--PTPPP 372 Score = 28.7 bits (61), Expect = 8.0 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 1/43 (2%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPP-PXWXPPXXPPPPPXXPXXXPXP 223 PP P P P P P PPPPP P P P Sbjct: 330 PPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P P P P PPP P PP Sbjct: 340 PTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPP 371 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 33.5 bits (73), Expect = 0.28 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGGPXXXG 473 GG GGGGG G GGGGG G Sbjct: 487 GGFGGGGGASGGGGGGGGGGGFSG 510 Score = 31.1 bits (67), Expect = 1.5 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = -2 Query: 965 GGXXGPPXGXGG---VXGGXXXXXXXXXXXXXXXXAXGXXGGGGGGGXGGXXXG 813 GG GP G GG + GG G GGGGGGG GG G Sbjct: 458 GGAYGP-GGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGGGGGGGGGGFSG 510 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 228 PXGXGXXXGXXGGGGGXXGGXXXGGG 151 P G G G GGGGG GG GG Sbjct: 486 PGGFGGGGGASGGGGGGGGGGGFSGG 511 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGGXRG 871 G GG G G GG GGG GG G Sbjct: 491 GGGGASGGGGGGGGGGGFSGGACG 514 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGGXRG 871 G GG G GG GGG GGG G Sbjct: 487 GGFGGGGGASGGGGGGGGGGGFSG 510 Score = 29.5 bits (63), Expect = 4.6 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = -2 Query: 965 GGXXGPPXGXGGVXGGXXXXXXXXXXXXXXXXAXGXXGGGGGGGXGGXXXG 813 GG G GGV G + G GGGGGGG G G Sbjct: 464 GGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGGGGGGGGGGFSGGACG 514 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGGG G G GG G GG Sbjct: 488 GFGGGGGASGGGGGGGGGGGFSGGACGDFTSGLSPTCGGGG 528 Score = 28.7 bits (61), Expect = 8.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G GGG G G GG G G Sbjct: 491 GGGGASGGGGGGGGGGGFSGGACGDFTSG 519 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 33.5 bits (73), Expect = 0.28 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPP--PPPXPXXXXPPPPPXPP 545 PP G G P GPP PP PPPP PP Sbjct: 690 PPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPP 727 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 4/23 (17%) Frame = +3 Query: 489 PPPPPXPXXXX----PPPPPXPP 545 PPPPP P PPPPP PP Sbjct: 755 PPPPPPPAVPGEGARPPPPPPPP 777 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPP 911 PPPPPPP P PPP PP Sbjct: 755 PPPPPPPAVPGEGARPP---PPPPPP 777 Score = 30.7 bits (66), Expect = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXP 943 PPP PP P P PPP P Sbjct: 756 PPPPPPAVPGEGARPPPPPPP 776 Score = 29.9 bits (64), Expect = 3.5 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P P PPPPP PP P P P A PPP Sbjct: 680 PSSAPPPPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGP--PPPAPPPPP 729 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXP 943 PPP PPP P PPP P Sbjct: 755 PPPPPPPAVPGEGARPPPPPP 775 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 30.7 bits (66), Expect = 2.0 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 799 GXGXXPXXXPPXPPPPPPP 855 G G PP PPPPPPP Sbjct: 786 GEGVGGITPPPPPPPPPPP 804 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXG---XAPP 964 PP PPP PP P P P G APP Sbjct: 794 PPPPPPPPPPPPEDLIIPLPRRGSDLFAPP 823 Score = 29.1 bits (62), Expect = 6.1 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 826 PPXPPPPPPP 855 PP PPPPPPP Sbjct: 796 PPPPPPPPPP 805 Score = 28.7 bits (61), Expect = 8.0 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 798 GXGXXPLXXXPXPPPPPPP 854 G G + P PPPPPPP Sbjct: 786 GEGVGGITPPPPPPPPPPP 804 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PPP PP P P PP Sbjct: 795 PPPPPPPPPPPEDLIIPLPRRGSDLFAPP 823 Score = 27.9 bits (59), Expect(2) = 0.28 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -1 Query: 441 GGXXPPPPPPP 409 GG PPPPPPP Sbjct: 790 GGITPPPPPPP 800 Score = 24.2 bits (50), Expect(2) = 0.28 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 429 PPPPPPPXXXL 397 PPPPPPP L Sbjct: 798 PPPPPPPPEDL 808 >SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2462 Score = 25.8 bits (54), Expect(2) = 0.35 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = +1 Query: 772 PGXXARARGGXGXXPXXXPPXPPPPP 849 PG + G PP PPPPP Sbjct: 2303 PGSNSTRSPSTGSHSPSVPPPPPPPP 2328 Score = 25.8 bits (54), Expect(2) = 0.35 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 835 PPPPPPPXXP 864 PPPPPPP P Sbjct: 2322 PPPPPPPEQP 2331 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 PPP P P P P PPP P G P Sbjct: 686 PPPLPTPIASSEPLPLPPPPPPTGIDIP 713 Score = 33.1 bits (72), Expect = 0.37 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPP-RAPRXAXXPP 965 P PPPPPP P P PP PP +P + PP Sbjct: 700 PLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPPSSKHPP 746 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXX-XXPPPPPXPPXXPXPXXVRFXXXGGGXRP 602 PP G P +P P PP P PPP PP P V RP Sbjct: 704 PPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPPSSKHPPTVSPSSSSAPPRP 759 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPP + P PPP PP + PPP Sbjct: 682 PLTPPPPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPPP 726 Score = 28.7 bits (61), Expect = 8.0 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPP P P PPP P P PPP Sbjct: 682 PLTPPPPLPTPIASSEPLP-LPPPPPPTGIDIPHSPSKDDLPLPPPP 727 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 936 GGGXGXGXXGGXGGGXGGG 880 GGG G G GG GGG GGG Sbjct: 320 GGGGGGGGGGGGGGGGGGG 338 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGG 488 GG GGGGG G GGGGG Sbjct: 320 GGGGGGGGGGGGGGGGGGG 338 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 936 GGGXGXGXXGGXGGGXGGG 880 GGG G G GG GGG GGG Sbjct: 321 GGGGGGGGGGGGGGGGGGG 339 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGG 488 GG GGGGG G GGGGG Sbjct: 321 GGGGGGGGGGGGGGGGGGG 339 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGG 883 G GGG G G GG GGG GG Sbjct: 320 GGGGGGGGGGGGGGGGGGGG 339 Score = 29.9 bits (64), Expect = 3.5 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 204 GXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 G GGGGG GG GGG G G G Sbjct: 322 GGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNG 356 Score = 28.7 bits (61), Expect = 8.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGGXRG 871 G GGG G G GG GGG G Sbjct: 323 GGGGGGGGGGGGGGGGGDXXXXNG 346 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 33.1 bits (72), Expect = 0.37 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXP------PXXPXPXXVR 572 P TP PPPPP PPPP P P P P V+ Sbjct: 781 PTTPPPEYPPPPPGLARPNPPPPNPPLQVTSIPGEPAPPFVK 822 Score = 33.1 bits (72), Expect = 0.37 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPP 937 P PPP PP PP P PPP Sbjct: 781 PTTPPPEYPPPPPGLARPNPPP 802 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 33.1 bits (72), Expect = 0.37 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 PPP PPP PP P P P P PP Sbjct: 430 PPPTPPPTPP--PTPPPTTLPPTTQPPP 455 Score = 33.1 bits (72), Expect = 0.37 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 3/27 (11%) Frame = +2 Query: 872 PRXPPPXPPPXPP---XXPXPXPPPXP 943 P PPP PPP PP P PPP P Sbjct: 431 PPTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 32.7 bits (71), Expect = 0.49 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 893 PPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PP P P PPP PP Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPP 454 Score = 29.5 bits (63), Expect = 4.