BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_A13 (1026 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 52 6e-07 At4g01985.1 68417.m00265 expressed protein 49 6e-06 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 49 6e-06 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 48 1e-05 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 46 5e-05 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 38 9e-05 At1g61080.1 68414.m06877 proline-rich family protein 45 9e-05 At5g46730.1 68418.m05757 glycine-rich protein 44 2e-04 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 44 2e-04 At3g50180.1 68416.m05486 hypothetical protein 43 3e-04 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 43 3e-04 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 42 5e-04 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 42 7e-04 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 42 9e-04 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 41 0.001 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 41 0.001 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 41 0.001 At1g62240.1 68414.m07021 expressed protein 41 0.001 At4g18570.1 68417.m02749 proline-rich family protein common fami... 41 0.002 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 40 0.002 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 40 0.002 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 40 0.002 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 40 0.002 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 40 0.003 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 40 0.004 At4g33660.1 68417.m04781 expressed protein 40 0.004 At1g75550.1 68414.m08780 glycine-rich protein 40 0.004 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 39 0.005 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 39 0.005 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 39 0.005 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 39 0.005 At2g30560.1 68415.m03722 glycine-rich protein 39 0.005 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 39 0.006 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 39 0.006 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 39 0.006 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 39 0.006 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 39 0.006 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 34 0.008 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 38 0.008 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 38 0.008 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 38 0.008 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 38 0.011 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 38 0.011 At4g30460.1 68417.m04325 glycine-rich protein 38 0.011 At4g16240.1 68417.m02464 hypothetical protein 38 0.011 At4g08230.1 68417.m01358 glycine-rich protein 38 0.011 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 38 0.011 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 38 0.011 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 38 0.011 At1g53625.1 68414.m06096 expressed protein 38 0.011 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 38 0.011 At2g05440.2 68415.m00575 glycine-rich protein 38 0.014 At2g05440.1 68415.m00574 glycine-rich protein 38 0.014 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 38 0.014 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 37 0.019 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 37 0.019 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 37 0.019 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 37 0.019 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 37 0.019 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 37 0.019 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 37 0.019 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 37 0.025 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 37 0.025 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 37 0.025 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 37 0.025 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 37 0.025 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 37 0.025 At1g29380.1 68414.m03592 hypothetical protein 37 0.025 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 37 0.025 At5g38560.1 68418.m04662 protein kinase family protein contains ... 36 0.033 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 36 0.033 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 36 0.033 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 36 0.033 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 36 0.033 At1g35617.1 68414.m04424 hypothetical protein 36 0.033 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 29 0.039 At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; g... 36 0.043 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 36 0.043 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 36 0.043 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 36 0.043 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 36 0.043 At1g02710.1 68414.m00222 glycine-rich protein 36 0.043 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 36 0.057 At4g29030.1 68417.m04151 glycine-rich protein glycine-rich prote... 36 0.057 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 36 0.057 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 36 0.057 At1g70990.1 68414.m08190 proline-rich family protein 36 0.057 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 36 0.057 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 36 0.057 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 36 0.057 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 36 0.057 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 36 0.057 At1g29030.1 68414.m03553 apoptosis inhibitory 5 (API5) family pr... 36 0.057 At1g26150.1 68414.m03192 protein kinase family protein similar t... 36 0.057 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 35 0.076 At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 35 0.076 At3g51290.1 68416.m05614 proline-rich family protein 35 0.076 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 35 0.076 At1g49270.1 68414.m05524 protein kinase family protein contains ... 35 0.076 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 35 0.076 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 35 0.10 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 35 0.10 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 35 0.10 At5g04970.1 68418.m00526 pectinesterase, putative contains simil... 35 0.10 At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1... 35 0.10 At2g28670.1 68415.m03485 disease resistance-responsive family pr... 35 0.10 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 35 0.10 At1g23540.1 68414.m02960 protein kinase family protein contains ... 35 0.10 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 35 0.10 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 34 0.13 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 34 0.13 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 34 0.13 At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibri... 34 0.13 At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / he... 34 0.13 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 34 0.13 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 34 0.13 At1g27710.1 68414.m03387 glycine-rich protein 34 0.13 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 34 0.13 At1g12810.1 68414.m01488 proline-rich family protein contains pr... 34 0.13 At1g11850.2 68414.m01364 expressed protein 34 0.13 At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein si... 34 0.17 At3g11402.1 68416.m01388 DC1 domain-containing protein contains ... 34 0.17 At3g05920.1 68416.m00668 heavy-metal-associated domain-containin... 34 0.17 At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F... 34 0.17 At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F... 34 0.17 At1g15830.1 68414.m01900 expressed protein 34 0.17 At1g04800.1 68414.m00476 glycine-rich protein 34 0.17 At1g02460.1 68414.m00195 glycoside hydrolase family 28 protein /... 34 0.17 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 33 0.23 At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ... 33 0.23 At5g21160.1 68418.m02528 La domain-containing protein / proline-... 33 0.23 At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family prot... 33 0.23 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 33 0.23 At3g24540.1 68416.m03082 protein kinase family protein contains ... 33 0.23 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 33 0.23 At1g10620.1 68414.m01204 protein kinase family protein contains ... 33 0.23 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 33 0.31 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 33 0.31 At5g56140.1 68418.m07003 KH domain-containing protein 33 0.31 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 33 0.31 At3g46740.1 68416.m05074 chloroplast outer envelope protein, put... 33 0.31 At3g24550.1 68416.m03083 protein kinase family protein contains ... 33 0.31 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 33 0.31 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 33 0.31 At2g05510.1 68415.m00583 glycine-rich protein 33 0.31 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 33 0.31 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 33 0.31 At5g66960.1 68418.m08442 prolyl oligopeptidase family protein si... 31 0.31 At5g64430.1 68418.m08093 octicosapeptide/Phox/Bem1p (PB1) domain... 33 0.40 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 33 0.40 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 33 0.40 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 33 0.40 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 33 0.40 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 33 0.40 At4g29240.1 68417.m04182 leucine-rich repeat family protein / ex... 33 0.40 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 33 0.40 At3g43583.1 68416.m04636 hypothetical protein 33 0.40 At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein... 33 0.40 At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family... 33 0.40 At3g02670.1 68416.m00258 proline-rich family protein contains pr... 33 0.40 At2g39750.1 68415.m04881 dehydration-responsive family protein s... 33 0.40 At2g11005.1 68415.m01177 glycine-rich protein 33 0.40 At1g74720.1 68414.m08658 C2 domain-containing protein contains I... 33 0.40 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 33 0.40 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 33 0.40 At2g41260.2 68415.m05096 glycine-rich protein / late embryogenes... 27 0.44 At5g52440.1 68418.m06507 HCF106 protein identical to HCF106 [Ara... 26 0.44 At2g41260.1 68415.m05095 glycine-rich protein / late embryogenes... 27 0.45 At5g61660.1 68418.m07736 glycine-rich protein 32 0.53 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 32 0.53 At5g02600.2 68418.m00195 heavy-metal-associated domain-containin... 32 0.53 At5g02600.1 68418.m00196 heavy-metal-associated domain-containin... 32 0.53 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 32 0.53 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 32 0.53 At4g14750.1 68417.m02270 calmodulin-binding family protein conta... 32 0.53 At3g26400.1 68416.m03292 eukaryotic translation initiation facto... 32 0.53 At3g18810.1 68416.m02389 protein kinase family protein contains ... 32 0.53 At3g08640.1 68416.m01003 alphavirus core protein family contains... 32 0.53 At2g28440.1 68415.m03455 proline-rich family protein contains pr... 32 0.53 At2g04190.1 68415.m00404 meprin and TRAF homology domain-contain... 32 0.53 At1g15840.1 68414.m01901 expressed protein 32 0.53 At5g60050.1 68418.m07530 PRLI-interacting factor-related contain... 29 0.55 At5g07190.1 68418.m00819 embryo-specific protein 3, putative sim... 32 0.71 At4g34440.1 68417.m04894 protein kinase family protein contains ... 32 0.71 At4g03120.1 68417.m00425 proline-rich family protein similar to ... 32 0.71 At3g49840.1 68416.m05449 proline-rich family protein contains pr... 32 0.71 At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ b... 32 0.71 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 32 0.71 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 32 0.71 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 32 0.71 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 32 0.71 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 32 0.71 At1g53640.1 68414.m06100 hypothetical protein ; expression suppo... 32 0.71 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 32 0.71 At5g65630.1 68418.m08256 DNA-binding bromodomain-containing prot... 31 0.93 At5g60850.1 68418.m07633 Dof-type zinc finger domain-containing ... 31 0.93 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 31 0.93 At4g21720.1 68417.m03145 expressed protein 31 0.93 At3g46240.1 68416.m05005 protein kinase-related similar to light... 31 0.93 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 31 0.93 At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) fa... 31 0.93 At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) fa... 31 0.93 At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) fa... 31 0.93 At2g34670.1 68415.m04259 proline-rich family protein contains pr... 31 0.93 At1g65440.1 68414.m07424 glycine-rich protein 31 0.93 At1g53620.1 68414.m06094 glycine-rich protein 31 0.93 At1g32360.1 68414.m03989 zinc finger (CCCH-type) family protein ... 31 0.93 At1g28240.1 68414.m03466 expressed protein 31 0.93 At1g11850.1 68414.m01363 expressed protein 31 0.93 At1g04660.1 68414.m00463 glycine-rich protein 31 0.93 At3g57500.1 68416.m06401 hypothetical protein 27 1.0 At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly id... 31 1.2 At4g03390.1 68417.m00461 leucine-rich repeat transmembrane prote... 31 1.2 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 31 1.2 At3g49300.1 68416.m05388 proline-rich family protein contains pr... 31 1.2 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 31 1.2 At3g13225.1 68416.m01660 WW domain-containing protein contains P... 31 1.2 At3g11820.2 68416.m01448 syntaxin 121 (SYP121) / syntaxin-relate... 31 1.2 At3g11820.1 68416.m01449 syntaxin 121 (SYP121) / syntaxin-relate... 31 1.2 At3g04570.1 68416.m00485 DNA-binding protein-related contains Pf... 31 1.2 At2g30505.1 68415.m03716 Expressed protein 31 1.2 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 31 1.2 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 31 1.2 At1g68390.1 68414.m07813 expressed protein contains Pfam profile... 31 1.2 At1g50300.1 68414.m05639 zinc finger (Ran-binding) family protei... 31 1.2 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 31 1.2 At1g35830.1 68414.m04452 VQ motif-containing protein contains PF... 31 1.2 At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family p... 31 1.2 At3g50190.1 68416.m05488 expressed protein contains Pfam profile... 26 1.6 At5g25550.1 68418.m03040 leucine-rich repeat family protein / ex... 31 1.6 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 31 1.6 At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp... 31 1.6 At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp... 31 1.6 At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp... 31 1.6 At4g16830.1 68417.m02540 nuclear RNA-binding protein (RGGA) iden... 31 1.6 At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar... 31 1.6 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 31 1.6 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 31 1.6 At3g18360.1 68416.m02335 VQ motif-containing protein contains PF... 31 1.6 At3g07540.1 68416.m00900 formin homology 2 domain-containing pro... 31 1.6 At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family... 31 1.6 At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi do... 31 1.6 At1g62510.1 68414.m07053 protease inhibitor/seed storage/lipid t... 31 1.6 At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin fa... 31 1.6 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 31 1.6 At1g30475.1 68414.m03725 expressed protein 27 1.7 At5g22790.1 68418.m02664 expressed protein 30 2.2 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 30 2.2 At4g32340.1 68417.m04603 expressed protein 30 2.2 At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi... 30 2.2 At4g19920.1 68417.m02918 disease resistance protein (TIR class),... 30 2.2 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 30 2.2 At3g04640.1 68416.m00497 glycine-rich protein predicted proteins... 30 2.2 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 30 2.2 At2g05530.1 68415.m00585 glycine-rich protein 30 2.2 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 30 2.2 At1g77030.1 68414.m08970 glycine-rich protein 30 2.2 At1g64450.1 68414.m07306 proline-rich family protein contains pr... 30 2.2 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 30 2.2 At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi do... 30 2.2 At1g31280.1 68414.m03828 PAZ domain-containing protein / piwi do... 30 2.2 At1g24490.1 68414.m03084 60 kDa inner membrane family protein si... 30 2.2 At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp... 30 2.2 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 30 2.2 At1g04930.1 68414.m00490 hydroxyproline-rich glycoprotein family... 30 2.2 At3g25500.1 68416.m03171 formin homology 2 domain-containing pro... 25 2.5 At5g11550.1 68418.m01347 expressed protein 29 2.7 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 30 2.8 At4g39680.1 68417.m05614 SAP domain-containing protein contains ... 30 2.8 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 30 2.8 At4g21620.1 68417.m03134 glycine-rich protein 30 2.8 At3g32400.1 68416.m04142 formin homology 2 domain-containing pro... 30 2.8 At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar... 30 2.8 At3g08630.1 68416.m01002 expressed protein 30 2.8 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 30 2.8 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 30 2.8 At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family... 30 2.8 At1g30780.1 68414.m03763 F-box family protein 30 2.8 At1g18170.1 68414.m02258 immunophilin / FKBP-type peptidyl-proly... 30 2.8 At1g07135.1 68414.m00759 glycine-rich protein 30 2.8 At3g05470.1 68416.m00599 formin homology 2 domain-containing pro... 29 3.2 At5g41460.1 68418.m05035 fringe-related protein strong similarit... 29 3.4 At3g10040.1 68416.m01204 expressed protein est match 25 3.4 At1g20900.1 68414.m02617 DNA-binding protein-related contains Pf... 25 3.5 At4g38550.1 68417.m05458 expressed protein 29 3.8 At4g15150.1 68417.m02326 glycine-rich protein 29 3.8 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 29 3.8 At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative stro... 29 3.8 At3g21215.1 68416.m02681 RNA-binding protein, putative contains ... 29 3.8 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 29 3.8 At3g16350.1 68416.m02068 myb family transcription factor ; conta... 29 3.8 At2g45470.1 68415.m05655 fasciclin-like arabinogalactan-protein ... 29 3.8 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 29 3.8 At5g62440.1 68418.m07837 expressed protein 29 5.0 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 29 5.0 At5g58010.1 68418.m07258 basic helix-loop-helix (bHLH) family pr... 29 5.0 At5g46780.2 68418.m05763 VQ motif-containing protein contains PF... 29 5.0 At5g46780.1 68418.m05762 VQ motif-containing protein contains PF... 29 5.0 At5g41440.1 68418.m05033 zinc finger (C3HC4-type RING finger) fa... 29 5.0 At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear... 29 5.0 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 29 5.0 At5g13760.1 68418.m01604 expressed protein similar to unknown pr... 29 5.0 At5g10380.1 68418.m01204 zinc finger (C3HC4-type RING finger) fa... 29 5.0 At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containi... 29 5.0 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 29 5.0 At4g26480.1 68417.m03810 KH domain-containing protein qkI-7, Mus... 29 5.0 At4g23890.1 68417.m03436 expressed protein hypothetical protein,... 29 5.0 At4g23140.2 68417.m03338 receptor-like protein kinase 5 (RLK5) i... 29 5.0 At4g23140.1 68417.m03337 receptor-like protein kinase 5 (RLK5) i... 29 5.0 At4g17940.1 68417.m02672 expressed protein 29 5.0 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 29 5.0 At3g56990.1 68416.m06344 glycine-rich protein conserved hypothet... 29 5.0 At2g39250.1 68415.m04820 AP2 domain-containing transcription fac... 29 5.0 At1g70250.1 68414.m08082 receptor serine/threonine kinase, putat... 29 5.0 At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ... 29 5.0 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 29 5.0 At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative si... 29 5.0 At1g27090.1 68414.m03302 glycine-rich protein 29 5.0 At1g13920.1 68414.m01633 remorin family protein contains Pfam do... 29 5.0 At5g65410.1 68418.m08226 zinc finger homeobox family protein / Z... 29 6.6 At5g52470.1 68418.m06510 fibrillarin 1 (FBR1) (FIB1) (SKIP7) ide... 29 6.6 At5g26070.1 68418.m03102 hydroxyproline-rich glycoprotein family... 29 6.6 At5g10060.1 68418.m01165 expressed protein 29 6.6 At5g07150.1 68418.m00815 leucine-rich repeat family protein cont... 29 6.6 At4g33520.3 68417.m04762 metal-transporting P-type ATPase, putat... 29 6.6 At4g33520.2 68417.m04761 metal-transporting P-type ATPase, putat... 29 6.6 At4g33520.1 68417.m04760 metal-transporting P-type ATPase, putat... 29 6.6 At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid t... 29 6.6 At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-conta... 29 6.6 At3g55950.1 68416.m06217 protein kinase family protein contains ... 29 6.6 At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, ... 29 6.6 At3g01560.1 68416.m00086 proline-rich family protein contains pr... 29 6.6 At2g35920.1 68415.m04409 helicase domain-containing protein simi... 29 6.6 At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical ... 29 6.6 At1g70470.1 68414.m08108 expressed protein 29 6.6 At1g67035.1 68414.m07623 expressed protein ; expression supporte... 29 6.6 At1g54060.1 68414.m06160 expressed protein similar to 6b-interac... 29 6.6 At1g48410.2 68414.m05409 argonaute protein (AGO1) identical to S... 29 6.6 At1g48410.1 68414.m05408 argonaute protein (AGO1) identical to S... 29 6.6 At1g35880.1 68414.m04457 hypothetical protein 29 6.6 At1g29230.1 68414.m03575 CBL-interacting protein kinase 18 (CIPK... 29 6.6 At1g26110.1 68414.m03186 expressed protein 29 6.6 At1g23050.1 68414.m02880 hydroxyproline-rich glycoprotein family... 29 6.6 At1g20120.1 68414.m02517 family II extracellular lipase, putativ... 29 6.6 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 29 6.6 At1g51580.1 68414.m05806 KH domain-containing protein 24 7.2 At2g47700.1 68415.m05957 zinc finger (C3HC4-type RING finger) fa... 25 7.6 At2g37590.1 68415.m04612 Dof-type zinc finger domain-containing ... 24 7.7 At1g56200.1 68414.m06459 expressed protein 24 8.3 At5g66400.1 68418.m08374 dehydrin (RAB18) nearly identical to SP... 28 8.7 At5g53060.1 68418.m06592 KH domain-containing protein 28 8.7 At5g51300.2 68418.m06360 splicing factor-related contains simila... 28 8.7 At5g51300.1 68418.m06359 splicing factor-related contains simila... 28 8.7 At5g37790.1 68418.m04551 protein kinase family protein contains ... 28 8.7 At5g04290.1 68418.m00422 KOW domain-containing transcription fac... 28 8.7 At5g02500.1 68418.m00183 heat shock cognate 70 kDa protein 1 (HS... 28 8.7 At4g36260.1 68417.m05157 zinc finger protein-related similar to ... 28 8.7 At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containi... 28 8.7 At4g15460.1 68417.m02363 glycine-rich protein 28 8.7 At3g55790.1 68416.m06199 expressed protein predicted protein, Ar... 28 8.7 At3g44950.1 68416.m04843 glycine-rich protein 28 8.7 At3g43520.1 68416.m04614 expressed protein contains Pfam profile... 28 8.7 At3g07195.1 68416.m00858 proline-rich family protein 28 8.7 At3g06780.1 68416.m00805 glycine-rich protein 28 8.7 At2g35640.1 68415.m04371 hydroxyproline-rich glycoprotein family... 28 8.7 At2g35270.1 68415.m04326 DNA-binding protein-related contains Pf... 28 8.7 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 28 8.7 At2g23770.1 68415.m02839 protein kinase family protein / peptido... 28 8.7 At2g18470.1 68415.m02151 protein kinase family protein contains ... 28 8.7 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 28 8.7 At1g48100.1 68414.m05368 glycoside hydrolase family 28 protein /... 28 8.7 At1g36675.1 68414.m04563 glycine-rich protein 28 8.7 At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing ... 28 8.7 At1g11130.1 68414.m01274 leucine-rich repeat family protein / pr... 28 8.7 At1g07310.1 68414.m00778 C2 domain-containing protein contains s... 28 8.7 At2g48160.1 68415.m06031 PWWP domain-containing protein 25 8.7 At3g54220.1 68416.m05993 scarecrow transcription factor, putativ... 23 9.3 At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ... 23 9.9 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 52.0 bits (119), Expect = 6e-07 Identities = 41/172 (23%), Positives = 44/172 (25%), Gaps = 6/172 (3%) Frame = +3 Query: 471 TPXXXGPPPPPXPXXXXPPP------PPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXX 632 TP PPPPP P PPP P PP P P R P + Sbjct: 571 TPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGS 630 Query: 633 XXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXX 812 R P P P P P P Sbjct: 631 TGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKA 690 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 + P PP PPP P PPP P PP + PPP Sbjct: 691 NISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPP 742 Score = 49.6 bits (113), Expect = 3e-06 Identities = 44/181 (24%), Positives = 47/181 (25%), Gaps = 4/181 (2%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXP----PPPPXPPXXPXPXXVRFXXXGGGXRPX 605 PP +P PPPPP P P P PP P P P Sbjct: 489 PPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSPSQPPP 548 Query: 606 XXXXXTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXR 785 + P P P P P P Sbjct: 549 PPPLPSFSNRDPLTTLHQP-INKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPP---- 603 Query: 786 PXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P P P PPPPPPP PPP PP P P A + A PP Sbjct: 604 PPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIP--AAKCAPPPP 661 Query: 966 P 968 P Sbjct: 662 P 662 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/72 (34%), Positives = 26/72 (36%), Gaps = 4/72 (5%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXP----XXXPPR 938 P P G G P PPPPPPP + P PPP PP PP Sbjct: 621 PPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAP--PPPPPPPTSHSGSIRVGPPS 678 Query: 939 APRXAXXPPPAA 974 P PPP A Sbjct: 679 TPPPPPPPPPKA 690 Score = 41.9 bits (94), Expect = 7e-04 Identities = 19/47 (40%), Positives = 21/47 (44%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 PPPPPPP R+ P P PP P PP P P P+A Sbjct: 572 PPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPP-PPSSRSIPSPSA 617 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/47 (36%), Positives = 20/47 (42%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPPPPP + PPP PP P + + PPP Sbjct: 482 PPPPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPP 528 Score = 39.5 bits (88), Expect = 0.004 Identities = 39/160 (24%), Positives = 39/160 (24%), Gaps = 6/160 (3%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXPXGGXXXXXLXXEKXXXXX 277 PP P P P PPP PP PPPPP P P Sbjct: 576 PPPPPPLPSRSIPPPLAQPPPPRPPP--PPPPPPSSRSIPSPSAPPPP---PPPPPSFGS 630 Query: 278 XGGXXXGGAPGPXKPXXXXXXXXXXXXXXXXXXXXXXTXNXXXXGGGGGGGXXPPXXXGA 457 G P P P G PP A Sbjct: 631 TGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKA 690 Query: 458 R--XXPHPXXXGPXPPPXPRXXXPXPPPXP----XPXPXP 559 P P P PP R P PPP P P P P Sbjct: 691 NISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPP 730 Score = 38.7 bits (86), Expect = 0.006 Identities = 37/175 (21%), Positives = 41/175 (23%), Gaps = 7/175 (4%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXXXX 644 P P PPPPP P P PP P P +P Sbjct: 594 PPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPA 653 Query: 645 RAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXX 824 P P P P+ P L Sbjct: 654 AKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRL-- 711 Query: 825 XPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXP-------XXXPPRAPRXAXXPPP 968 PPPPPPP P P PP P PP + + PPP Sbjct: 712 GAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPPLGAKGSNAPPP 766 Score = 35.1 bits (77), Expect = 0.076 Identities = 17/51 (33%), Positives = 19/51 (37%) Frame = +3 Query: 816 LXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 L P PPPPPP + PPP PP +P PPP Sbjct: 480 LLPPPPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPP 530 Score = 34.3 bits (75), Expect = 0.13 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 459 GXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 G P TP PPPP P PP PP P Sbjct: 675 GPPSTPPPPPPPPPKANISNAPKPPAPPPLPP 706 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 10/42 (23%) Frame = +2 Query: 872 PRXPPPXP------PPXPPXXPXPXPPPXPXXG----XAPPP 967 P PPP P PP PP P PPP P G PPP Sbjct: 714 PPPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPP 755 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 4/62 (6%) Frame = +1 Query: 796 GGXGXXPXXXPPXPPPPPPPXX----PXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXP 963 G P PP PPPPPP P PP PP P P Sbjct: 670 GSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPP 729 Query: 964 PP 969 PP Sbjct: 730 PP 731 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXP----PXXPXP 