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 793 RGGXGXXPXXXPPXPPPPPPP 855 R G P PP PPP PPP Sbjct: 424 RCGTATPPPTPPPTPPPTPPP 444 Score = 28.7 bits (61), Expect = 8.0 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXP 908 P PPP PP P PPP P Sbjct: 431 PPTPPPTPPPTPPPTTLPPTTQPPPQP 457 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 33.1 bits (72), Expect = 0.37 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 8/48 (16%) Frame = +3 Query: 453 GXGXPXTPXXXGPPP------PPXPXXXXPPPP--PXPPXXPXPXXVR 572 G G P P PPP PP P PPP P PP P P R Sbjct: 448 GGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYR 495 Score = 33.1 bits (72), Expect = 0.37 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +3 Query: 420 GGGGXXPPXXXGXGXPXTPXXXGPPP--PPXPXXXXPPPPPXPPXXP 554 GG PP G P P PPP PP P PPPP P P Sbjct: 463 GGMRGMPPPPMGMYPP--PRGFPPPPFGPPPPFYRGPPPPRGMPPPP 507 Score = 32.3 bits (70), Expect = 0.65 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 6/56 (10%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPP--PXPXXXXPPP----PPXPPXXPXPXXVRFXXXG 587 PP G P P PPP P P PPP PP P P P R G Sbjct: 460 PPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPPRQRMPSQG 515 Score = 31.9 bits (69), Expect = 0.86 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXPXG 229 PP P P+ PPP PP PPP P P G Sbjct: 459 PPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRG 502 Score = 31.5 bits (68), Expect = 1.1 Identities = 30/104 (28%), Positives = 33/104 (31%), Gaps = 9/104 (8%) Frame = +3 Query: 678 PGPXGXPXXXXPXG--GGGGPXXXXXXXXXXXXPRXXRPXAG--GXGXXPLXXXPXP--- 836 P G P P G GGGP P P G G P+ P P Sbjct: 431 PQHTGPPQPRPPHGMPQGGGPPQLP--------PNLPPPPGGMRGMPPPPMGMYPPPRGF 482 Query: 837 PPPP--PPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXP 962 PPPP PP P PPP P PP+ + P Sbjct: 483 PPPPFGPPPPFYRGPPPPRGMPPPPRQRMPSQGPPQVHYPSQDP 526 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPX--PPPXPXXGXAPPPR 970 PPP P PP P P P P G PPPR Sbjct: 477 PPPRGFPPPPFGPPPPFYRGPPPPRGMPPPPR 508 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 PP PP PP P P G PPPR Sbjct: 451 PPQLPPNLPPPPGGMRGMPPPPMGMYPPPR 480 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +2 Query: 881 PPPXP--PPXPPXXPXPXPPPXPXXGXAPPPR 970 PPP PP P P PP P PPPR Sbjct: 470 PPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPR 501 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 32.7 bits (71), Expect = 0.49 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGG-GXXXGXARXXXXXXGGGGGGGXGXXXRG 812 A+GG + GA GG G GG G G A GG GG G G Sbjct: 779 ASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGG 833 Score = 29.9 bits (64), Expect = 3.5 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGG-GXXXGXARXXXXXXGGGGGGGXGXXXRG 812 A+ G + GA GG G GG G G A GG GG G G Sbjct: 768 ASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGG 822 Score = 29.5 bits (63), Expect = 4.6 Identities = 17/51 (33%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = -3 Query: 973 AAGGGXXAXRGA--RGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 ++GG A GA G G GG GG G GG GG G Sbjct: 761 SSGGDGHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGG 811 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/46 (30%), Positives = 16/46 (34%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGG 836 ++ GG G G G GG GG G GG GG Sbjct: 796 SSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADGG 841 Score = 28.7 bits (61), Expect = 8.0 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGG-GXXXGXARXXXXXXGGGGGGG 833 A GG + GA GG G GG G G A GG GG Sbjct: 790 ANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGG 837 Score = 28.7 bits (61), Expect = 8.0 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 AG G GG G GG GG G + GG GG G Sbjct: 794 AGSSSGGASGGAGGSSGGASGGAGGSSG-GASGGAGSSSGGASGGADG 840 >SB_55337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1853 Score = 32.7 bits (71), Expect = 0.49 Identities = 22/90 (24%), Positives = 25/90 (27%) Frame = +3 Query: 459 GXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXX 638 G P P PP PP P P + +P Sbjct: 626 GFPGPPGDSDYGPPGDKGLKGNTGPPGDEGVPGPIGPKGDKCEACPKPPPGPAGEPGSPG 685 Query: 639 XXRAXGAXGAXGXPGPXGXPXXXXPXGGGG 728 GA G+ G PGP G P P G G Sbjct: 686 LPGEDGAIGSRGLPGPSGEPGKPGPAGRAG 715 >SB_46720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1705 Score = 32.7 bits (71), Expect = 0.49 Identities = 30/107 (28%), Positives = 30/107 (28%) Frame = +3 Query: 414 GGGGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGG 593 G G P G P P G PP P P PP P P P F G Sbjct: 894 GPPGLAGSPGPRGPNGEPGDPGMDGDKGPPGPVDAGPRGPPGEPGPPGP----FGAAGLD 949 Query: 594 XRPXXXXXXTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGP 734 P R GA G G PG G G G P Sbjct: 950 GMPGKPGAKGESGQPGMR--GADGLSGPPGFDGQAGETGAIGFKGEP 994 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 32.7 bits (71), Expect = 0.49 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 423 GGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 G G P TP P PP P P PP PP P Sbjct: 210 GNGVVPTQAPRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPP 253 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 P P PP PP P P PP P PP+ Sbjct: 227 PPTKAPTDPPVPPTNP-PVPPTNPPAPPTNPPK 258 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 32.7 bits (71), Expect = 0.49 Identities = 16/31 (51%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -1 Query: 966 GGG--AXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG + G GGG G G GG GG GGG Sbjct: 167 GGGMMSMAGGGMGGGMGGGMGGGMEGGMGGG 197 Score = 32.7 bits (71), Expect = 0.49 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 3/51 (5%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGX---ARXXXXXXGGGGGGGXG 827 AGGG G GG G GG GGG G GGG GGG G Sbjct: 174 AGGGMGGGMG--GGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMG 222 Score = 32.3 bits (70), Expect = 0.65 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXAR--XXXXXXGGGGGGGXGXXXRG 812 GGG G GG G GG GG G + GGG GGG G G Sbjct: 135 GGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGG 188 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G G GG GGG G +G Sbjct: 175 GGGMG--GGMGGGMGGGMEGGMGGGMMEGMQG 204 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G G G GG GGG GGG G Sbjct: 162 GGGSMGGGMMSMAGGGMGGGMGGGMGGGMEG 192 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 32.7 bits (71), Expect = 0.49 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = +3 Query: 414 GGGGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPP--PPP--XPPXXPXP 560 G G PP P P G PP P PP PPP PP P P Sbjct: 2144 GSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPP 2196 Score = 32.3 bits (70), Expect = 0.65 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 PPPP P P PP PP P PP P PP Sbjct: 2150 PPPPMGPARHSPSGPSPLGAPPSVPP--PMGAPPSGPPPMGAPP 2191 Score = 29.9 bits (64), Expect = 3.5 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 5/61 (8%) Frame = +3 Query: 804 GXXPLXXXPXPPPP--PPPXXXXXXRAXPXXXPPPXPPXX---PXXXPPRAPRXAXXPPP 968 G PL P PPP PP A P PP P P PP P + P Sbjct: 2163 GPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPPSGSHSP 2222 Query: 969 A 971 A Sbjct: 2223 A 2223 >SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) Length = 370 Score = 32.7 bits (71), Expect = 0.49 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 G G G G G G G G GGG GGG G Sbjct: 238 GDGDGDGDGDGDGDGDGDGDGDGGGGGGGGDG 269 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 32.7 bits (71), Expect = 0.49 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 574 KRTXXGXGXXGGXGGGGGXXXXGXGGGGG 488 +R G G GG GGGGG G GG G Sbjct: 999 RRRRGGGGGGGGGGGGGGGRRGGRGGARG 1027 Score = 31.9 bits (69), Expect = 0.86 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 951 PXXGXGGGXGXGXXGGXGGGXGGGXRG 871 P GGG G G GG GGG GG G Sbjct: 998 PRRRRGGGGGGGGGGGGGGGRRGGRGG 1024 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXG 886 RGGG G GGG G G GG GG G Sbjct: 1002 RGGGGG--GGGGGGGGGGRRGGRGGARG 1027 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 32.7 bits (71), Expect = 0.49 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 G G + G RGG G GG GGG G GGG GGG Sbjct: 750 GYGNRSGGGYRGG---GGYGGGGGGYRGGGGYGGGHRGGGGYGGG 791 Score = 32.7 bits (71), Expect = 0.49 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -3 Query: 571 RTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 R+ G GG GGGGG G G GGG G G Sbjct: 754 RSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYG 789 Score = 30.7 bits (66), Expect = 2.0 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG R +GG GG GG G GG GGG G G Sbjct: 738 GGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYG 789 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG G GGG G GGGG G GG Sbjct: 769 GGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGG 809 Score = 30.3 bits (65), Expect = 2.6 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 +GGG RG GG G G GGG G R GGG GG RG Sbjct: 755 SGGGY---RGG-GGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRG 803 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G G GGG GG GGG G + GG Sbjct: 768 GGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGG 809 Score = 28.7 bits (61), Expect = 8.