560 PP T PPPPP P P PPP P P P P Sbjct: 698 PPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPP 742 Score = 32.3 bits (70), Expect = 0.53 Identities = 35/160 (21%), Positives = 37/160 (23%), Gaps = 6/160 (3%) Frame = +2 Query: 98 PPXPXPXXXFXXX-PLFXXPPPX--WXPPXXPPPPPXXPXXXPXPXGGXXXXXLXXEKXX 268 PP P P F PL P PP PPPPP P P Sbjct: 546 PPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPP 605 Query: 269 XXXXGGXXXGGAPGPXKPXXXXXXXXXXXXXXXXXXXXXXTXNXXXXGGGGGGGXXPP-- 442 AP P P PP Sbjct: 606 PPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPP 665 Query: 443 -XXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 G+ P P PPP P+ P P P P P Sbjct: 666 TSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPPLP 705 Score = 32.3 bits (70), Expect = 0.53 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXP-----PPPPXPPXXPXPXXVR 572 PP G PPPPP P P PPPP PP +R Sbjct: 624 PPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIR 673 Score = 32.3 bits (70), Expect = 0.53 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PP PPPPP PP P Sbjct: 686 PPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTP 726 Score = 31.9 bits (69), Expect = 0.71 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 9/33 (27%) Frame = +2 Query: 872 PRXPPPXPPPXP---------PXXPXPXPPPXP 943 P PPP PPP P P P P PPP P Sbjct: 501 PSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPP 533 Score = 31.9 bits (69), Expect = 0.71 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPPXXXR 981 P P PPPPPPP P P PP P P PPP R Sbjct: 567 PINKTPPPPPPPPPPLPSRSIPP------------PLAQPPPPRPPPPPPPPPSSR 610 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 8/44 (18%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXP--------XXXXPPPPPXPP 545 PP G PPPPP P PPPPP PP Sbjct: 622 PPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPP 665 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXPXGG 232 PP P P PPP PPPPP P P G Sbjct: 702 PPLPPSSTRLGAPP--PPPPPPLSKTPAPPPPPLSKTPVPPPPPG 744 Score = 29.1 bits (62), Expect = 5.0 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 4/67 (5%) Frame = +2 Query: 488 PXPPPXPRXXXPXPPPXPX-PXPXPXXXXFXXXGGGGXPXXXXXXNXQXXXXXPXXXRXR 664 P PPP P P PPP P P P G P P R R Sbjct: 715 PPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPPLGAKGSNAPPPPPPAGRGR 774 Query: 665 ---GXGR 676 G GR Sbjct: 775 ASLGLGR 781 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 48.8 bits (111), Expect = 6e-06 Identities = 46/180 (25%), Positives = 48/180 (26%), Gaps = 2/180 (1%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGG--GXGXXXRGXXPXP 797 AGG A G GG G GG GGG GGGGGG G G G Sbjct: 332 AGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGG 391 Query: 796 PAXGRXXRGXXXXXXXXXXXXGPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVX 617 + G G G G G G + Sbjct: 392 ASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGA 451 Query: 616 XXXXXGRXPPPXXXKRTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G G G G GGG G GG GG GV G GG Sbjct: 452 VGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGG 511 Score = 44.4 bits (100), Expect = 1e-04 Identities = 47/181 (25%), Positives = 49/181 (27%), Gaps = 2/181 (1%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPP 794 + G G A GA GG G GG GGG GGG GG G G Sbjct: 46 SVGVGAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASG-GAGGG 104 Query: 793 AXGRXXRGXXXXXXXXXXXXGPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXX 614 GR +G G G G G G A A Sbjct: 105 GKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGA-IGGGASGGVGGGGKGR 163 Query: 613 XXXXGRXPPPXXXKRTXXGXGXXGGXGGGGGXXXXGXG--GGGGPXXXGVXGXPXPXXXG 440 G G G G G GGG G G G GG G G G Sbjct: 164 GGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAG 223 Query: 439 G 437 G Sbjct: 224 G 224 Score = 42.3 bits (95), Expect = 5e-04 Identities = 42/162 (25%), Positives = 44/162 (27%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPP 794 A GGG R GG G GG G G G + GGG GG G G Sbjct: 101 AGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGV-GGG 159 Query: 793 AXGRXXRGXXXXXXXXXXXXGPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXX 614 GR + G G G G G A Sbjct: 160 GKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGT 219 Query: 613 XXXXGRXPPPXXXKRTXXGXGXXGGXGGGGGXXXXGXGGGGG 488 GR G G GG GG GG G G G G Sbjct: 220 VGAGGR-----GSGGASGGVGVGGGAGGSGGGSVGGGGRGSG 256 Score = 41.9 bits (94), Expect = 7e-04 Identities = 46/176 (26%), Positives = 46/176 (26%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPPAXG 785 G GA GG G G GGG G GGG GGG G G G Sbjct: 45 GSVGVGAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGG 104 Query: 784 RXXRGXXXXXXXXXXXXGPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXXXXX 605 RG G G G G G A A V Sbjct: 105 GKGRGRKGGGGAGGGVGGGVGAGGG---AGGSVGAGGGIGGGAGGAIGGGASGGV-GGGG 160 Query: 604 XGRXPPPXXXKRTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 GR G G G G GG G G GG G G GG Sbjct: 161 KGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGG 216 Score = 41.5 bits (93), Expect = 9e-04 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G G GG GGG GGG G Sbjct: 471 GGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGG 502 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 AGG A G GG G GG GG GGGGGG G RG Sbjct: 264 AGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRG 316 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGA G GGG G G GG GGG GGG G Sbjct: 330 GGAGGSVGAGGGVGGGVGGGVGGGVGGGVGG 360 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 G G G GGG G G GG GGG GGG RG Sbjct: 483 GVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRG 514 Score = 39.9 bits (89), Expect = 0.003 Identities = 41/170 (24%), Positives = 44/170 (25%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPP 794 + GGG GA GG G GG GG G G GGG G G Sbjct: 309 SVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGG 368 Query: 793 AXGRXXRGXXXXXXXXXXXXGPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXX 614 A G G G G G G + A + Sbjct: 369 AVG--GGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGG 426 Query: 613 XXXXGRXPPPXXXKRTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G G GGGGG G G G G G G Sbjct: 427 GVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGG 476 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/53 (45%), Positives = 24/53 (45%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 AGGG GA GG G GG GGG G GGG GGG G RG Sbjct: 470 AGGGTGGSVGAGGGVGVGGGGGIGGGAGGG--------VGGGVGGGVGGGVRG 514 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 G G G GGG G G GG GGG GGG G Sbjct: 479 GAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGG 510 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 AGGG G GG G GG GGG G GG GGG G RG Sbjct: 480 AGGGVGV--GGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRG 530 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGA G GGG G G GG GGG GG G Sbjct: 262 GGAGGNVGAGGGLGGGVGGGVGGGVGGSVGG 292 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG + GA GG G GG GGG G R GG GG G Sbjct: 284 GGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASG 330 Score = 37.5 bits (83), Expect = 0.014 Identities = 41/168 (24%), Positives = 42/168 (25%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPPAX 788 G G G GG G GG G G + GGG GGG G G A Sbjct: 75 GSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGG---GVGAGGGAG 131 Query: 787 GRXXRGXXXXXXXXXXXXGPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXXXX 608 G G G G G G A Sbjct: 132 GSVGAGGGIGGGAGGAIGGGASGGVGGGGKGR-GGKSGGGAGGGVGGGVGAGGGAGGSVG 190 Query: 607 XXGRXPPPXXXKRTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G G G GGGG G G GG GV G Sbjct: 191 AGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGG 238 Score = 37.1 bits (82), Expect = 0.019 Identities = 42/167 (25%), Positives = 42/167 (25%), Gaps = 1/167 (0%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGG-GGGGXGXXXRGXXPXPP 794 A GG GA GG G GG GGG GG GGGG G G Sbjct: 260 ASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGG 319 Query: 793 AXGRXXRGXXXXXXXXXXXXGPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXX 614 A G G G G G G A Sbjct: 320 ASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVG 379 Query: 613 XXXXGRXPPPXXXKRTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G G G GG GG G GG GG G Sbjct: 380 GGGRGSGGASGGASGGASG-GASGGASGGASGGVGGAGGAGGSVGAG 425 Score = 35.9 bits (79), Expect = 0.043 Identities = 44/179 (24%), Positives = 45/179 (25%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPP 794 A GGG G G G GG GG G G GGG G G Sbjct: 301 AVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGG 360 Query: 793 AXGRXXRGXXXXXXXXXXXXGPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXX 614 A G G G G G G + A V Sbjct: 361 AVGGAVGGAVGGGGGGSVGGG------GRGSGGASGGASGGASGGASGGASGGASGGVGG 414 Query: 613 XXXXGRXPPPXXXKRTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G G GG GG G G GGGG G G GG Sbjct: 415 AGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGG 473 Score = 35.9 bits (79), Expect = 0.043 Identities = 44/178 (24%), Positives = 45/178 (25%), Gaps = 1/178 (0%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPPAX 788 GG GA GG G GG GGG G R GG GG G + Sbjct: 352 GGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGA-SGGASGGASGGASGGASGGASG 410 Query: 787 GRXXRGXXXXXXXXXXXXGPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXXXX 608 G G G G G G Sbjct: 411 GVGGAGGAGGSVGAGGGVGGGV--GGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSG 468 Query: 607 XXGRXPPPXXXKRTXXGXGXXGGXGGG-GGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G G GG GGG GG G GGG G G G GG Sbjct: 469 GAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGG 526 Score = 35.1 bits (77), Expect = 0.076 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG GA GG G GG GGG GG G G G Sbjct: 487 GGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGG 533 Score = 34.7 bits (76), Expect = 0.10 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGG--GXXXGXARXXXXXXGGGGGGGXGXXXRG 812 A GGG G G G GG GG G G GGG GGG G G Sbjct: 451 AVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGG 506 Score = 34.7 bits (76), Expect = 0.10 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGG-GGGGGXGXXXRG 812 A GG G GG G GG GG G R GG G GGG G G Sbjct: 496 AGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAGGGVGG 550 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = -1 Query: 963 GGAXPXXGXGG--GXGXGXXGGXGGGXGGGXRG 871 GG G GG G G G GG GGG GGG G Sbjct: 256 GGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGG 288 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXX--GGXGGGXXXGXARXXXXXXGGGGGGGXGXXXR 815 GG GA GG G GG GGG G GGG GG G R Sbjct: 525 GGAGRGSGGASGGAGAGGGAGGGVGGGANVGVGVGAGGSTGGGAAGGGGVGNR 577 Score = 33.5 bits (73), Expect = 0.23 Identities = 41/181 (22%), Positives = 44/181 (24%), Gaps = 2/181 (1%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPP 794 + GGG GA GG G GG GG G + G GG GG G Sbjct: 377 SVGGGGRGSGGASGGASGGASGGASGGASGGAS------GGVGGAGGAGGSVGAGGGVGG 430 Query: 793 AXGRXXRGXXXXXXXXXXXXGPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXX 614 G G G G G + Sbjct: 431 GVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGG 490 Query: 613 XXXXGRXPPPXXXKRTXXGXGXXGGXGG--GGGXXXXGXGGGGGPXXXGVXGXPXPXXXG 440 G G G G GG GGG G G GG G G G Sbjct: 491 GIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAGGGVGG 550 Query: 439 G 437 G Sbjct: 551 G 551 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXX-GGXGGGXXXGXARXXXXXXGGGGGGG 833 G G GA GG G GG GGG G R GG GG Sbjct: 221 GAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGG 266 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G G G G G GGG GGG G Sbjct: 249 GGGGRGSGGVGASGGAGGNVGAGGGLGGGVGG 280 Score = 32.7 bits (71), Expect = 0.40 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG G RG G GG GG G GGG GGG G G Sbjct: 244 GGGSVGGGGRGSGGVGASGGAGGNVGAGGG--LGGGVGGGVGGGVGGSVGG 292 Score = 32.3 bits (70), Expect = 0.53 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GG GG GG GG G + K G G GG Sbjct: 78 GVGAGGGVGGGAGGAIGGGASGGAGGG-GKGRGRKGGGGAGG 118 Score = 31.9 bits (69), Expect = 0.71 Identities = 46/182 (25%), Positives = 46/182 (25%), Gaps = 5/182 (2%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXG-GGGG-GGXGXXXRGXXPXPP 794 G G GA GG GG G G G G GGG GG G G Sbjct: 204 GAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGG 263 Query: 793 AXGRXXRGXXXXXXXXXXXXGPPPPPXGXXXXGXPXGP--GXPXAPXAPXARXXXXXLXV 620 A G G G G G G G R Sbjct: 264 AGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGG 323 Query: 619 XXXXXXGRXPPPXXXKRTXXGXGXXGGXGGG-GGXXXXGXGGGGGPXXXGVXGXPXPXXX 443 G G G GG GGG GG G GG G G G Sbjct: 324 ASGGASG-----GAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSV 378 Query: 442 GG 437 GG Sbjct: 379 GG 380 Score = 31.5 bits (68), Expect = 0.93 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = -3 Query: 973 AAGG-GXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 A+GG G G GG G G GG GGG GGG G G Sbjct: 230 ASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGG 284 Score = 31.5 bits (68), Expect = 0.93 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGA G GGG G G G G G GG G Sbjct: 536 GGAGAGGGAGGGVGGGANVGVGVGAGGSTGG 566 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 G G G GGG G G GG GGG G Sbjct: 539 GAGGGAGGGVGGGANVGVGVGAGGSTGGGAAG 570 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGG---GXXXXGXXQXXKXGXGXGG 97 G G G GG GG GG GG G G + K G G GG Sbjct: 129 GAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGG 173 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 216 GXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGG G GGG G G G GG Sbjct: 173 GGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGG 212 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = -3 Query: 973 AAGGGXXAXRGARG-GXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 A+GGG G RG G G G GG G G GG G G Sbjct: 213 ASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASG 262 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -1 Query: 222 GXGXXXGXXG-GGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G G G GG GG GGG G G G GG Sbjct: 215 GGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGG 257 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 A GGG GG G G G G G G GG G G G Sbjct: 519 AVGGGVGGAGRGSGGASGGAGAGGGAGGGVGGGANVGVGVGAGGSTGGGAAGGG 572 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = -3 Query: 574 KRTXXGXGXXGGXGGGGGXXXXGXG-GGGGPXXXGVXGXPXPXXXGG 437 +R G G G G GG G G GGGG G+ G GG Sbjct: 38 RRHKHGRGSVGVGAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGG 84 Score = 29.1 bits (62), Expect = 5.0 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -1 Query: 552 GXGXGXGGGX-GXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G GGG G G GGG G G G A GG Sbjct: 48 GVGAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGG 87 