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G G GGGG GG GGG G Sbjct: 764 GYGGGGGGYRGGGGYGGGHRGGGGYGGGG 792 Score = 28.7 bits (61), Expect = 8.0 Identities = 18/53 (33%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGX-ARXXXXXXGGGGGGGXGXXXRG 812 GGG G GG G G GGG G + GG G G G +G Sbjct: 768 GGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGGYGQG 820 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 32.7 bits (71), Expect = 0.49 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PPPP P PP P PP P P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAP 118 Score = 32.3 bits (70), Expect = 0.65 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPP--PXPXXGXAPPP 967 PPP PP P P P PP P P P P Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGPDTPAP 126 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXG 952 P PP PPP P P P P P G Sbjct: 104 PTMPPTPPPPQTPAPPGPDTPAPPAPG 130 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P TP PP P P PP P P P P Sbjct: 98 PATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P PPPP P PP P PP P Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGPDTP 124 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 P PPP P PP P PP G P R Sbjct: 107 PPTPPPPQTPAPPGPDTPAPPAPGGCGAKPHTR 139 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P PP PP P P P P PP Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGPDTPAPP 127 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP P P P PP P P P Sbjct: 98 PATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 28.7 bits (61), Expect = 8.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPP 937 PPP P PP P PPP Sbjct: 95 PPPPATPPPPTMPPTPPPP 113 >SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) Length = 968 Score = 32.3 bits (70), Expect = 0.65 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXG 952 P+ PPP P PP P P P P G Sbjct: 301 PQTPPPPQTPPPPQTPAPPQTPAPPSG 327 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 P PP P PP P PP P P Sbjct: 301 PQTPPPPQTPPPPQTPAPPQTPAP 324 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +3 Query: 459 GXPXTPXXXGPPP--PPXPXXXXPPPPPXPP 545 G P TP PPP PP P PP P PP Sbjct: 299 GTPQTP----PPPQTPPPPQTPAPPQTPAPP 325 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 32.3 bits (70), Expect = 0.65 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -3 Query: 544 GGXGG-GGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 GG GG GGG G GG GGP G G GG Sbjct: 421 GGRGGPGGGYEGRGRGGRGGPRGGGPRGYDGGYGQGG 457 Score = 29.5 bits (63), Expect = 4.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGGXRG 871 G GGG GG GG GGG RG Sbjct: 425 GPGGGYEGRGRGGRGGPRGGGPRG 448 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 32.3 bits (70), Expect = 0.65 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPX-PPPXPXXGXAPPPR 970 PR P P PP P PPP P PPPR Sbjct: 206 PRSGPLPPTAAPPPPPTTGAPPPTPVTNKPPPPR 239 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 PP G P PPPP P PPP P Sbjct: 217 PPPPPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAP 252 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 4/33 (12%) Frame = +2 Query: 881 PPPXP----PPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P PP P P PPP P APPP Sbjct: 217 PPPPPTTGAPPPTPVTNKP-PPPRPATTQAPPP 248 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = +3 Query: 828 PXPP---PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRA 941 P PP PPPPP PPP P PP A Sbjct: 210 PLPPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPPTA 250 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P G PPP PPP P P P Sbjct: 217 PPPPPTTGAPPPTPVTNKPPPPRPATTQAPPP 248 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PP PP P PP PPP Sbjct: 181 PPPIPPIDPPRTQPPPIPPIDPPRTQPPP 209 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PP PP P PP PPP Sbjct: 194 PPPIPPIDPPRTQPPPIPPIDPPRTQPPP 222 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P P PP P P P PP P PPR P P Sbjct: 176 PPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIFPQP 227 Score = 30.3 bits (65), Expect = 2.6 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPP-XXPXXXPPRAPRXAXXPP 965 P+ PPP PP R P PP PP P PP P PP Sbjct: 173 PIDPPRTQPPPIPP--IDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPP 222 Score = 29.9 bits (64), Expect = 3.5 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Frame = +3 Query: 828 PXPPP---PPPPXXXXXXRAXPXXXPPPXPP-XXPXXXPPRAPRXAXXPP 965 P PP PPP R P PP PP P PP P PP Sbjct: 160 PIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPP 209 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P P PPP P PPP PP P Sbjct: 173 PIDPPRTQPPPIPPIDPPRTQPPPIPPIDP 202 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P P PPP P PPP PP P Sbjct: 186 PIDPPRTQPPPIPPIDPPRTQPPPIPPIDP 215 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGG 880 G GGG G G GG GGG G G Sbjct: 84 GDGGGGGDGGGGGDGGGDGDG 104 >SB_58050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -3 Query: 733 GPPPPPXGXXXXGXPXGPGXPXAPXAPXA 647 GPP PP G P PG P P +P A Sbjct: 103 GPPGPPGHVGEDGAPGAPGAPGPPGSPGA 131 Score = 30.3 bits (65), Expect = 2.6 Identities = 24/90 (26%), Positives = 24/90 (26%) Frame = +3 Query: 459 GXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXX 638 G P P GPP P PP PP G Sbjct: 82 GPPGPPGAPGPPGEPGQVGMAGPP--GPPGHVGEDGAPGAPGAPGPPGSPGAPGLPGEKG 139 Query: 639 XXRAXGAXGAXGXPGPXGXPXXXXPXGGGG 728 GA GA G PG G P P G G Sbjct: 140 DPGLQGAPGAAGLPGAPGLPGPQGPMGPPG 169 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 32.3 bits (70), Expect = 0.65 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 471 TPXXXGPPPPPXPXXXXPPPPPXPP 545 +P PPPP PPPPP PP Sbjct: 193 SPEPTRPPPPLDDLDDLPPPPPPPP 217 Score = 29.5 bits (63), Expect = 4.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXP 908 PPPPPPP PPP P Sbjct: 210 PPPPPPPPEDDSIHNHEDLPPPPPP 234 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPP 911 PL PPPPPP PPP PP Sbjct: 202 PLDDLDDLPPPPPPPPEDDSIHNHEDLPPPPPP 234 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 31.9 bits (69), Expect = 0.86 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXP 554 PPPPP P PPPP PP P Sbjct: 142 PPPPPPPPS--PPPPCHPPALP 161 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 887 PXPPPXPPXXPXPXPPP 937 P PPP PP P P PP Sbjct: 142 PPPPPPPPSPPPPCHPP 158 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXP 943 PPP PPP PP P PP P Sbjct: 143 PPPPPPPSPP--PPCHPPALP 161 >SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) Length = 519 Score = 31.9 bits (69), Expect = 0.86 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPP----XPXXGXAPPPR 970 P P P PP P P P PPP P AP PR Sbjct: 38 PHGPRPLPPLREPPTPAPTPPPALPSTPTLPLAPRPR 74 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 31.9 bits (69), Expect = 0.86 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +3 Query: 786 PXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 P G G P+ P P PPP P PP P PP P Sbjct: 228 PPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMP 280 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXPXG 229 PP P P+ PPP PP PPP P P G Sbjct: 224 PPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMG 267 Score = 29.9 bits (64), Expect = 3.