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGG GG G G G G GG Sbjct: 54 GGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGG 95 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G G GG G G GG G G A GG Sbjct: 82 GGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGG 122 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -1 Query: 216 GXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G GGGG G G G G G G GG Sbjct: 190 GAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGG 229 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 G G G G GGG GG G G G G G Sbjct: 233 GVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGG 273 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGG GG GGG G G G GG Sbjct: 43 GRGSVGVGAGAGGGASGGIGVGGGGGGGGGI-GGSGGVGAGG 83 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 + GGG G G G GGG G GG GG G G Sbjct: 247 SVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGG 300 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G GG G RG GG G G + GG Sbjct: 367 GGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGG 407 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXR 874 GGGA G G G G GG GG G G R Sbjct: 549 GGGANVGVGVGAGGSTG--GGAAGGGGVGNR 577 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 48.8 bits (111), Expect = 6e-06 Identities = 18/32 (56%), Positives = 19/32 (59%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP PPP PP P P PPP P +PPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPP 415 Score = 48.4 bits (110), Expect = 8e-06 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP PPP PP P P PPP P PPP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 46.4 bits (105), Expect = 3e-05 Identities = 17/32 (53%), Positives = 18/32 (56%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P +P PPPPP P PPPPP PP P P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/56 (39%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 804 GXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXP-XXXPPRAPRXAXXPPP 968 G P P PPPPPPP P PPP P P PP +P PPP Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPP 428 Score = 45.6 bits (103), Expect = 5e-05 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP PPP PP P P PPP PPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 Score = 44.8 bits (101), Expect = 9e-05 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +3 Query: 453 GXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 G P P PPPPP P PPPPP PP P Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPPPPP P PPP P PP P PPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPP 429 Score = 44.8 bits (101), Expect = 9e-05 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPP-XXPXXXPPRAPRXAXXPPPA 971 P P PPPPPPP PPP PP P PP P PPP+ Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPS 439 Score = 44.0 bits (99), Expect = 2e-04 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = +3 Query: 471 TPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 +P PPPPP P PPPPP PP P P Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 41.9 bits (94), Expect = 7e-04 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P PPPPP P PPPPP PP P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYP 411 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 PP P P PPPPP P P PPP PP P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXP----PPXPPXXPXXXPPRAPRXAXXPPPA 971 P P PPPPPPP P P PP PP PP P PPP+ Sbjct: 394 PPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPS 450 Score = 41.5 bits (93), Expect = 9e-04 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P PPPPP P PPPPP P P P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSP 413 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 429 GXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 G PP P P PPPPP P PPPP P P P Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPPP P P PP PP P P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPPP PPPPP PP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYP 426 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPP PP P PPP P PP +P+ P P Sbjct: 413 PPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSP 459 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 107 PXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P F P PPP PP PPPPP P P P Sbjct: 366 PIDCASFGCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP PP PPPP P P P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 Score = 35.9 bits (79), Expect = 0.043 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP P PPPPP P P Sbjct: 417 PPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYP 457 Score = 35.5 bits (78), Expect = 0.057 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P PPPPP P PPPP P P P Sbjct: 397 PPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPP 437 Score = 35.5 bits (78), Expect = 0.057 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPP-XXPXXXPXP 223 PP P P P + PPP P PPPPP P P P Sbjct: 417 PPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSP 459 Score = 35.1 bits (77), Expect = 0.076 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXP 205 PP P P P PPP + P PPPPP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP P PPPP P P P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPP 428 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPP-PXPPXXPXP 560 P P PPPP P PPPP P P P P Sbjct: 427 PPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSP 459 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P PPPP P PPPPP P P Sbjct: 398 PPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPP 438 Score = 32.7 bits (71), Expect = 0.40 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP P PPPPP P P P Sbjct: 398 PPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPP--PYVYPPP 437 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPX-PPXXPXPXXV 569 P PPP P P PPPPP P P P V Sbjct: 411 PSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYV 443 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 4/35 (11%) Frame = +2 Query: 872 PRXPPPX---PPPXPPXX-PXPXPPPXPXXGXAPP 964 P PPP PPP PP P P P P P +PP Sbjct: 426 PPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPP 460 Score = 31.5 bits (68), Expect = 0.93 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPP---PXPXXXXPPPPPXPPXXPXPXXV 569 PP P P PPPP P P P PPP P P V Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYV 433 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 PP P P P PPP P P PPP P P P Sbjct: 394 PPPPPPPPPPPPPPYVYPSPPPPP----PSPPPYVYPPPPP 430 Score = 31.5 bits (68), Expect = 0.93 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXX--PPPPPXXPXXXPXP 223 PP P P + P PPP PP PPPPP P P Sbjct: 401 PPPPPPPYVYPSPP----PPPPSPPPYVYPPPPPPYVYPPPPSP 440 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXP 217 PP P P P PPP PP P PP P P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXP 217 PP P P P PPP P P PPP P P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP 536 PP P +P PPPPP P P PP Sbjct: 428 PPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPP 460 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 881 PPPXPP---PXPPXXPXPXPPPXPXXGXAPPP 967 PPP PP P PP P P P P P P Sbjct: 436 PPPSPPYVYPPPPPSPQPYMYPSPPCNDLPTP 467 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPP----XXPPPPPXXPXXXPXP 223 PP P P P PPP PP PPPPP P P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYP 426 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P P ++ PPP + P P PP P P P Sbjct: 411 PSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSP 451 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +3 Query: 474 PXXXGPPP---PPXPXXXXPPPPPXPPXXPXP 560 P PPP PP P PPPP PP P Sbjct: 415 PPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPP 446 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +2 Query: 872 PRXPPPX--PPPXPP-XXPXPXPPPXPXXGXAPPP 967 P PPP PPP PP P PPP P PPP Sbjct: 417 PPSPPPYVYPPPPPPYVYP---PPPSPPYVYPPPP 448 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP PP PPPP P P Sbjct: 402 PPPPPPYVYPSPPPPPPSPPPYVYPP--PPPPYVYPPPPSPP 441 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 48.0 bits (109), Expect = 1e-05 Identities = 22/55 (40%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXP---PXXPXXXPPRAPRXAXXPPP 968 P+ P PPPPPPP P PPP P P P PP P + PPP Sbjct: 447 PVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPP 501 Score = 48.0 bits (109), Expect = 1e-05 Identities = 22/55 (40%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXP---PXXPXXXPPRAPRXAXXPPP 968 P+ P PPPPPPP P PPP P P P PP P + PPP Sbjct: 462 PVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPP--XXPXXXPPRAPRXAXXPPP 968 P P PPPPPPP P PPP PP P PP P PPP Sbjct: 461 PPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPP 514 Score = 47.2 bits (107), Expect = 2e-05 Identities = 40/168 (23%), Positives = 42/168 (25%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXXXX 644 P P PPPP P PP PP P P + P Sbjct: 401 PLPPPSLPSPPPPAPIFSTPPTLTSPP-PPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPP 459 Query: 645 RAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXX 824 P P P P P P P P+ Sbjct: 460 PPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYS 519 Query: 825 XPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPP P P R P PP PP PP P PPP Sbjct: 520 SPPPPPSPAPTPVYCTR--PPPPPPHSPPPPQFSPPPPEPYYYSSPPP 565 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/53 (37%), Positives = 22/53 (41%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P+ P PPPPPPP P PP P P PP P PPP+ Sbjct: 434 PVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPS 486 Score = 46.8 bits (106), Expect = 2e-05 Identities = 44/183 (24%), Positives = 47/183 (25%), Gaps = 6/183 (3%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXX 617 PP +P PPPPP P PPPPP PP P P Sbjct: 470 PPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAP 529 Query: 618 XTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAG 797 P P P P P P P + Sbjct: 530 TPVYCTRPP----PPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPP----PHSP 581 Query: 798 GXGXXPLXXXPXPP----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP--RXAXX 959 P P PP PPP P PPP PP PP P + Sbjct: 582 PPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSP 641 Query: 960 PPP 968 PPP Sbjct: 642 PPP 644 Score = 45.2 bits (102), Expect = 7e-05 Identities = 42/175 (24%), Positives = 43/175 (24%), Gaps = 7/175 (4%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXXXX 644 P P PPPPP P PPPP PP P P P Sbjct: 431 PPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSP-PPPPPPPPPPPPVYSPPPPSPPP 489 Query: 645 RAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXX 824 P P P P RP P Sbjct: 490 PPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQ 549 Query: 825 XPXPPPPP-------PPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPP P PP + P PP PP P PP P PPP Sbjct: 550 FSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPP-PPIYPYLSPPPPPTPVSSPPP 603 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P PPPPP P PPPPP PP P P Sbjct: 438 PPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPP 478 Score = 43.6 bits (98), Expect = 2e-04 Identities = 43/186 (23%), Positives = 48/186 (25%), Gaps = 9/186 (4%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPP---PPXPPXXPXPXXVRFXXXGGGXRPXX 608 PP P P PPP P PPP PP PP P P + P Sbjct: 432 PPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPP 491 Query: 609 XXXXTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRP 788 + + P P P P P P Sbjct: 492 PPVYSPPPPPPPPPPPPVYSPPPPPVYSSP----PPPPSPAPTPVYCTRPPPPPPHSPPP 547 Query: 789 XAGGXGXXPLXXXPXPPPP---PPPXXXXXXRAXPXXXPP---PXPPXXPXXXPPRAPRX 950 PPPP PPP + P P P PP P PP P Sbjct: 548 PQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVY 607 Query: 951 AXXPPP 968 + PPP Sbjct: 608 SPPPPP 613 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 P PP PPPPPPP P PP PP P P PP Sbjct: 462 PVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPP 513 Score = 43.2 bits (97), Expect = 3e-04 Identities = 40/177 (22%), Positives = 41/177 (23%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXX 617 PP P PPPPP P PPPP PP P P P Sbjct: 453 PPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPP------VYSPPPPPPPPPP 506 Query: 618 XTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAG 797 + P P P P P Sbjct: 507 PPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPP 566 Query: 798 GXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PPPP P P PP P PP P PPP Sbjct: 567 HSSPPPHSPPPPHSPPPP--IYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPP 621 Score = 42.7 bits (96), Expect = 4e-04 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P + P PPP + PP PPPPP P P P Sbjct: 427 PPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPP 468 Score = 41.5 bits (93), Expect = 9e-04 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPX--WXPPXXPPPPPXXPXXXPXP 223 PP P P + P PPP + PP PPPPP P P P Sbjct: 471 PPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPP 514 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PPP P P PPP P PPP Sbjct: 427 PPPSPPPPVYSPPPPPPPPPPVYSPPPPP 455 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP + PP PPPPP P P Sbjct: 442 PPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPP 483 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP PP PPPP P P P Sbjct: 552 PPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPP 593 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P T PP PP P PPPPP PP P Sbjct: 411 PPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSP 451 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP +P PPPPP PPPPP PP P Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSP 466 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPX---WXPPXXPPPPPXXPXXXPXP 223 PP P P + P PPP + PP PPPP P P P Sbjct: 455 PPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPP 499 Score = 35.9 bits (79), Expect = 0.043 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP P PPPPP P P Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPP 467 Score = 35.5 bits (78), Expect = 0.057 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +1 Query: 826 PPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 PP P PPP P PP +PP P P PPP Sbjct: 396 PPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPP 443 Score = 35.1 bits (77), Expect = 0.076 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXP 217 PP P P + P PPP P PPPPP P P Sbjct: 440 PPPPPPPPVYSPPP--PPPPPPPPPVYSPPPPPPPPPPPP 477 Score = 35.1 bits (77), Expect = 0.076 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = +2 Query: 872 PRXPPPX----PPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP PPP PP PPP P +PPP Sbjct: 618 PPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPP 653 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXP 217 P P P F P PPP PP PPP P P Sbjct: 408 PSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPP 447 