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXG 952 P PPP PP P PPP P G Sbjct: 277 PGMPPPMPPGGMPPNMEQPPPPPPSSG 303 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPX--PXXGXAPPP 967 PPP PP P P P PP P G PPP Sbjct: 248 PPPGMPP-PGMMPPPGFPPMGMPGMGGMPPP 277 >SB_53480| Best HMM Match : Sigma70_r1_1 (HMM E-Value=5.7) Length = 402 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 G G G G G G G G GGG GGG Sbjct: 67 GDGDGDGDGDGDGDGDGDGDGDGGGGGGG 95 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 943 GARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 G G G G G G G GGGGGGG G Sbjct: 59 GDDGDDGDGDGDGDGDGDGDGDGDGDGDGDGGGGGGGDG 97 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXP-PPXPXXGXAPPPR 970 P P P PP PP P P P PP P G P PR Sbjct: 1355 PSTPRPRPPT-PPRPPTPRPRPPTPRPG-PPTPR 1386 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +2 Query: 467 PHPXXXGPXPPPXPRXXXPXP-PPXPXPXP 553 P P P PP PR P P PP P P P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGP 1382 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P TP PP PP P P PP P P P Sbjct: 1355 PSTPRPR-PPTPPRPPTPRPRPPTPRPGPPTP 1385 >SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) Length = 483 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 875 RXPPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 + P P P P P P PPP P PP Sbjct: 159 KKPTTKPTPAPHSSPSPTPPPPPIIPPCPP 188 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXA 953 P PPPP PP R PPP PP PR PR A Sbjct: 136 PTPPPPTPPQSTPKPRRV-LPTPPPKPP------TPRPPRRA 170 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 P PPP PP P P P P PPR Sbjct: 136 PTPPPPTPPQSTPKPRRVLPTPPPKPPTPRPPR 168 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P P P P P PPP PP P Sbjct: 136 PTPPPPTPPQSTPKPRRVLPTPPPKPPTPRPP 167 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 P PPP PP R P PPP PP +P PAA Sbjct: 254 PIPPPTKPPPRVASRRPPP-PLPPPDSSEAQAQQPPLSPPVGKPVVPAA 301 >SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1929 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXP 943 PP PPP P P PPP P Sbjct: 1166 PPQPPPVPSVQAPPAPPPAP 1185 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Frame = +3 Query: 489 PPPPPXPXXXXPP-PPPXPP 545 P PPP P PP PPP PP Sbjct: 1167 PQPPPVPSVQAPPAPPPAPP 1186 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 4/36 (11%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXP----XPPPXPXXGXAPPP 967 P PPP P PP P P P P P PPP Sbjct: 115 PTGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPP 150 >SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 31.1 bits (67), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXP 943 PP PP PP P P P P P Sbjct: 29 PPEAPPLPPFAPLPPPVPPP 48 >SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 RXPPPXPPPXPPXXPXPXPPPXPXXGXAP 961 R PP PP PP P PPP P Sbjct: 196 RPPPSGAPPPPPIGAPPPPPPDDDVSMTP 224 Score = 29.9 bits (64), Expect = 3.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPP 536 P G PPPP P PPPPP Sbjct: 197 PPPSGAPPPP-PIGAPPPPPP 216 >SB_5034| Best HMM Match : Extensin_2 (HMM E-Value=0.0055) Length = 695 Score = 31.1 bits (67), Expect = 1.5 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P PPPPP RA PP PP PP P+ PP Sbjct: 439 PLPPPPPQQAARINYRA--SYGAPPLPPKR-GGGPPLPPKRGGGPP 481 Score = 29.9 bits (64), Expect = 3.5 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPPP RA PP PP P R A P P Sbjct: 298 PLPPPPPQQAARIDYRA--SYGAPPLPPKRGGGPPLPPKRVANIPSP 342 >SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 31.1 bits (67), Expect = 1.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 486 GPPPPPXPXXXXPPPPPXP 542 GP P P P PPPPP P Sbjct: 168 GPNPSPPPSGAPPPPPPPP 186 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 796 GGXGXXPXXXPPXPPPPPPP 855 GG G P P PPPPPP Sbjct: 165 GGEGPNPSPPPSGAPPPPPP 184 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -1 Query: 474 GXGXXRAPXXXGGXXPPPPPPPXXXLXFV 388 G G +P G PPPPPPP L +V Sbjct: 166 GEGPNPSPPPSGAP-PPPPPPPLFLLFYV 193 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 31.1 bits (67), Expect = 1.5 Identities = 18/56 (32%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGG--GGGXGXXXRG 812 + GG G GG G GG G ++ GGGG GGG G G Sbjct: 101 STSGGTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAG 156 Score = 29.9 bits (64), Expect = 3.5 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 AGGG G GG G G GG G + GGG G G G Sbjct: 135 AGGGAAGGGGQEGG---GQGGAQAGGSTSGSSSGGATSGGGGVSGSSGTSIAG 184 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +1 Query: 826 PPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPP 966 PP PPPP PP P P + P P P PP Sbjct: 1455 PPPPPPPAPP-CPPPCHVQSTQHTVDHSWAPSPVSAPLPMAAPPSPP 1500 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAP 961 P P PP P P P PPP AP Sbjct: 522 PAPQPPSPPAPPPKPAPPPRSPPAAAP 548 Score = 26.2 bits (55), Expect(2) = 5.1 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 PPPPPPP + P P P P+AP Sbjct: 457 PPPPPPPPPQMYQQPLMMPQAPMMMPQAPMMM-PQAP 492 Score = 21.4 bits (43), Expect(2) = 5.1 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +3 Query: 813 PLXXXPXPPPPP 848 P P PPPPP Sbjct: 454 PQGPPPPPPPPP 465 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXP 932 PPPPPP A PPP P P P Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPPLPAGPPPDEP 543 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PP PPP P PPP P PPP Sbjct: 512 PPPPPASPPPPLPAEEDNSPPPLP---AGPPP 540 Score = 28.7 bits (61), Expect = 8.0 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P PPPP P PPP P P Sbjct: 513 PPPPASPPPPLPAEEDNSPPPLPAGPP 539 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 31.1 bits (67), Expect = 1.5 Identities = 30/107 (28%), Positives = 30/107 (28%), Gaps = 5/107 (4%) Frame = +3 Query: 429 GXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPP----PPXPPXXPXPXXVRFXXXGGGX 596 G PP G P P P P PPP P P P V GGG Sbjct: 160 GTQPPGQGGYPGYNQPPPGHYPAPGQPGGYYPPPGGYQQPPPGGYAPPPYV--PQEGGGI 217 Query: 597 RPXXXXXXT-XXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGP 734 P A G G P G P P G GGP Sbjct: 218 PPQNHPLTNYPAPPPQGYAPPPGGYPGAPPAGGYPGAPPPGGYPGGP 264 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.1 bits (67), Expect = 1.5 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +3 Query: 429 GXXPPXXX--GXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 G PP G P TP G PPP P PPP P P P Sbjct: 51 GDPPPNIPIPGNPPPNTPIP-GDPPPNTPIPGDPPPNTPIPGNPPP 95 Score = 31.1 bits (67), Expect = 1.5 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +3 Query: 429 GXXPPXXX--GXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 G PP G P TP G PPP P PPP P P P Sbjct: 61 GNPPPNTPIPGDPPPNTPIP-GDPPPNTPIPGNPPPNTPIPGDPPP 105 Score = 30.7 bits (66), Expect = 2.0 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +3 Query: 429 GXXPPXXX--GXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 G PP G P TP G PPP P PPP P P P Sbjct: 71 GDPPPNTPIPGDPPPNTPIP-GNPPPNTPIPGDPPPNTPIPGDPPP 115 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 453 GXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 G P TP G PPP P PPP P P P Sbjct: 41 GDRPPNTPIP-GDPPPNIPIPGNPPPNTPIPGDPPP 75 Score = 29.9 bits (64), Expect = 3.5 Identities = 19/66 (28%), Positives = 19/66 (28%), Gaps = 1/66 (1%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXX-PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPR 947 PR P G P P PPP P P PP P PP P Sbjct: 30 PRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPI 89 Query: 948 XAXXPP 965 PP Sbjct: 90 PGNPPP 95 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P P PPP P P PP P PP P PP Sbjct: 55 PNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPP 105 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P P PPP P P PP P PP P PP Sbjct: 65 PNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPP 115 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 31.1 bits (67), Expect = 1.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 826 PPXPPPPPPPXXP 864 PP PPPPPPP P Sbjct: 211 PPPPPPPPPPPPP 223 Score = 31.1 bits (67), Expect = 1.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 826 PPXPPPPPPPXXP 864 PP PPPPPPP P Sbjct: 212 PPPPPPPPPPPPP 224 Score = 30.7 bits (66), Expect = 2.0 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 814 PXXXPPXPPPPPPP 855 P PP PPPPPPP Sbjct: 211 PPPPPPPPPPPPPP 224 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXP 542 PPPPP P PPPPP P Sbjct: 211 PPPPPPP----PPPPPPP 224 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 799 GXGXXPXXXPPXPPPPPP 852 G P PP PPPPPP Sbjct: 207 GDAKPPPPPPPPPPPPPP 224 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 522 PPPPPXPPXXPXPXXVR 572 PPPPP PP P P R Sbjct: 212 PPPPPPPPPPPPPMLAR 228 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 31.1 bits (67), Expect = 1.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 826 PPXPPPPPPPXXP 864 PP PPPPPPP P Sbjct: 378 PPPPPPPPPPPAP 390 Score = 30.7 bits (66), Expect = 2.