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PP PP PPPPP P P Sbjct: 428 PPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 469 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXG-PPPPPXPXXXXPPPPPXPPXXPXPXXVRF 575 PP P P PPPPP PPPPP P P V + Sbjct: 633 PPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHY 679 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +2 Query: 872 PRXPPPX--PPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP PPP PP PPP P + PP Sbjct: 609 PPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPP 642 Score = 33.9 bits (74), Expect = 0.17 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPPXXP---PPPPXXPXXXP 217 P P P P++ PPP PP P PPPP P P Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPP 507 Score = 33.9 bits (74), Expect = 0.17 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP P PPPPP P P Sbjct: 484 PPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPP 525 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXP----PPPPXXPXXXP 217 PP P P P PPP + PP P PPPP P P Sbjct: 488 PPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTP 531 Score = 33.9 bits (74), Expect = 0.17 Identities = 38/170 (22%), Positives = 40/170 (23%), Gaps = 4/170 (2%) Frame = +3 Query: 471 TPXXXGPPPPPXPXXXXPP----PPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXX 638 TP PPPP P PP PPP P P P Sbjct: 530 TPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYL 589 Query: 639 XXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPL 818 + P P P P P P P P Sbjct: 590 SPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYS-----PPPPPPVVHYSSPPPP 644 Query: 819 XXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPP P P PP PP +P PPP Sbjct: 645 PVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPP 694 Score = 33.9 bits (74), Expect = 0.17 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P++ PPP P PPPPP P P Sbjct: 592 PPPPTPVSSPPPTPVYSPPPP--PPCIEPPPPPPCIEYSPPP 631 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRF 575 PP P PPPPP PPPPP P P V + Sbjct: 613 PPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYY 658 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRF 575 PP P PPPPP PPPP P P V + Sbjct: 644 PPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHY 689 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXP 217 PP P P P PPP P PPPP P P Sbjct: 454 PPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPP 493 Score = 32.7 bits (71), Expect = 0.40 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 6/58 (10%) Frame = +1 Query: 814 PXXXPPXPP---PPPPPXX---PXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 P PP PP PPPPP P PP +PP P P P P Sbjct: 500 PPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEP 557 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/45 (40%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPP---PPPXXPXXXPXP 223 PP P P P++ PPP PP PP PPP P P P Sbjct: 438 PPPPPPPPP----PVYSPPPPP-PPPPPPPVYSPPPPPPPPPPPP 477 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/46 (39%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPP----PPPXXPXXXPXP 223 PP P P P++ PPP PP PP PPP P P P Sbjct: 451 PPPPPPPPP--PPPVYSPPPPP-PPPPPPPPVYSPPPPSPPPPPPP 493 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXP 217 PP P P P++ PPP PP PPPP P P Sbjct: 482 PPPPSPPPP--PPPVYSPPPP---PPPPPPPPVYSPPPPP 516 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 6/35 (17%) Frame = +2 Query: 881 PPPXP-----PPXPPXXPXPX-PPPXPXXGXAPPP 967 PPP P PP PP P PPP P +PPP Sbjct: 682 PPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPP 716 Score = 31.9 bits (69), Expect = 0.71 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P+F PP PP PPPP P P Sbjct: 403 PPPSLPSPP-PPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPP 443 Score = 31.9 bits (69), Expect = 0.71 Identities = 16/53 (30%), Positives = 18/53 (33%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P+ PPPPP PPP P PP + PPPA Sbjct: 655 PVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPA 707 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 467 PHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 P P P PPP P PPP P P P P Sbjct: 431 PPPPVYSPPPPPPPPPPVYSPPPPP-PPPPP 460 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 3/44 (6%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXGPXPP---PXPRXXXPXPPPXPXPXPXP 559 PP P P P PP P P PPP P P P P Sbjct: 488 PPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTP 531 Score = 31.5 bits (68), Expect = 0.93 Identities = 42/188 (22%), Positives = 44/188 (23%), Gaps = 10/188 (5%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXX-------PPPP--PXPPXXPXPXXVRFXXXGG 590 PP P P PPPPP P PPPP P PP P + Sbjct: 504 PPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYY--S 561 Query: 591 GXRPXXXXXXTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXX 770 P P P P P P Sbjct: 562 SPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPT----PVYSPPPPPPCIE 617 Query: 771 PRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXP-XXXPPPXPPXXPXXXPPRAPR 947 P P P PPPPP P PP PP PP Sbjct: 618 PPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEV 677 Query: 948 XAXXPPPA 971 PPP+ Sbjct: 678 HYHSPPPS 685 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPP P P P Sbjct: 654 PPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPP 694 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPX--PXXXXPPPPPXPPXXPXPXXV 569 PP P +P PPPP P PPP P P P V Sbjct: 674 PPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPPMV 719 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PP PPP P P PP PPP Sbjct: 614 PCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPP 645 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPX-XXXPPPPPXPPXXPXP 560 PP P P PPP P PPPPP P P Sbjct: 663 PPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESP 704 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P PPP P PPPPP P P P Sbjct: 563 PPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPP-TPVSSPPP 603 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 5/34 (14%) Frame = +2 Query: 881 PPPX-----PPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PPP P P PPP +PPP Sbjct: 673 PPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPP 706 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 P P PPPPP PP PP P PPP Sbjct: 583 PPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPP 634 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXX--PPPPPXXPXXXPXP 223 PP P P + P PPP PP PPPP P P Sbjct: 524 PPSPAPTPVYCTRP--PPPPPHSPPPPQFSPPPPEPYYYSSPPP 565 Score = 29.1 bits (62), Expect = 5.0 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 4/56 (7%) Frame = +1 Query: 814 PXXXPPXPPPP---PPPXXPXXXXXXXXXXXXXXXXXXPPX-TPPXPXGGPXXPPP 969 P P PPPP PPP P PP +PP P PPP Sbjct: 538 PPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPP 593 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXP 547 PP P P P P P P PPP P P Sbjct: 410 PPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPP 446 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP + P PP P P P Sbjct: 500 PPPPPPPPPVYSPP----PPPVYSSPPPPPSPAPTPVYCTRP 537 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 45.6 bits (103), Expect = 5e-05 Identities = 20/45 (44%), Positives = 22/45 (48%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 PPPPPP + P PPP PP P PP+ P PPPA Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPP--PSPPPPQLPPPPQLPPPA 104 Score = 45.2 bits (102), Expect = 7e-05 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +2 Query: 416 GGGGGXXPPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 GGG PP P P P PPP P P PPP P P P Sbjct: 39 GGGNDNNPPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPP 86 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P P PPPPP P P PPP PP PP+ P A P Sbjct: 58 PADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKP 108 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/34 (52%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +2 Query: 872 PRXPPPXPPPX--PPXXPXPXPPPXPXXGXAPPP 967 P PPP PPP PP P P PPP P PPP Sbjct: 64 PPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPP 97 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P P PPPP PP + P PPP P P PP P+ PP Sbjct: 64 PPPPPPCPPPPSPPPCPPPP-SPPPSPPPPQLPPPPQLPPPAPPKPQPSPP 113 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P P PPP P PPP P PP P P Sbjct: 66 PPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPP 97 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPP P P PPP PP P P Sbjct: 68 PPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKP 108 Score = 37.1 bits (82), Expect = 0.019 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P P P P PPP P PPP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPP 74 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PP PPP PP P P PP P PPP Sbjct: 74 PSPPPCPPPPSPP--PSPPPPQLPPPPQLPPP 103 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +2 Query: 872 PRXPPPXPPPX--PPXXPXPXPPPXPXXGXAPPPR 970 P PPP PPP PP P P PP P PP+ Sbjct: 73 PPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPK 107 Score = 35.9 bits (79), Expect = 0.043 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPP-PXPPXXPXXXPPRAPRXAXXPP 965 P P P P P P PP P PP P PP +P + PP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPP 92 Score = 35.9 bits (79), Expect = 0.043 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPP-PXPPXXPXP 560 PP P P PPPP P PPP P PP P P Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPP 103 Score = 35.5 bits (78), Expect = 0.057 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P P P P P P PPP +PPP Sbjct: 47 PPSPSPEPEPEPADCPPPPPPPPCPPPPSPPP 78 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP PP PPPP P P P Sbjct: 68 PPCPPPPSPPPCPPP-PSPPPSPPPPQLPPPPQLPPPAPPKP 108 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP PPP P PPP P PP Sbjct: 82 PPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPP 113 Score = 33.5 bits (73), Expect = 0.23 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P PP P P PP P PPP Sbjct: 54 PEPEPADCPPPPPPPPCPPPPSPPPCPPP 82 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPP--PPXPXXXXPPPPPXPPXXPXP 560 PP P +P PPP PP P P PP P P P Sbjct: 73 PPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 32.7 bits (71), Expect = 0.40 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPPXXPP--PPPXXPXXXPXP 223 P P P P PPP PP PP PPP P P P Sbjct: 50 PSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPP 92 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXP 217 PP P P P PP PP PPP P P P Sbjct: 73 PPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSP 112 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P PP PP P P PP P P P Sbjct: 54 PEPEPADCPPPPPPPPCPPPPSPPPCPPPPSP 85 Score = 31.9 bits (69), Expect = 0.71 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP PP PP P P P Sbjct: 77 PPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P PPPP P P P P PP P Sbjct: 87 PSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -3 Query: 499 GGGGPXXXGVXGXPXPXXXGGXXPPPPPPP 410 GGG P P PPPPPPP Sbjct: 39 GGGNDNNPPPSPSPEPEPEPADCPPPPPPP 68 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P P P PPP P PP PP P P Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPP 86 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 PP P P PP P P P P P P P Sbjct: 80 PPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXP-PXXPXXXPPRAPRXAXXPPP 968 P P PPPP P P PPP P P P PP PPP Sbjct: 127 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPP 179 Score = 37.5 bits (83), Expect(2) = 9e-05 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = +3 Query: 414 GGGGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPP-PXPPXXPXP 560 G GGG G P P PPPP P P PP PP P P Sbjct: 57 GDDGGGDDSGGDDGGYTPPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTP 106 Score = 37.1 bits (82), Expect = 0.019 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXP-PXXPXXXPPRAPRXAXXPPP 968 P P PPPP P P PPP P P P PP +P PPP Sbjct: 91 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSP-----PPP 138 Score = 37.1 bits (82), Expect = 0.019 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXP-PXXPXXXPPRAPRXAXXPPP 968 P P PPPP P P PPP P P P PP +P PPP Sbjct: 109 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSP-----PPP 156 Score = 35.9 bits (79), Expect = 0.043 Identities = 22/61 (36%), Positives = 24/61 (39%), Gaps = 2/61 (3%) Frame = +3 Query: 792 AGGXGXXPLXXXPXPP-PPPPPXXXXXXRAXPXXXPPPXP-PXXPXXXPPRAPRXAXXPP 965 +GG P PP PPPP P PPP P P P PP +P PP Sbjct: 65 SGGDDGGYTPPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSP-----PP 119 Query: 966 P 968 P Sbjct: 120 P 120 Score = 35.1 bits (77), Expect = 0.076 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 8/57 (14%) Frame = +3 Query: 414 GGGGGGXXPPXXXG--XGXPXTPXXXGP-----PPPPXPXXXXP-PPPPXPPXXPXP 560 GG GG PP P TP P PPPP P P P PP P P P Sbjct: 66 GGDDGGYTPPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 122 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PPPP P P P P P PP P + PP Sbjct: 145 PSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPP 196 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 P PP PPPP P P PP +PP P P P P Sbjct: 145 PSPTPPVSPPPPTPT-PSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSP 195 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P+ P P PP PPPP P P Sbjct: 155 PPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPP 196 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPP-PXPPXXPXP 560 PP TP PPP P P P PP PP P P Sbjct: 101 PPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTP 142 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPP-PXPPXXPXP 560 PP TP PPP P P P PP PP P P Sbjct: 119 PPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTP 160 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/55 (30%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXPXXXXXXXXXXXXXXXXXX---PPXTPPXPXGGPXXPPP 969 P PP PPPP P P PP +PP P P P P Sbjct: 75 PAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSP 129 Score = 31.5 bits (68), Expect = 0.93 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P +P PPPP P P P P P P P Sbjct: 136 PPPTPTPSVP-SPTPPVSPPPPTPTPSVPSPTPPVPTDPMP 175 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 PP + P P P P P P P PP P P P Sbjct: 137 PPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSP 177 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPP-PPXPPXXPXP 560 PP P +P PPPP P P P PP P P P Sbjct: 100 PPPTPTPSVP-SPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 140 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPP-PPXPPXXPXP 560 PP P +P PPPP P P P PP P P P Sbjct: 118 PPPTPTPSVP-SPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 158 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP TP P P P PPPP P P P V Sbjct: 155 PPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDV 198 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 Query: 471 TPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 +P PPPP P P PP P P P Sbjct: 176 SPPPPVSPPPPTPTPSVPSPPDVTPTPPTP 205 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = +3 Query: 465 PXTPXXXGPPPP-PXPXXXXPP---PPPXPPXXPXPXXV 569 P P PPPP P P PP P P P P P V Sbjct: 175 PSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDV 213 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXP-PPPPXXPXXXPXP 223 P P P P+ PPP PP P P P P P P Sbjct: 160 PSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTP 202 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPP-PXWXPPXXPPPPPXXPXXXPXP 223 PP P P P+ PP P P PP P P P P Sbjct: 137 PPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPP 179 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/54 (29%), Positives = 17/54 (31%), Gaps = 3/54 (5%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPP---XPPXXPXXXPPRAPRXAXXPP 965 P+ P P P P P PPP PP P P P PP Sbjct: 150 PVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPP 203 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 6/42 (14%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPP------PXWXPPXXPPPPPXXP 205 PP P P P+ PP P PP PPPP P Sbjct: 83 PPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTP 124 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 6/42 (14%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPP------PXWXPPXXPPPPPXXP 205 PP P P P+ PP P PP PPPP P Sbjct: 101 PPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTP 142 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 6/42 (14%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPP------PXWXPPXXPPPPPXXP 205 PP P P P+ PP P PP PPPP P Sbjct: 119 PPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTP 160 Score = 28.3 bits (60), Expect = 8.7 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPP-PXPXXXXPPPPPXPPXXPXP 560 PP P TP P PP P PPPP PP P P Sbjct: 149 PPVSPPPPTP-TPSVPSPTPPVPTDPMPSPPPPVSPP-PPTP 188 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +3 Query: 465 PXTPXXXGPPP--PPXPXXXXPPPPPXPPXXPXPXXV 569 P TP PP P P P PP P P P V Sbjct: 202 PPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPSV 238 Score = 26.6 bits (56), Expect(2) = 9e-05 Identities = 19/86 (22%), Positives = 19/86 (22%) Frame = +3 Query: 678 PGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXXXPXPPPPPPPX 857 P P P P P P P P P P PP Sbjct: 111 PTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVP 170 Query: 858 XXXXXRAXPXXXPPPXPPXXPXXXPP 935 P PPP P PP Sbjct: 171 TDPMPSPPPPVSPPPPTPTPSVPSPP 196 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = +3 Query: 816 LXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 L P PPPPPPP + P PPP PP P PPPA Sbjct: 414 LFPPPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPA 465 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPPPP A P PPP P PP A PPP Sbjct: 508 PPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPP 552 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXP-PXXPXXXPPRAPRXAXXPPP 968 PL PPP PP A P PPP P PP PR A PPP Sbjct: 486 PLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPP 538 Score = 39.9 bits (89), Expect = 0.003 Identities = 27/95 (28%), Positives = 28/95 (29%), Gaps = 5/95 (5%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPP-----XXPXPXXVRFXXXGGGXRPXXXXXXTXX 629 P T PPPPP PPPPP PP P P + GG P Sbjct: 543 PGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANG 602 Query: 630 XXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGP 734 A G GP P G GP Sbjct: 603 ATPPPPPPPMAMANGAAGPPPPPPRMGMANGAAGP 637 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 429 GXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 G PP P T PPPPP PPPPP PP Sbjct: 505 GSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPP 543 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPPPPP A P PPP P PP A PPP Sbjct: 517 PTTIAAPPPPPPPPRAAV---APPPPPPPPGTAAAPPPPPPPPGTQAAPPPP 565 Score = 39.1 bits (87), Expect = 0.005 Identities = 42/171 (24%), Positives = 42/171 (24%), Gaps = 11/171 (6%) Frame = +3 Query: 489 PPPPPXPXXXXP-----PPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXXXXRAX 653 PPPPP P P PPPP PP P A Sbjct: 475 PPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAV 534 Query: 654 GAXGAXGXPGPXGXPXXXXPXGGG-GGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXXXP 830 PG P P G P P G G Sbjct: 535 APPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSG------ 588 Query: 831 XPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPR-----XAXXPPP 968 PPPPPPP P PP PP PR A PPP Sbjct: 589 GPPPPPPPMPLANGATPPPPPPPMAMANGAAGPPPPPPRMGMANGAAGPPP 639 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PPP P PPP P APPP Sbjct: 536 PPPPPPPPGTAAAPPPPPPPPGTQAAPPP 564 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 PPPPPPP PPP PP P P + PPA Sbjct: 454 PPPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPA 499 Score = 36.3 bits (80), Expect = 0.033 Identities = 42/180 (23%), Positives = 44/180 (24%), Gaps = 3/180 (1%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXX 617 PP P PP PP PPP PP P P + P Sbjct: 424 PPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPPLPPA 483 Query: 618 XTXXXXXXXRAXGAXGAXGXPG--PXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPX 791 G P P P P P P Sbjct: 484 VMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPP 543 Query: 792 AGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXP-PRAPRXAXXPPP 968 G P PPPPPPP A P PPP P P P + PPP Sbjct: 544 --GTAAAP------PPPPPPP---GTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPP 592 Score = 36.3 bits (80), Expect = 0.033 Identities = 21/69 (30%), Positives = 21/69 (30%) Frame = -3 Query: 487 PXXXGVXGXPXPXXXGGXXPPPPPPPXXXXVXCXXXXXXXXXXXXXXXXXXXXPXGFXGX 308 P V P P G PPPPPP P G G Sbjct: 529 PPRAAVAPPPPPPPPGTAAAPPPPPPPPG-TQAAPPPPPPPPMQNRAPSPPPMPMGNSGS 587 Query: 307 GGPPXPXPP 281 GGPP P PP Sbjct: 588 GGPPPPPPP 596 Score = 35.9 bits (79), Expect = 0.043 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXP--XPXPXXXXFXXXGGGGXP 601 PP G P P P PPP + P PPP P P P G GG P Sbjct: 539 PPPPPGTAAAPPP----PPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPP 591 Score = 35.1 bits (77), Expect = 0.076 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 835 PPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 PPPPPPP PP PP P PPP Sbjct: 523 PPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPP 567 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 P PPPPPPP PP PP P PPP Sbjct: 556 PGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPP 607 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P PPP P + P PPP PP AP PPA Sbjct: 436 PLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPPLPPA 483 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/69 (28%), Positives = 21/69 (30%), Gaps = 4/69 (5%) Frame = +2 Query: 773 PGXXPXRGGGGXXPPXXXXXXXXXXXXXXXXXXPRXPPPXPPPXPPXXPXPXPPPXP--- 943 P P R PP + PP PPP P P PPP P Sbjct: 525 PPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGN 584 Query: 944 -XXGXAPPP 967 G PPP Sbjct: 585 SGSGGPPPP 593 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 829 PXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 P PPPPPP PP PP P PPP Sbjct: 508 PPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPP 554 Score = 33.1 bits (72), Expect = 0.31 Identities = 21/75 (28%), Positives = 21/75 (28%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXPXGGXXXXXLXXEKXXXXX 277 PP P P P PPP PPPPP P P Sbjct: 523 PPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQN-RAPSPPPMP 581 Query: 278 XGGXXXGGAPGPXKP 322 G GG P P P Sbjct: 582 MGNSGSGGPPPPPPP 596 Score = 31.9 bits (69), Expect = 0.71 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP PPPPP P P Sbjct: 510 PPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPP 551 Score = 31.9 bits (69), Expect = 0.71 Identities = 29/110 (26%), Positives = 29/110 (26%), Gaps = 3/110 (2%) Frame = -3 Query: 730 PPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXXXXXXGRXPPPXXXKRTXXGXG 551 PPPPP P P P AP PPP R Sbjct: 524 PPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPP----PPPPMQNRAPSPPP 579 Query: 550 XXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXG---GXXPPPPPPP 410 G G GG P G P P G PPPPPP Sbjct: 580 MPMGNSGSGGPPPPPPPM---PLANGATPPPPPPPMAMANGAAGPPPPPP 626 Score = 31.9 bits (69), Expect = 0.71 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 7/49 (14%) Frame = +3 Query: 411 GGGGGGGXXPPXXXGXGXPXTPXXXG--PPPPPXPXXXX-----PPPPP 536 G G GG PP P P G PPPPP P PPPPP Sbjct: 583 GNSGSGGPPPPP------PPMPLANGATPPPPPPPMAMANGAAGPPPPP 625 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 6/46 (13%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPP------XXPPPPPXXPXXXP 217 PP P P F PPP PP PPPP P P Sbjct: 457 PPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKP 502 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 467 PHPXXXGPXPPPXPRXXXPXPPPXPXP 547 P P PPP P PPP P P Sbjct: 530 PRAAVAPPPPPPPPGTAAAPPPPPPPP 556 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/47 (46%), Positives = 24/47 (51%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG + GA GG G GG GGG G + GGGGGGG G Sbjct: 174 GGGGGSAGGAHGGSGYG--GGEGGGAGGGGSHGGAGGYGGGGGGGSG 218 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G G GG GGG GGG G Sbjct: 230 GGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGG 261 Score = 39.9 bits (89), Expect = 0.003 Identities = 42/179 (23%), Positives = 44/179 (24%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPP 794 A+GGG G GG G GG GG G + GGG GG G G Sbjct: 33 ASGGGGHGGGGGSGGVSSGGYGGESGGGYGGGS---GEGAGGGYGGAEGYASGGGSGHGG 89 Query: 793 AXGRXXRGXXXXXXXXXXXXGPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXX 614 G G G G G G Sbjct: 90 GGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGA 149 Query: 613 XXXXGRXPPPXXXKRTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G G GG GGG G G GG G G GG Sbjct: 150 GEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGG 208 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 A GGG G GG G GG GG G A GGG GGG G G Sbjct: 197 AGGGGSHGGAGGYGGGGGGGSGG-GGAYGGGGAHGGGYGSGGGEGGGYGGGAAG 249 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/49 (46%), Positives = 24/49 (48%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 + GGG GA GG G GG GGG G A GGGGGGG G Sbjct: 217 SGGGGAYGGGGAHGGGY-GSGGGEGGGYGGGAA----GGYGGGGGGGEG 260 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG GA GG G GG GGG G G GGGGG G Sbjct: 240 GGGYGG--GAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHG 284 Score = 37.5 bits (83), Expect = 0.014 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXG--GXGGGXXXGXARXXXXXXGGGGGGGXG 827 A GGG + G GG G G G GGG G GGG GGG G Sbjct: 228 AHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHG 278 Score = 37.1 bits (82), Expect = 0.019 Identities = 43/182 (23%), Positives = 43/182 (23%), Gaps = 4/182 (2%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPPA 791 AGGG G G G GG GG G GGGG GG G Sbjct: 69 AGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSG 128 Query: 790 XGRXXR----GXXXXXXXXXXXXGPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLX 623 G G G G G G A Sbjct: 129 GGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSG 188 Query: 622 VXXXXXXGRXPPPXXXKRTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXX 443 G G G GG GGGG G GGG G G Sbjct: 189 YGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAA 248 Query: 442 GG 437 GG Sbjct: 249 GG 250 Score = 36.3 bits (80), Expect = 0.033 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXG-GGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 A GGG G GG G GG G GG G A G GG GG G G Sbjct: 164 AYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSG 218 Score = 36.3 bits (80), Expect = 0.033 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXP 797 G G G GG G GG GGG G + G GGG G G G P Sbjct: 234 GSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGGGGYAP 290 Score = 36.3 bits (80), Expect = 0.033 Identities = 21/59 (35%), Positives = 22/59 (37%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPP 794 +GGG G GG G GG GGG G GG GGG G G P Sbjct: 235 SGGGEG---GGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGGGGYAP 290 Score = 35.5 bits (78), Expect = 0.057 Identities = 44/172 (25%), Positives = 46/172 (26%), Gaps = 7/172 (4%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGG---GGXGXXXRGXXPXP 797 GGG + G G G GG GG G A GGGGG G G G Sbjct: 91 GGGAASSGGYASGAGEGGGGGYGGAAG-GHAGGGGGGSGGGGGSAYGAGGEHASGYGNGA 149 Query: 796 P---AXGRXXRGXXXXXXXXXXXXGPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXL 626 G G G G G G G + Sbjct: 150 GEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGY 209 Query: 625 XVXXXXXXGRXPPPXXXKRTXXGXGXXGGXGGG-GGXXXXGXGGGGGPXXXG 473 G G G GG GGG GG G GGGGG G Sbjct: 210 GGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGG 261 Score = 33.9 bits (74), Expect = 0.17 Identities = 43/178 (24%), Positives = 44/178 (24%), Gaps = 8/178 (4%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXX----GXARXXXXXXGGGGGGGXGXXXRGXX 806 A GG GA GG G GG GGG G G G GGG G G Sbjct: 104 AGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGG 163 Query: 805 PXPPAXGRXXRGXXXXXXXXXXXXG----PPPPPXGXXXXGXPXGPGXPXAPXAPXARXX 638 G G G G G G G + Sbjct: 164 AYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAY 223 Query: 637 XXXLXVXXXXXXGRXPPPXXXKRTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G G GG G GGG G GGG G G Sbjct: 224 GGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGG 281 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 G G G GG G G GG G G GGG G Sbjct: 44 GSGGVSSGGYGGESGGGYGGGSGEGAGGGYGG 75 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGGA G G G G GG GG GG G Sbjct: 91 GGGAASSGGYASGAGEGGGGGYGGAAGGHAGG 122 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G GGGG GG GGG G G G GG Sbjct: 204 GGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGG 245 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG+ G G G G G G G GGG G Sbjct: 62 GGGSGEGAGGGYGGAEGYASGGGSGHGGGGGG 93 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGG GG GG G G G GG Sbjct: 214 GGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGG 255 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 216 GXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G GGGG GG GGG G G GG Sbjct: 211 GGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGG 250 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGG G GGG G + G G GG Sbjct: 234 GSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGG 275 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 552 GXGXGXGGGXGXXXRGXGGGXGPXXXGXG 466 G G G GGG G G GG G G G Sbjct: 103 GAGEGGGGGYGGAAGGHAGGGGGGSGGGG 131 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = -3 Query: 559 GXGXXGGX-GGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G GG GGGGG GG GG G G GG Sbjct: 31 GQASGGGGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGG 72 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G G GG G G