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXP 931 P PPP PPP PP P P Sbjct: 375 PFAPPPPPPPPPPPAPGSTP 394 Score = 30.7 bits (66), Expect = 2.0 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 814 PXXXPPXPPPPPPP 855 P PP PPPPPPP Sbjct: 375 PFAPPPPPPPPPPP 388 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +3 Query: 465 PXTPXXXGPP---PPPXPXXXXPPPPPXPPXXPXPXXVR 572 P TP P P P PPPPP PP P V+ Sbjct: 358 PSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAPGSTPVK 396 >SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G G GG G GGG G GGG GP G Sbjct: 355 GRGASGGRGRGGG--RGGFGGGAGPQGEG 381 >SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GGGG GGGGG G+ G GG Sbjct: 216 GWENGGFGGGGSAMAHPGGGGGYSGGGIEGSETTGSAGG 254 >SB_35308| Best HMM Match : VWA (HMM E-Value=1.1e-20) Length = 381 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXG 886 GG G GG G G GG GGG G Sbjct: 291 GGISASGGAGGSGGAGGVGGGGGGTG 316 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGG 883 G A GG G G GG GGG GG Sbjct: 288 GSAGGISASGGAGGSGGAGGVGGGGGG 314 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGG 491 G GG GG GG G GGGG Sbjct: 292 GISASGGAGGSGGAGGVGGGGGG 314 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 943 GARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 G GG G GG GGG GG GGG G Sbjct: 343 GYNGGPSPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSG 381 Score = 30.7 bits (66), Expect = 2.0 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -3 Query: 553 GXXGGXGGGGG-XXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G GG GGGGG G GGGG G G GG Sbjct: 351 GAVGGFGGGGGGSEDNGASGGGGGYSGGGSGITWNQAGGG 390 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 RG G G GGG G G GG GGG G Sbjct: 205 RGRGGGGRGGYGGGGGYGGYGGYDQYSGGGYGG 237 Score = 30.3 bits (65), Expect = 2.6 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 231 PPXGXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 P G G G GGG GG GGG G G G GG Sbjct: 194 PADGGRGGYGGRGRGGGGRGGYGGGGGYGGYGGYDQYS-GGGYGG 237 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG G GGG G GGGGG Sbjct: 198 GRGGYGGRGRGGG-GRGGYGGGGG 220 Score = 28.7 bits (61), Expect = 8.0 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGG 836 G G RG RGG G GG GGG G GGG GG Sbjct: 198 GRGGYGGRG-RGG---GGRGGYGGGGGYGGYGGYDQYSGGGYGG 237 >SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 840 PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 PP P RA P P PP P PP A P AA Sbjct: 115 PPAPTSVPSGPRAPPGGPGAPPPPPPPAVVPPSAVTTDGKPATAA 159 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 493 GGPXXXGVXGXPXPXXXGGXXPPPPPPP 410 G P V P G PPPPPPP Sbjct: 114 GPPAPTSVPSGPRAPPGGPGAPPPPPPP 141 >SB_16908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 355 Score = 30.7 bits (66), Expect = 2.0 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 A GGG A G GG GGG G GGG G G Sbjct: 157 ATGGGAVAGVGTADDGANTDGGGAGGGAVTGVGTPDDGANTDGGGAGGG 205 >SB_15415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1390 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPP 902 P+ P PPPPPP RA P PPP Sbjct: 1043 PIMEEPFPPPPPPYQTGSPIRAFP---PPP 1069 >SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGGA GGG GG GGG GG Sbjct: 66 GGGAGGDDDDGGGISGCGDGGGGGGGAGG 94 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -3 Query: 931 GXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 G G GG GG G GGGGGG G G Sbjct: 60 GDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDG 99 Score = 28.7 bits (61), Expect = 8.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G G G GGG G GGGGG G Sbjct: 66 GGGAGGDDDDGGGISGCGDGGGGGGGAGG 94 >SB_47680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2749 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PP PPP PP P P G + PP Sbjct: 359 PPQSPPPSPPESYNSEPEDSPLVGPSKPP 387 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 943 GARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 G GG G GG GGG GG GGG G Sbjct: 213 GYNGGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSG 251 Score = 30.3 bits (65), Expect = 2.6 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -3 Query: 553 GXXGGXGGGGG-XXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G GG GGGGG G GGGG G G GG Sbjct: 221 GAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGG 260 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 A G G GG G GGG G + GGGGG G Sbjct: 219 APGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGGSYCG 266 Score = 28.7 bits (61), Expect = 8.0 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -1 Query: 216 GXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G GGGGG GGG G G GG Sbjct: 221 GAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGG 260 >SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) Length = 524 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P P P P P P P P P P Sbjct: 272 PEPEPEPEPEPEPEPEPEPEPEPVHVPEP 300 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 875 RXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 R P P P P P P P P P P P Sbjct: 258 RQPEPEPEPEQEPEPEPEPEPEPEPEPEPEP 288 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 453 GXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 G P PP PP P P PP P P P Sbjct: 736 GIPSPSEVTTKSPPAPPLPPKVTPKPPAPPQFAPVP 771 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 492 PPPPXPXXXXPPPPPXPPXXPXP 560 P PP P P PPP P P P Sbjct: 759 PKPPAPPQFAPVPPPCAPIPPMP 781 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = +3 Query: 897 PPXPPXXPXXXP--PRAPRXAXXPPPAA 974 PP PP P P P P+ A PPP A Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAPVPPPCA 775 Score = 29.1 bits (62), Expect = 6.1 Identities = 16/50 (32%), Positives = 17/50 (34%), Gaps = 3/50 (6%) Frame = +3 Query: 828 PXPP---PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP P PPP PP P P AP + PPP Sbjct: 762 PAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPPP 811 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 30.3 bits (65), Expect = 2.6 Identities = 37/155 (23%), Positives = 37/155 (23%), Gaps = 8/155 (5%) Frame = +3 Query: 414 GGGGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP-----XPP--XXPXPXXVR 572 GG PP G P P PP P P PPP PP P P R Sbjct: 213 GGAPLQGGPPQGESHGQPGPPALLQQGPPGPPFHGEPRPPPHHDMRGPPDQWVPGPEQRR 272 Query: 573 FXXXGGGXRPXXXXXXTXXXXXXXRAXGAXGAXGXP-GPXGXPXXXXPXGGGGGPXXXXX 749 G G P G P GP G G Sbjct: 273 DNMRGPGMPPDMHGPPDRGRHDRGPPHDHRDFHGPPDGPHGQRMQHHDIRGPDPRGDRGP 332 Query: 750 XXXXXXXPRXXRPXAGGXGXXPLXXXPXPPPPPPP 854 P P G G P PP P P Sbjct: 333 RGPPSGVPTSGGPPPGHQGLRPSGPNNQGPPGPGP 367 >SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1717 Score = 30.3 bits (65), Expect = 2.6 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGG--GGXG 827 AG G + G G G GG GG G GGGG GG G Sbjct: 231 AGVGAGSDSGVGSGGGYGGVGGGSGGIAYGSVFKPVDLGSGGGGSWGGAG 280 >SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 30.3 bits (65), Expect = 2.6 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 910 GGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPPAXGRXXRG 770 GG GGG G R G G G RG PP G RG Sbjct: 68 GGYGGGPPRGPPRGHPMRGRGAPYGRGGPPSRGPPRGPPLPGPPRRG 114 Score = 29.5 bits (63), Expect = 4.6 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 5/70 (7%) Frame = +1 Query: 775 GXXARARG---GXGXXPXXXPPXPP--PPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPX 939 G R RG G G P PP P P PP P PP P Sbjct: 81 GHPMRGRGAPYGRGGPPSRGPPRGPPLPGPPRRGPPPDRDSGYGGYGDRYDRPPPDRRPP 140 Query: 940 PXGGPXXPPP 969 P PPP Sbjct: 141 PPDRSGYPPP 150 >SB_18621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXG 886 GGG G GGG G G GGG G Sbjct: 46 GGGVGDDDGGGGGCGGGDDDDDGGGGG 72 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 RGGG G GG G G G GG GGG G Sbjct: 195 RGGGRGAPRGRGGPRGGG---GGSGGYGGGSYG 224 Score = 29.1 bits (62), Expect = 6.1 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -3 Query: 934 GGXXXGXXGGXGGGXXXGXARXXXXXXGGGGG-GGXGXXXRG 812 G G GG GGG G R GGGGG GG G G Sbjct: 185 GAGGRGGRGGRGGG--RGAPRGRGGPRGGGGGSGGYGGGSYG 224 Score = 28.7 bits (61), Expect = 8.0 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG RGA G GG G G G + GG GG G Sbjct: 193 GGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGGYSQGGYG 238 >SB_56440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1142 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +2 Query: 440 PXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXP 553 P G + P+P GP P P P P P P P Sbjct: 345 PPLNGRKSNPNPPHNGPKVHPQPSPQWPKVHPQPSPPP 382 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 488 PXPPPXPRXXXPXPPPXPXPXP 553 P PPP P P PPP P P Sbjct: 942 PTPPPSPPPKEPTPPPSSKPSP 963 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 875 RXPPPXPPPXPPXXPXPXPPP 937 R P P PPP PP P PPP Sbjct: 938 RSPTPTPPPSPP-PKEPTPPP 957 >SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) Length = 361 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 951 PXXGXGGGXGXGXXGGXGGGXGGG 880 P G GGG G G GGG GGG Sbjct: 148 PVCGRGGGGRRGGGGCCGGGGGGG 171 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 30.3 bits (65), Expect = 2.6 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 893 PPPXPPXXPXPXPPP 937 PPP PP P P PPP Sbjct: 162 PPPQPPPPPLPPPPP 176 Score = 29.9 bits (64), Expect = 3.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPP 536 PPP P P PPPPP Sbjct: 162 PPPQPPPPPLPPPPPP 177 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 143 FXXPPPXWXPPXXPPPPP 196 + PPP PP PPPPP Sbjct: 159 YYSPPPQPPPPPLPPPPP 176 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 30.3 bits (65), Expect = 2.6 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXG-GGXXXGXARXXXXXXGGGGGGGXG 827 GGG G RGG G GG GG G GG GG G Sbjct: 141 GGGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCG 188 Score = 29.1 bits (62), Expect = 6.1 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXG--GGXXXGXARXXXXXXGGGG-GGGXG 827 GG R GG G GG G GG G GGG GGG G Sbjct: 156 GGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPG 204 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGG 839 GG G G G G GGG G + GGGGG Sbjct: 179 GGGDYSGGCGYGSSYGGGGDYGGGPGYGGGQGYGSYSGGGGG 220 >SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) Length = 278 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 951 PXXGXGGGXGXGXXGGXGGGXGGG 880 P G GGG G G GGG GGG Sbjct: 65 PVCGRGGGGRRGGGGCCGGGGGGG 88 >SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) Length = 1440 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P PPPPPPP P PP PP P PP Sbjct: 1122 PLPPPPPPPIPDDDGDDTDSTQLPNPPPDMQLPDPP-PPITINVPP 1166 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +3 Query: 489 PPPPPXPXXXXPPP--PPXPPXXPXP 560 PP PP P PP PP PP P P Sbjct: 1259 PPLPPLPPPDAQPPSLPPQPPQPPQP 1284 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 137 PLFXXPPPXWXPPXXPPPPPXXP 205 PL PPP PP PP PP P Sbjct: 1260 PLPPLPPPDAQPPSLPPQPPQPP 1282 >SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) Length = 224 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 951 PXXGXGGGXGXGXXGGXGGGXGGG 880 P G GGG G G GGG GGG Sbjct: 148 PVCGRGGGGRRGGGGCCGGGGGGG 171 >SB_40225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1442 Score = 25.0 bits (52), Expect(2) = 2.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 829 PXPPPPPPPXXP 864 P PPPPPP P Sbjct: 727 PPPPPPPPQTTP 738 Score = 23.4 bits (48), Expect(2) = 2.9 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +1 Query: 787 RARGGXGXXPXXXPPXPPPP 846 R G P PP PPPP Sbjct: 715 RTAQGLPSYPTLPPPPPPPP 734 >SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) Length = 246 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P P P P PP P PPP Sbjct: 158 PPPSSSP-PLSSPPPPPPSTPSSSLLPPP 185 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXP 554 P PPP P PP PP P P Sbjct: 461 PIPPPPPMSPPPPTPPPPATSP 482 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 887 PXPPPXPPXXPXPXPPP 937 P PPP P P P PPP Sbjct: 461 PIPPPPPMSPPPPTPPP 477 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 29.9 bits (64), Expect = 3.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGG 488 G GG GGGG GGGGG Sbjct: 185 GDDGGGSGGGGDDGGSDGGGGG 206 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 G G+ GG G G GGG G GGG GG Sbjct: 167 GDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGGNDGG 210 Score = 29.5 bits (63), Expect = 4.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G G GGGG GG GGG G Sbjct: 182 GDGGDDGGGSGGGGDDGGSDGGGGGNDGG 210 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G G G G GGG G GGGG G Sbjct: 182 GDGGDDGGGSGGGGDDGGSDGGGGGNDGG 210 Score = 28.7 bits (61), Expect = 8.0 Identities = 18/52 (34%), Positives = 20/52 (38%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG + G GG GG GGG G + GGGGG G G Sbjct: 170 GGSNGSGGGDDGGDGGDDGGGSGGGGDDGGS------DGGGGGNDGGRDDGG 215 >SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G GG G G G G G GGG G Sbjct: 242 GGVGGLGGIGGLGGGGVIAGAGAGIGGGVIG 272 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXP 458 G G GG GGGG G G GGG G G P Sbjct: 246 GLGGIGGLGGGGVIAGAGAGIGGG--VIGTGGIP 277 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXP 943 P PP PP PP P PP P Sbjct: 27 PTDPPTDPPTDPPTDPPTDPPTDP 50 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXP 943 P PP PP PP P PP P Sbjct: 31 PTDPPTDPPTDPPTDPPTDPPTDP 54 >SB_34304| Best HMM Match : HR1 (HMM E-Value=3.2) Length = 245 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +1 Query: 775 GXXARARGGXGXXPXXXPPXPPPPPPP 855 G ++ G P PP PP PPPP Sbjct: 2 GMNEKSDNGSAESPFASPPKPPRPPPP 28 >SB_19562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 G G G G G G G G G G GGG G Sbjct: 215 GNGDGEGEGEGEGDGDGDGDGNGDGDGGGGDG 246 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXG 472 G G G G G G G G GGG G G Sbjct: 227 GDGDGDGDGNGDGDGGGGDGGGDGDGDDG 255 >SB_6248| Best HMM Match : KH_1 (HMM E-Value=1.6e-41) Length = 487 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 654 GAXGAXGXPGPXGXPXXXXPXGGGGGP 734 G G G PG G P P GG GGP Sbjct: 192 GYDGGFGGPGFGGGPMRGGPMGGRGGP 218 Score = 28.7 bits (61), Expect = 8.0 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGX-GGGGGPXXXGV---XGXPXPXXXGG 437 G GG G GGG G GG GGP G+ G P GG Sbjct: 195 GGFGGPGFGGGPMRGGPMGGRGGPRGRGMQRGRGGPRGGGRGG 237 >SB_5778| Best HMM Match : Gag_MA (HMM E-Value=1.2) Length = 250 Score = 29.9 bits (64), Expect = 3.5 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXP 932 P P PPP P + PP PP P P Sbjct: 109 PSPAPPPTPSLRIAEKQHQSRASPPPPPPPPVLKP 143 >SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2851 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 413 GGGGGGXXPPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPP 535 GGG GG P P P PP P PPP Sbjct: 200 GGGNGGDGKPDGKEGLHGPPPVVRNTHEPPWMDRSGPGPPP 240 >SB_31266| Best HMM Match : PKI (HMM E-Value=1) Length = 1507 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/47 (29%), Positives = 19/47 (40%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 PP PP P PP P PP +P+ + PPP++ Sbjct: 400 PPRPPKPSTNGQASVDGQLKPPSSPSPRRQTGPP-SPKPSRQPPPSS 445 >SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -1 Query: 936 GGGXGXGXXG-GXGGGXGGGXRG 871 GGG G G G G GGG GGG G Sbjct: 6 GGGDGDGGDGDGGGGGDGGGDGG 28 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 4/36 (11%) Frame = +2 Query: 872 PRXPPPXPP----PXPPXXPXPXPPPXPXXGXAPPP 967 P PPP PP P P P P P PPP Sbjct: 853 PSAPPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPP 888 >SB_21796| Best HMM Match : COLFI (HMM E-Value=0) Length = 1239 Score = 29.9 bits (64), Expect = 3.5 Identities = 17/66 (25%), Positives = 19/66 (28%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXXXXRAXGAXGA 668 PPP P P PP P P + G R + G G Sbjct: 92 PPPTPPPQRRGPPGDPGPKGNKGQPGAQGRPGAPGDRGERGSAGSDGPKGEAGGPGPLGP 151 Query: 669 XGXPGP 686 G PGP Sbjct: 152 IGPPGP 157 Score = 24.2 bits (50), Expect(2) = 3.8 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXP 452 G G G G G GG GP G G P P Sbjct: 126 GDRGERGSAGSDGPKGEAGGPGP--LGPIGPPGP 157 Score = 23.8 bits (49), Expect(2) = 3.8 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = -3 Query: 733 GPPPPPXGXXXXGXPXGPGXPXAP 662 GPP P G P G P AP Sbjct: 102 GPPGDPGPKGNKGQPGAQGRPGAP 125 >SB_20903| Best HMM Match : Extensin_2 (HMM E-Value=0.3) Length = 713 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 PPPPPP P PP PPR P P Sbjct: 487 PPPPPPSDAMMQGMGAPSMSEPPAGGPPMGQGPPRPPTNPTAAP 530 >SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) Length = 260 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGG 892 RGGG G GGG G G GG GGG Sbjct: 153 RGGG-----GRGGGRGHGRGGGSGGG 173 Score = 29.9 bits (64), Expect = 3.5 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 936 GGGXGXGXXGGXGGGXGGG 880 GGG G G G GGG GGG Sbjct: 155 GGGRGGGRGHGRGGGSGGG 173 >SB_38133| Best HMM Match : TolA (HMM E-Value=0.38) Length = 2114 Score = 25.0 bits (52), Expect(2) = 3.7 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 829 PXPPPPPPPXXP 864 P PPPPP P P Sbjct: 1054 PPPPPPPSPTVP 1065 Score = 23.0 bits (47), Expect(2) = 3.7 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +1 Query: 787 RARGGXGXXPXXXPPXPPPPP 849 + +GG PP PPP P Sbjct: 1042 QTQGGQAQQAAVPPPPPPPSP 1062 >SB_55442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 25.4 bits (53), Expect(2) = 4.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -2 Query: 854 GGGGGGGXGG 825 GGGGGGG GG Sbjct: 195 GGGGGGGGGG 204 Score = 22.6 bits (46), Expect(2) = 4.4 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 863 GXXGGGGGGG 834 G GGGGGGG Sbjct: 194 GGGGGGGGGG 203 >SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 29.5 bits (63), Expect = 4.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 899 PXPPXXPXPXPPPXPXXGXAPPP 967 P PP P PPP P PPP Sbjct: 363 PTPPPPPHSPPPPLPVIQLNPPP 385 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +2 Query: 74 NLXXXXXXPPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 NL P P + F P P PP P PP P P P Sbjct: 162 NLFILRQHPSYPPTQPFYPPTQPFYPPTPSSYPPTQPSYPPTAPSYPPTP 211 >SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) Length = 1467 Score = 29.5 bits (63), Expect = 4.6 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 4/56 (7%) Frame = +3 Query: 813 PLXXXPXPPPPPP----PXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PP PPP P P P PP PR A PPP Sbjct: 630 PTTVPPLPPTPPPRQSTPPPLLLIPLLPLLTLPLPPPTVRHPQATPLPRLATHPPP 685 >SB_51223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 410 GGGGGGGXXPPXXXGARXXPHPXXXGPXPPPXPRXXXPXPP 532 GGG G PP P GP PP R PP Sbjct: 37 GGGAGNRPSPPADRHGPSDPPTDRHGPSDPPTDRHGPSDPP 77 >SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPP 934 PP P P PP P P PP Sbjct: 74 PPQPTPPPPRPPTPPPP 90 >SB_41312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 357 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGG 488 G GG GGGGG G GGGGG Sbjct: 151 GRGGGRGGGGG----GCGGGGG 168 >SB_37501| Best HMM Match : SCP (HMM E-Value=1.2e-19) Length = 351 Score = 29.5 bits (63), Expect = 4.6 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = -3 Query: 535 GGGGGXXXXGXGGGGG-PXXXGVXGXPXPXXXGGXXPPPP 419 GGGGG GGGGG P G P G P P Sbjct: 18 GGGGGSPTEAPGGGGGSPTEAPGGGGSTPTKGEGSTSPTP 57 >SB_36777| Best HMM Match : VWA (HMM E-Value=0) Length = 1303 Score = 29.5 bits (63), Expect = 4.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 899 PXPPXXPXPXPPPXPXXGXAPPP 967 P P P P P P P APPP Sbjct: 1257 PSPSLVPNPVPQPAPAPAPAPPP 1279 >SB_26832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 635 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 417 GGGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXP 542 G G PP G P GPP PP P PP P Sbjct: 471 GVRGDRGPPGPAGPPGPSGRYVPGPPGPPGRTVIGLPGPPGP 512 >SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 29.5 bits (63), Expect = 4.6 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = -3 Query: 967 GGGXXAXRG-ARGGXXXGXXGGXG-GGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG A G RGG GG G G G GGGG G G G Sbjct: 44 GGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGG 97 Score = 29.5 bits (63), Expect = 4.6 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = -3 Query: 967 GGGXXAXRG-ARGGXXXGXXGGXG-GGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG A G RGG GG G G G GGGG G G G Sbjct: 64 GGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGIAGEGMGGGGMAGEGMSRGG 117 >SB_3546| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-29) Length = 447 Score = 29.5 bits (63), Expect = 4.6 Identities = 19/64 (29%), Positives = 22/64 (34%) Frame = +2 Query: 41 NSPLXNXKMXGNLXXXXXXPPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPX 220 N+P N + N PP P F PL+ PP PP PP P Sbjct: 309 NAPPFNGQPPYNTPPFNGQPPYYTPP--FNGQPLYHTPPFNGQPPYNTPPFNGQPLYHTP 366 Query: 221 PXGG 232 P G Sbjct: 367 PFNG 370 >SB_58047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 29.1 bits (62), Expect = 6.1 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 411 GGGGGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 G G G P G G GPP PP PP PP PP Sbjct: 186 GPPGPPGPPGPGLVGSGSGAGAVIAGPPGPP-----GPPGPPGPP 225 >SB_45113| Best HMM Match : CemA (HMM E-Value=6) Length = 363 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 586 PXXXKRTXXGXGXXGGXGGGGGXXXXGXGGGGG 488 P T G G GGGG G GGGGG Sbjct: 137 PTATTATTTKQGPMRGRGGGGRRGGRGRGGGGG 169 >SB_38223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPP 536 PPPPP PPPPP Sbjct: 93 PPPPPQLENDFPPPPP 108 >SB_35820| Best HMM Match : TRAP_240kDa (HMM E-Value=0.006) Length = 1382 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 936 GGGXGXGXXGGXGGGXGGG 880 GGG G G GG GGG GGG Sbjct: 773 GGGMGLG-MGGSGGGGGGG 790 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GG GGG G G GGG GGG Sbjct: 795 GGNRDNYSRGGGGGYNRGYGSGGGYGGG 822 >SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) Length = 556 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 943 GARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GA GG G G GGG G GGG G G Sbjct: 516 GAIGGGAIGDGGDNGGGDDGGDDGAGNSDGGGGNDNGGG 554 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGGA G GG G G G GGG Sbjct: 519 GGGAIGDGGDNGGGDDGGDDGAGNSDGGG 547 >SB_25350| Best HMM Match : Collagen (HMM E-Value=0) Length = 1112 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 648 AXGAXGAXGXPGPXGXPXXXXPXGGGG 728 A G G+ G PGP G P P G G Sbjct: 82 AAGIKGSNGAPGPRGSPGLPGPRGSDG 108 Score = 29.1 bits (62), Expect = 6.1 Identities = 36/152 (23%), Positives = 36/152 (23%), Gaps = 1/152 (0%) Frame = +3 Query: 282 GGXGXGGPPXPXNPXGXXXXXXXXXXXXXXXXXXXXQXTXXXXGGGGGGGXXPPXXXGXG 461 G G GP P P G G GG P G Sbjct: 597 GDQGASGPTGPVGPRGPGGIKGAKGVMGSSGRPGITGTLGQRGRLGSKGGEGTPGSQGM- 655 Query: 462 XPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXXX 641 P GPP P P PP P P P R G R Sbjct: 656 ----PGMSGPPGRPGPPG---PPGPPGPSGPSGSNGRNGVKGTPGRDGEPGIPGPDGRPG 708 Query: 642 XRAXGA-XGAXGXPGPXGXPXXXXPXGGGGGP 734 R G G G GP G G G P Sbjct: 709 ERGPGGEIGRKGEKGPSGERGYPGKDGRAGEP 740 >SB_23868| Best HMM Match : Gal_Lectin (HMM E-Value=1.4e-05) Length = 318 Score = 29.1 bits (62), Expect = 6.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 893 PPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P P P P P P PP Sbjct: 93 PPPQPAPLPEPEPEPEPDLDLPVPP 117 >SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = -3 Query: 553 GXXGGXGG-GGGXXXXGXGGGGGPXXXGVXG 464 G GG GG GGG G GGGG G G Sbjct: 270 GAVGGFGGWGGGSEDNGASGGGGGYSGGGSG 300 >SB_13751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 853 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 G G G G G G G G G G GGG Sbjct: 779 GDGDGDGDGDGDGDGDGDGDGAGAGDGGG 807 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 G G G GGG G G G G G G G Sbjct: 795 GDGDGAGAGDGGGDGDGDGDGDGDGDGAG 823 >SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) Length = 287 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGV 470 G GG GG G G GGGGG G+ Sbjct: 259 GGFGGGGGACGCNGGGAGGGGGYSGGGL 286 >SB_58404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 532 Score = 29.1 bits (62), Expect = 6.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGG--XGGGXXXGXARXXXXXXGGGGGG 836 GGG RG RGG G G GG G R G GGG Sbjct: 430 GGGRGGFRGNRGGFRGGNERGQRRGGRGGHGPPRGGGGFSGPRGGG 475 >SB_55443| Best HMM Match : Homeobox (HMM E-Value=2.3e-26) Length = 245 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 PPP P PP P PP P + P R Sbjct: 190 PPPMYPAFPPIFPSSPPPEYPGLPVSSPGR 219 >SB_52268| Best HMM Match : SecA_PP_bind (HMM E-Value=0.33) Length = 774 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 501 PXPXXXXPPPPPXPPXXP 554 P P PPPPP PP P Sbjct: 408 PQPWSPAPPPPPTPPFNP 425 Score = 23.8 bits (49), Expect(2) = 6.7 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 Query: 813 PLXXXPXPPPPPPP 854 P P PPPPP P Sbjct: 408 PQPWSPAPPPPPTP 421 Score = 23.4 bits (48), Expect(2) = 6.7 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +3 Query: 882 PXXXPPPXPPXXPXXXPPR 938 P PPP PP P P+ Sbjct: 413 PAPPPPPTPPFNPWLDSPK 431 >SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) Length = 627 Score = 29.1 bits (62), Expect = 6.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXP 943 P P P PP P P PPP P Sbjct: 150 PSITQPPPRHSPPQTPVPPPPPLP 173 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 1/24 (4%) Frame = +2 Query: 137 PLFXXPPPXWXPPXXP-PPPPXXP 205 P PPP PP P PPPP P Sbjct: 150 PSITQPPPRHSPPQTPVPPPPPLP 173 >SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) Length = 154 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 PPP P PP P PP P + P R Sbjct: 100 PPPMYPAFPPSFPSSPPPEYPGLPVSSPGR 129 >SB_33704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 677 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 390 QXTXXXXGGGGGGGXXPPXXXGXGXPXTPXXXGPPP 497 Q T GG G PP G G P T PPP Sbjct: 515 QQTAQHPNQQGGRGQAPPPSYGRGGPTTTVQQQPPP 550 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 P PPP P P P P P P P PP Sbjct: 429 PSHPPPLPQPPPSIIP-PPTTPLPQTVPTPP 458 >SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) Length = 185 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 936 GGGXGXGXXGGXGGGXGGGXRG 871 GGG G G G GG GGG G Sbjct: 124 GGGDGGGGSDGGGGSDGGGGDG 145 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 943 GARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGG 839 G GG G GG GG G GGGGG Sbjct: 428 GGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGGG 462 >SB_18739| Best HMM Match : YhhN (HMM E-Value=7.3) Length = 306 Score = 29.1 bits (62), Expect = 6.1 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 826 PPXPPPPPPP 855 PP PPPPPPP Sbjct: 252 PPPPPPPPPP 261 >SB_14695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 PPP P PP P PP P + P R Sbjct: 153 PPPMYPAFPPSFPSSPPPEYPGLPVSSPGR 182 >SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 PPP P PP P PP P + P R Sbjct: 190 PPPMYPAFPPIFPSSPPPEYPGLPVSSPGR 219 >SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G G G G G GGG GG Sbjct: 168 GGGDDDDGGDGDGGGDDGGGADGGGADGG 196 >SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) Length = 245 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 PPP P PP P PP P + P R Sbjct: 190 PPPMYPAFPPSFPSSPPPEYPGLPVSSPGR 219 >SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) Length = 245 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 PPP P PP P PP P + P R Sbjct: 190 PPPMYPAFPPSFPFSPPPEYPGLPVSSPGR 219 >SB_58915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 28.7 bits (61), Expect = 8.0 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +3 Query: 813 PLXXXPXPPPPPPP 854 P+ P PPPPPPP Sbjct: 151 PMVTTPAPPPPPPP 164 >SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 936 GGGXGXGXXGGXGGGXGGGXRG 871 GGG G G GG G GGG G Sbjct: 193 GGGGGVGTTGGSTGAAGGGGGG 214 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPP 545 P P GPPP P PPP PP Sbjct: 276 PGFPPRWGPPPHMPPDYRGFPPPNFPP 302 >SB_51163| Best HMM Match : Adeno_PIX (HMM E-Value=0.96) Length = 772 Score = 28.7 bits (61), Expect = 8.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GG G G G G GG GG GGG Sbjct: 512 GGGSHEMGGGMEEGAGGMGGGGGAGGGG 539 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 28.7 bits (61), Expect = 8.0 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +3 Query: 420 GGGGXXPPXXXGXGXPXTPXXXGPPPPPX-PXXXXPPPPPXP 542 G GG PP G P T G PP P PPPP P Sbjct: 77 GIGG--PPPSGQYGAPPTSQPYGAPPTSGYPGYQQHPPPPQP 116 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 28.7 bits (61), Expect = 8.0 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 887 PXPPPXPPXXPXPXPPPXPXXGXAPP 964 P PP PP P P P P PP Sbjct: 230 PKPPTAPPNTPPPPVTPPPPNTPGPP 255 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 1/25 (4%) Frame = +3 Query: 489 PPPPPXPXXXXPPP-PPXPPXXPXP 560 P PP P PPP P PP P P Sbjct: 230 PKPPTAPPNTPPPPVTPPPPNTPGP 254 >SB_31182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1280 Score = 28.7 bits (61), Expect = 8.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P PP PPPPPP P Sbjct: 1057 PVVKPPSYPPPPPPKPP 1073 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 28.7 bits (61), Expect = 8.0 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 8/59 (13%) Frame = +3 Query: 816 LXXXPXPPPPPPPXXXXXXRAXP--XXXPPPXPP------XXPXXXPPRAPRXAXXPPP 968 L P PPP P R P PPP PP P PPR PPP Sbjct: 22 LLRPPPPPPTRPFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPPPPPRRGFYDDYPPP 80 >SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 28.7 bits (61), Expect = 8.0 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -3 Query: 592 PPPXXXKRTXXGXGXX-GGXGGGGGXXXXGXGGGGGPXXXGV 470 PP G G GG GGGG GGGGG G+ Sbjct: 321 PPSSFVNGGSGGSGTSEGGFGGGGATVASRPGGGGGYSGGGL 362 >SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) Length = 782 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 936 GGGXGXGXXGGXGGGXGGGXRG 871 GGG G G GG G GGG G Sbjct: 239 GGGGGVGTTGGSTGAAGGGGGG 260 >SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 28.7 bits (61), Expect = 8.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 910 GGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG GGG G GG GGGG G Sbjct: 55 GGQGGGGQGGGQGVGGQEVGGQGGGGQG 82 >SB_41601| Best HMM Match : zf-C2H2 (HMM E-Value=0.0019) Length = 1008 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 459 GXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 G TP P PP P PP PP P Sbjct: 153 GQQQTPQRIAPAPPNTQNMRQTPTPPMPPKSP 184 >SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 28.7 bits (61), Expect = 8.0 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 6/54 (11%) Frame = -3 Query: 970 AGGGXXAXRGARG-----GXXXGXXGGXGG-GXXXGXARXXXXXXGGGGGGGXG 827 AGGG RG RG G G GG GG G G R G G G G G Sbjct: 17 AGGGGDRGRG-RGHCLGHGSGRGGRGGRGGSGRGRGRGRGSGRGRGRGSGQGYG 69 Score = 28.7 bits (61), Expect = 8.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G G G G G GG GG RG Sbjct: 18 GGGGDRGRGRGHCLGHGSGRGGRGGRGGSGRG 49 >SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) Length = 1258 Score = 28.7 bits (61), Expect = 8.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG GGG G GGG GGG Sbjct: 1087 GGGGQQPMMMGGGQGMMMGNAMGGGMGGG 1115 >SB_28137| Best HMM Match : rve (HMM E-Value=0.00026) Length = 293 Score = 28.7 bits (61), Expect = 8.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPP 937 P P P P P P P PPP Sbjct: 244 PTPSPTPPSPTHPSPLPPP 262 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 28.7 bits (61), Expect = 8.0 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -3 Query: 964 GGXXAXRGARGGXXX-GXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 GG G GG G GG GGG G +R GG GGG Sbjct: 2304 GGKSFLNGGEGGESRAGPVGGFGGG---GSSRIRPGGGGGYSGGG 2345 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 28.7 bits (61), Expect = 8.0 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = +3 Query: 417 GGGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP--XPPXXPXP 560 GG PP G P T PP P PPPPP P P P Sbjct: 609 GGHPHHPPPTGYPGGYPGT--HTAPPAGGYPTGQHPPPPPAGYPGYGPPP 656 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 28.7 bits (61), Expect = 8.0 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +2 Query: 872 PRXPPPXP--PPXPPXXPXPXP--PPXPXXGXAPPPR 970 PR PP P PP PP P P PP P P R Sbjct: 346 PRYPPSPPRYPPSPPRYPSSHPRYPPSPLRYLPSPIR 382 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 28.7 bits (61), Expect = 8.0 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +3 Query: 489 PPPPPXPXXXXPPP---PPXPPXXPXP 560 P PPP P PPP PP P P P Sbjct: 79 PFPPPPPIYMPPPPVYMPPPPVYMPPP 105 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 28.7 bits (61), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG P G GG G GG GGG G Sbjct: 336 GGGDPGGGDPGGGDPGGGDPGGGDPGGGDHG 366 Score = 28.7 bits (61), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG P G GG G GG GGG G Sbjct: 341 GGGDPGGGDPGGGDPGGGDPGGGDHGGGDHG 371 Score = 28.7 bits (61), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG P G GG G GG GGG G Sbjct: 346 GGGDPGGGDPGGGDPGGGDHGGGDHGGGDHG 376 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.310 0.152 0.543 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,604,171 Number of Sequences: 59808 Number of extensions: 658784 Number of successful extensions: 21729 Number of sequences better than 10.0: 243 Number of HSP's better than 10.0 without gapping: 1098 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9556 length of database: 16,821,457 effective HSP length: 83 effective length of database: 11,857,393 effective search space used: 3059207394 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 43 (21.9 bits)
- SilkBase 1999-2023 -