GGG G G G GG Sbjct: 192 GEGGGAGGGGSHGGAG-GYGGGGGGGSGGGGAYGGGGAHGG 231 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 43.6 bits (98), Expect = 2e-04 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXP 943 P+ PPP PPP PP P P PPP P Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPP 62 Score = 41.5 bits (93), Expect = 9e-04 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 6/35 (17%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXP------XXGXAPPP 967 PPP PPP PP P P PPP P G PPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPP 78 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGG 590 P P PPPPP P PPPPP PP P P V G Sbjct: 36 PLFPQSPPPPPPPPP----PPPPPPPPPPPPPPAVNMSVETG 73 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P P PPPPPPP + PPP PP P +P PP Sbjct: 48 PPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPP 98 Score = 40.7 bits (91), Expect = 0.002 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXP 943 PPP PPP PP P P PPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPP 63 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 137 PLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PLF PP PP PPPPP P P P Sbjct: 36 PLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 37.5 bits (83), Expect = 0.014 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P PPP PP P P PPP P PPP Sbjct: 36 PLFPQSPPPPPPPPPPPPPPPPPP---PPPPP 64 Score = 36.3 bits (80), Expect = 0.033 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PP P PP P P PPP P PPP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPP 63 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXP-XXXPPRAPRXAXXPPP 968 P P PPPPPP P PP P PP P PPP Sbjct: 52 PPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPPP 104 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPP--XXPXXXPPRAPRXAXXPPP 968 PPPPPP + P PPP PP P PP+ PPP Sbjct: 75 PPPPPPVTDMIKPLSSP---PPPQPPPRSQPPPKPPQKNLPRRHPPP 118 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP 536 PP P P PPPPP P PPPPP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPP---PPPPPP 64 Score = 33.1 bits (72), Expect = 0.31 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 495 PPPXPXXXXPPPPPXPPXXPXP 560 PP P PPPPP PP P P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPP 56 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 6/58 (10%) Frame = +1 Query: 814 PXXXPPXPP-PPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPP-----XPXGGPXXPPP 969 P PP PP PPPPP P PP PP P P P P Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQP 96 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPPPP P PPP PP P PPP Sbjct: 42 PPPPPPP---------PPPPPPPPPPPPPPPPAVNMSVETGIPPP 77 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 125 FXXXPLFXXPPPXWXPPXXPPPPPXXP 205 F P PPP PP PPPPP P Sbjct: 38 FPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 PPPPP + P PPP P PR PP Sbjct: 76 PPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPPQKNLPRRHPPPP 119 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +3 Query: 489 PPPPPXPXXXXP---PPPPXPPXXPXP 560 PPPPP P PPPP PP P Sbjct: 76 PPPPPVTDMIKPLSSPPPPQPPPRSQP 102 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 74 NLXXXXXXPPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPP 196 N+ PP P P PL PPP P PPP P Sbjct: 67 NMSVETGIPPPPPPVTDMIK-PLSSPPPPQPPPRSQPPPKP 106 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P P PPPPPPP P Sbjct: 35 PPLFPQSPPPPPPPPPP 51 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPX-PXXGXAPPPR 970 PPP PP P PPP P PPP+ Sbjct: 75 PPPPPPVTDMIKPLSSPPPPQPPPRSQPPPK 105 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 894 PPPXPPXXPXXXPPRAPRXAXXPPPA 971 PPP PP P PP P PPPA Sbjct: 42 PPPPPP--PPPPPPPPPPPPPPPPPA 65 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +2 Query: 872 PRXPPPX--PPPXPPXXPXPXPPPXPXXGXAPPPR 970 P PPP PPP PP P P P P R Sbjct: 93 PPQPPPRSQPPPKPPQKNLPRRHPPPPRSPEKPKR 127 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 3/33 (9%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXP---PPPPXPPXXP 554 P P PPP P P PPPP P P Sbjct: 93 PPQPPPRSQPPPKPPQKNLPRRHPPPPRSPEKP 125 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP--RXAXXPPP 968 P PPP PP RA P PPP PP P P P R PPP Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPPPPPPPPPPPRLGPRLRLRLLPPP 56 Score = 35.5 bits (78), Expect = 0.057 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 P PP PPP PP P P P PPPR Sbjct: 25 PPPQPPPPPPPPPPPPPPRLGPRLRLRLLPPPR 57 Score = 33.5 bits (73), Expect = 0.23 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXP 554 PPP P P PPPPP P P Sbjct: 25 PPPQPPPPPPPPPPPPPPRLGP 46 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXP 217 P P P PPP PP PPPPP P P Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPPPPPPPPPPPRLGP 46 Score = 33.1 bits (72), Expect = 0.31 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 495 PPPXPXXXXPPPPPXPPXXPXP 560 PPP P PPPPP PP P Sbjct: 25 PPPQPPPPPPPPPPPPPPRLGP 46 Score = 32.7 bits (71), Expect = 0.40 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P PP PPPPPPP P Sbjct: 25 PPPQPPPPPPPPPPPPP 41 Score = 32.7 bits (71), Expect = 0.40 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P PP PPPPPPP P Sbjct: 26 PPQPPPPPPPPPPPPPP 42 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPP 902 P P PPPPPPP R PPP Sbjct: 27 PQPPPPPPPPPPPPPPRLGPRLRLRLLPPP 56 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 8/36 (22%) Frame = +3 Query: 489 PPPPPXPXXXX--------PPPPPXPPXXPXPXXVR 572 PPPPP P P PPP PP P P R Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPPPPPPPPPPPR 43 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 8/36 (22%) Frame = +2 Query: 887 PXPPPXPPXX--------PXPXPPPXPXXGXAPPPR 970 P PPP PP P PPP P PPPR Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPPPPPPPPPPPR 43 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 787 RARGGXGXXPXXXPPXPPPPPPPXXP 864 R R P PP PPPPPP P Sbjct: 21 RQRAPPPQPPPPPPPPPPPPPPRLGP 46 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 170 PPXXPPPPPXXPXXXPXPXGG 232 PP PPPPP P P P G Sbjct: 25 PPPQPPPPPPPPPPPPPPRLG 45 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPP 536 P PPPPP P PPPPP Sbjct: 25 PPPQPPPPPPPP---PPPPPP 42 Score = 26.6 bits (56), Expect(2) = 0.54 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -1 Query: 459 RAPXXXGGXXPPPPPPP 409 RAP PPPPPPP Sbjct: 23 RAPPPQPPPPPPPPPPP 39 Score = 24.2 bits (50), Expect(2) = 0.54 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 429 PPPPPPPXXXL 397 PPPPPPP L Sbjct: 34 PPPPPPPPPRL 44 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 43.2 bits (97), Expect = 3e-04 Identities = 43/181 (23%), Positives = 43/181 (23%), Gaps = 5/181 (2%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXX 617 PP P P PPPPP P PPPPP P P P Sbjct: 501 PPPPSPIHSPPPPPVYSPPPPP-PVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSP 559 Query: 618 XTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAG 797 P P P P P P Sbjct: 560 PPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPP 619 Query: 798 GXGXXPLXXXPXPPPP---PPPXXXXXXRAXPXXXPPP--XPPXXPXXXPPRAPRXAXXP 962 P PPPP PPP PPP PP P PP P P Sbjct: 620 PPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSP 679 Query: 963 P 965 P Sbjct: 680 P 680 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = +3 Query: 813 PLXXXPXPP---PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P+ P PP PPPPP P PPP PP P +P PP Sbjct: 506 PIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPP 560 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/50 (40%), Positives = 21/50 (42%), Gaps = 3/50 (6%) Frame = +3 Query: 828 PXPPP---PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPP PPPP P PPP PP PP P + PPP Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPP--PVYSPPPPP 540 Score = 36.7 bits (81), Expect = 0.025 Identities = 41/173 (23%), Positives = 42/173 (24%), Gaps = 8/173 (4%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPP----PXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXXX 641 P PPPP P PPPP P PP P P Sbjct: 495 PPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPP 554 Query: 642 XRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXR-PXAGGXGXXPL 818 P P P P P P P P Sbjct: 555 PVHSPPPPVHSPPPPVHSPPP--PVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPP 612 Query: 819 XXXPXPPPP---PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPP PPP PP P P PP P + PPP Sbjct: 613 VYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPP 665 Score = 36.7 bits (81), Expect = 0.025 Identities = 45/186 (24%), Positives = 45/186 (24%), Gaps = 9/186 (4%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPP---PXPXXXXPPPP---PXPPXXPXPXXVRFXXXGGGXR 599 PP P P PPPP P P PPPP P PP P V Sbjct: 528 PPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSP 587 Query: 600 PXXXXXXTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRX 779 P P P P P P P Sbjct: 588 PPPPVHSPPPPVHSPPPP----VHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPV 643 Query: 780 XRPXAGGXGXXPLXXXPXPPP---PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRX 950 P P P PPP PPPP P PP PPR P Sbjct: 644 YSPP-------PPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTPV-NSPPPRTPSQ 695 Query: 951 AXXPPP 968 PP Sbjct: 696 TVEAPP 701 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P PP P PPP P PPP Sbjct: 502 PPPSPIHSPPPPPVYSPPPPPPVYSPPPP 530 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +2 Query: 875 RXPPPXPP-PXPPXXPXPXPPPXPXXGXAPPP 967 R PPP P PP P PPP P PPP Sbjct: 491 RSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPP 522 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXX--PPPPPXXPXXXPXP 223 PP P P P++ PPP PP PPPPP P P Sbjct: 501 PPPPSPIHSPPPPPVYSPPPP---PPVYSPPPPPPVYSPPPPPP 541 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPP---XXPPPPPXXPXXXP 217 P P P P+F PPP PP PPPP P P Sbjct: 616 PPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPP 657 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 875 RXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 R PP PP P P P P P +PPP Sbjct: 490 RRSPPPPPVHSPPPPSPIHSPPPPPVYSPPP 520 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 PP P PPPPP PPP PP P Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPP 531 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/39 (33%), Positives = 15/39 (38%) Frame = +2 Query: 107 PXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P P+ PPP + PP P P P P P Sbjct: 566 PPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPP 604 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = +2 Query: 107 PXPXXXFXXXPLFXXPPPXWXPPXXPPPP---PXXPXXXPXP 223 P P P+ PPP + PP PPPP P P P P Sbjct: 595 PPPPVHSPPPPVHSPPPPVYSPP--PPPPVHSPPPPVFSPPP 634 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +2 Query: 107 PXPXXXFXXXPLFXXPPPXWXPPXXP---PPPP 196 P P P++ PPP + PP P PPPP Sbjct: 632 PPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPP 664 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPP----PPPXXPXXXPXP 223 PP P P+ PPP P PP PPP P P P Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPP 538 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/39 (33%), Positives = 15/39 (38%) Frame = +2 Query: 107 PXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P P+ PPP + PP PP P P P Sbjct: 625 PPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPP 663 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 6/47 (12%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPP---XXPPPP---PXXPXXXPXP 223 P P P P+ PPP PP PPPP P P P P Sbjct: 536 PPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 582 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/51 (27%), Positives = 16/51 (31%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P+ PPPP P P PP PP P P+ P Sbjct: 426 PVKFRRSPPPPQQPHHHVVHSPPPASSPPTSPPVHSTPSPVHKPQPPKESP 476 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXP 217 PP P P P PPP PP PPPP P Sbjct: 518 PPPPPPVYSPPPPPPVYSPPP--PPPVHSPPPPVHSPPPP 555 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Frame = +1 Query: 814 PXXXPPXPP-PPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 P PP P PPPP P +PP P P PPP Sbjct: 569 PVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPP 621 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +2 Query: 107 PXPXXXFXXXPLFXXPPPXWXPPXXPP---PPPXXPXXXPXP 223 P P P+ PPP PP PP PPP P P P Sbjct: 588 PPPPVHSPPPPVHSPPPPVHSPP--PPVYSPPPPPPVHSPPP 627 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +2 Query: 107 PXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P P+ PPP PP PP P P P Sbjct: 559 PPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPP 597 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP P P P P P P Sbjct: 527 PPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 568 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 6/48 (12%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPP---XXPPPP---PXXPXXXPXP 223 PP P P+ PPP PP PPPP P P P P Sbjct: 528 PPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 575 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPP---PXXPXXXPXP 223 PP P P++ PPP PPPP P P P P Sbjct: 510 PPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPP 554 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P PPP P P P PPP P PPP Sbjct: 35 PPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPP 66 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P PPP P P P P P PP P P AP A P PA Sbjct: 82 PPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPA 134 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/98 (25%), Positives = 27/98 (27%), Gaps = 1/98 (1%) Frame = +3 Query: 678 PGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAG-GXGXXPLXXXPXPPPPPPP 854 P P P P G P P +P P P P P P Sbjct: 4 PTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPV 63 Query: 855 XXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P P PP P PP AP+ P P Sbjct: 64 PPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSP 101 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/52 (36%), Positives = 20/52 (38%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P P P PP A P P P PP P PP AP + P P Sbjct: 3 PPTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSP 54 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/52 (32%), Positives = 19/52 (36%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P+ PP PP P P PPP P P PP+ P P P Sbjct: 62 PVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVP 113 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 PPP P P PP P P P P P AP P+ Sbjct: 81 PPPEPKPAPPPAPKPVPCPSPPKPPAPTPK 110 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P PP P P PPP P P PP P+ PPPA Sbjct: 22 PVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPA 67 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P P P PPP P P P PP P P P P PA Sbjct: 70 PTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPA 122 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPP P P + P PP P P PP P P P Sbjct: 79 PAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAP 125 Score = 36.7 bits (81), Expect = 0.025 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +2 Query: 881 PPPXPPPXPPXX-PXPXPPPXPXXGXAPPPR 970 PPP PP PP P P PPP P P P+ Sbjct: 64 PPPACPPTPPKPQPKPAPPPEPKPAPPPAPK 94 Score = 35.5 bits (78), Expect = 0.057 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P PP PP P P P P P AP P Sbjct: 109 PKPVPPHGPPPKPAPAPTPAPSPKPAPSP 137 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/51 (33%), Positives = 20/51 (39%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P P P P PP + P PPP P P P +P+ A PP Sbjct: 90 PPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAP--SPKPAPSPP 138 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPP P PPP PP P P Sbjct: 35 PPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKP 75 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = +3 Query: 828 PXPPPPP---PPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P P P PP P PP P P PP P+ A PPPA Sbjct: 44 PAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPA--PPPA 92 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +2 Query: 422 GGGXXPPXXXGARXXPHPXXXG-PXPPPXPRXXX-PXPPPXPXPXPXP 559 G P G P P P PPP P P PPP P P P P Sbjct: 17 GPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVP 64 Score = 32.7 bits (71), Expect = 0.40 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = +3 Query: 828 PXPPPP--PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P P PPP P P P P P PP P A P P+ Sbjct: 81 PPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPS 130 Score = 31.9 bits (69), Expect = 0.71 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 P P P PPP P P PP PP P P V Sbjct: 79 PAPPPEPKPAPPPAPKPVPCPSPPKPP-APTPKPV 112 Score = 31.5 bits (68), Expect = 0.93 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P P P P P PPP P P P P Sbjct: 90 PPAPKPVPCPSPPKPPAPTPKPVPP-HGPPPKPAPAPTPAP 129 Score = 31.5 bits (68), Expect = 0.93 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 PP PPP P P P P P P P Sbjct: 113 PPHGPPPKPAPAPTPAPSPKPAPSPPKP 140 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 P P P PPP P P P P PP P P V Sbjct: 32 PSPPPKPQPKPPPAPS---PSPCPSPPPKPQPKPV 63 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P P P P P PP P P P P Sbjct: 43 PPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPP 83 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPP-PPXPPXXPXP 560 PP P PPP P P PP PP P P P Sbjct: 72 PPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVP 113 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +2 Query: 467 PHPXXXGPXPP-PXPRXXXPX-PPPXPXPXPXP 559 P P P PP P P+ P PPP P P P P Sbjct: 95 PVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTP 127 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPP---PXPPXXPXP 560 P PP PP P PPP P PP P P Sbjct: 64 PPPACPPTPPKPQPKPAPPPEPKPAPPPAPKP 95 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P P PP P P P P PP P P Sbjct: 81 PPPEPKPAPPPAPKPVPCPSPPKP--PAPTPKPVPPHGPPP 119 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 P P P PP PPP P P P P V Sbjct: 62 PVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPV 96 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P PPP P P PPP P P P P Sbjct: 64 PPPACPPTPPKPQPKPAPPPEPKP---APPPAPKPVPCPSP 101 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +3 Query: 843 PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 PP P A P P P P P P+ PPPA Sbjct: 3 PPTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPA 45 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXPXGG 232 PP P P P PP P PP P P P P G Sbjct: 72 PPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHG 116 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 PP P P GP P P P P P P P P P P Sbjct: 101 PPKPPAPTPKPVPPH-GPPPKPAPA---PTPAPSPKPAPSP 137 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P+ PP P P PP P P P Sbjct: 82 PPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAP 123 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 486 GPPPPPXPXXXXPPPPPXPPXXPXP 560 GPPP P P P P P P P Sbjct: 116 GPPPKPAPAPTPAPSPKPAPSPPKP 140 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PP P PPP P P P Sbjct: 25 PPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPP 66 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/43 (32%), Positives = 15/43 (34%), Gaps = 1/43 (2%) Frame = +3 Query: 813 PLXXXPXPPPPPP-PXXXXXXRAXPXXXPPPXPPXXPXXXPPR 938 P P PP P P P P P P P P PP+ Sbjct: 97 PCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPK 139 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PP P P PPP P P P Sbjct: 35 PPKPQPKPPPAPSPSPCPSPPP-KPQPKPVPPPACPPTPPKP 75 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/42 (35%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXG-PXPPPXPRXXXPXPPPXPXPXPXP 559 PP + P P P PPP P+ P P P P P P Sbjct: 69 PPTPPKPQPKPAPPPEPKPAPPPAPKPV-PCPSPPKPPAPTP 109 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 1/69 (1%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPP-PXPPXXPXXXPPRAPR 947 P P P P PPPPPPP P PP P P P P Sbjct: 670 PARSPPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPP 729 Query: 948 XAXXPPPAA 974 PPP A Sbjct: 730 PPPPPPPPA 738 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/47 (38%), Positives = 21/47 (44%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPPPPP ++ PP P PPR P + PPP Sbjct: 728 PPPPPPPPPPAPPTPQSNGISAMKSSPPAPP--APPRLPTHSASPPP 772 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 5/46 (10%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXX-----PPPPPXPPXXPXP 560 PP P P PPPPP PPPPP PP P P Sbjct: 675 PPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTP 720 Score = 35.9 bits (79), Expect = 0.043 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P PP PP P + P PPP PP P PPA Sbjct: 709 PPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPA 756 Score = 35.9 bits (79), Expect = 0.043 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXX--PPPPPXPPXXPXP 560 P PP PP P PPPPP PP P P Sbjct: 709 PPPPAPPAPPTPIVHTSSPPPPPPPPPPPAP 739 Score = 35.9 bits (79), Expect = 0.043 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRX 950 P P P P PP PP P PP PP P P Sbjct: 715 PAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPT 774 Query: 951 AXXPPP 968 A PPP Sbjct: 775 APPPPP 780 Score = 35.9 bits (79), Expect = 0.043 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PP PP P A P PPP P P RAP PPP Sbjct: 754 PPAPPAPPRLPTHSASP---PPPTAPPPPPLGQTRAPSAPPPPPP 795 Score = 35.1 bits (77), Expect = 0.076 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 PP P TP PPP P PPPPP PP Sbjct: 708 PPPPPAPPAPPTPIVHTSSPPPPPP---PPPPPAPP 740 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P PP PP P P PPP P P A + + PPA Sbjct: 707 PPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPA 759 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 467 PHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 P P P PP P PPP P P P P Sbjct: 707 PPPPPPAPPAPPTPIVHTSSPPPPPPPPPPP 737 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P PP P PPPPP PP P Sbjct: 709 PPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPP 740 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXP 962 P PP PPP RA PPP PP P P P Sbjct: 770 PPPPTAPPPPPLGQTRA--PSAPPPPPPKLGTKLSPSGPNVPPTP 812 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXP 205 PP P P P+ P PP PPP P P Sbjct: 707 PPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTP 742 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXP 542 PP P PPPPP P PP PP P Sbjct: 711 PPAPPAPPTPIVHTSSPPPPPPPP---PPPAPPTP 742 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPP 545 P PPPPP P PP PP Sbjct: 771 PPPTAPPPPPLGQTRAPSAPPPPP 794 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +2 Query: 881 PPPXPPPXPPXX----PXPXPPPXPXXGXAPPP 967 PPP PP PP P PPP P G P Sbjct: 771 PPPTAPPPPPLGQTRAPSAPPPPPPKLGTKLSP 803 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 6/48 (12%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXP------PPPPXXPXXXPXP 223 PP P P + PPP P P PPPP P P P Sbjct: 692 PPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAP 739 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 6/29 (20%) Frame = +3 Query: 492 PPPPXPXXXXPPPP------PXPPXXPXP 560 PPPP P PP P P PP P P Sbjct: 707 PPPPPPAPPAPPTPIVHTSSPPPPPPPPP 735 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 41.5 bits (93), Expect = 9e-04 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = +3 Query: 414 GGGGGGXXP---PXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXP 542 GGG P P G G P P G PPP P PPPPP P Sbjct: 660 GGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPP-PXPPXXPXPXXVRFXXXGGGXR 599 P P PPPPP P PPPP PP P P GGG + Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPPGALGRGAGGGNK 717 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +2 Query: 872 PRXPPPXP---PPXPPXXPXPXPPPXPXXGXAPPP 967 P PP P PP PP P PPP P G PPP Sbjct: 668 PSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPP 702 Score = 36.3 bits (80), Expect = 0.033 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 502 GGGGGPXXXGVXGXPXPXXXGGXXPPPPPP 413 GGG P G P P GG PPPPPP Sbjct: 676 GGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 36.3 bits (80), Expect = 0.033 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 499 GGGGPXXXGVXGXPXPXXXGGXXPPPPPPP 410 GGG P G P GG PPPPPPP Sbjct: 676 GGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPP 911 PL PPPPPPP PPP PP Sbjct: 673 PLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +2 Query: 485 GPXPPPXPRXXXPXPPPX---PXPXPXPXXXXFXXXGG 589 GP PPP P P PPP P P P P GG Sbjct: 678 GPPPPPPPPGGGPPPPPGGGPPPPPPPPGALGRGAGGG 715 Score = 32.7 bits (71), Expect = 0.40 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 3/27 (11%) Frame = +2 Query: 872 PRXPPPXP---PPXPPXXPXPXPPPXP 943 P PPP P PP PP P PPP P Sbjct: 679 PPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPP 935 PR RP G P PP P P PPP P P PP Sbjct: 649 PRVPRPPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPP 703 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +2 Query: 872 PRXPPPX--PPPXPPXXPXPXPPPXPXXG 952 P PPP PPP P P P PPP G Sbjct: 681 PPPPPPGGGPPPPPGGGPPPPPPPPGALG 709 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = +2 Query: 425 GGXXPPXXXGARXXPHPXXXGPXPPPXPRXXXPXPP----PXPXPXP 553 GG AR P P P PPP P P PP P P P P Sbjct: 660 GGGKSTNLPSARP-PLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP G T PP P PPPPP P P Sbjct: 654 PPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPP 694 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 Query: 454 PXXXGGXXPPPPPPP 410 P GG PPPPPPP Sbjct: 672 PPLPGGGPPPPPPPP 686 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -1 Query: 453 PXXXGGXXPPPPPPP 409 P GG PPPPPPP Sbjct: 672 PPLPGGGPPPPPPPP 686 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXPXGG 232 PP P P P PP PPPPP P P GG Sbjct: 655 PPRSAGGGKSTNLPSARPPLPGGGPP--PPPPPPGGGPPPPPGGG 697 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPXPPPPPP 851 P P GG P P PPPPPP Sbjct: 679 PPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +2 Query: 152 PPPXWXPPXXPPPPP-XXPXXXPXPXG 229 PPP P PPPPP P P P G Sbjct: 680 PPPPPPPGGGPPPPPGGGPPPPPPPPG 706 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 919 PPXTPPXPXGGPXXPPP 969 P PP P GGP PPP Sbjct: 668 PSARPPLPGGGPPPPPP 684 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 730 PPPPPXGXXXXGXPXGPGXPXAPXAPXA 647 PPPPP P G G P P P A Sbjct: 680 PPPPPPPGGGPPPPPGGGPPPPPPPPGA 707 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPP---XXPXXXPPRAPRXAXXPPP 968 PPPP P A P PPP PP P PP P+ PPP Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 Score = 37.5 bits (83), Expect = 0.014 Identities = 17/48 (35%), Positives = 19/48 (39%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P PPPP PP + P P P P P+APR P A Sbjct: 386 PRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGPADA 433 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPP-PXPPXXPXP 560 PP P PPPPP P PPPP P P P Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRP 426 Score = 32.7 bits (71), Expect = 0.40 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P + PPPP P P PP PP P Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGP 411 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/49 (34%), Positives = 19/49 (38%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 P PP PP +A P P P PPR P A PPP + Sbjct: 351 PLPPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPA--PPPGS 397 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 8/40 (20%) Frame = +3 Query: 465 PXTPXXXGPP------PPPXPXXXXPPPPPXP--PXXPXP 560 P P GPP PPP PPPPP P P P P Sbjct: 377 PQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXP 541 PP G + P P GP PPP P P P P Sbjct: 394 PPGSGGPKPPPPPGPKGPRPPP-PMSLGPKAPRPP 427 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPP----XXPPPPPXXPXXXPXP 223 PP P P P PPP PP PPPPP P P Sbjct: 372 PPVPAPQMPSSAGP--PRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 28.3 bits (60), Expect = 8.7 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = +3 Query: 816 LXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRA----PRXAXXPPPA 971 L P P P P R PP PP P PPR P + PPPA Sbjct: 138 LATKPGSSPSPSPS-----RPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPPPPPA 188 Score = 23.8 bits (49), Expect(2) = 5.4 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -3 Query: 313 GXGGPPXPXPPGXR 272 G GGP P PPG + Sbjct: 396 GSGGPKPPPPPGPK 409 Score = 23.4 bits (48), Expect(2) = 5.4 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = -3 Query: 460 PXPXXXGGXXPPPPPPP 410 P P PP PPPP Sbjct: 375 PAPQMPSSAGPPRPPPP 391 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPP---XXPXXXPPRAPRXAXXPPP 968 PPPP P A P PPP PP P PP P+ PPP Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 Score = 37.5 bits (83), Expect = 0.014 Identities = 17/48 (35%), Positives = 19/48 (39%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P PPPP PP + P P P P P+APR P A Sbjct: 386 PRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGPADA 433 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPP-PXPPXXPXP 560 PP P PPPPP P PPPP P P P Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRP 426 Score = 32.7 bits (71), Expect = 0.40 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P + PPPP P P PP PP P Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGP 411 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/49 (34%), Positives = 19/49 (38%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 P PP PP +A P P P PPR P A PPP + Sbjct: 351 PLPPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPA--PPPGS 397 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 8/40 (20%) Frame = +3 Query: 465 PXTPXXXGPP------PPPXPXXXXPPPPPXP--PXXPXP 560 P P GPP PPP PPPPP P P P P Sbjct: 377 PQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXP 541 PP G + P P GP PPP P P P P Sbjct: 394 PPGSGGPKPPPPPGPKGPRPPP-PMSLGPKAPRPP 427 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPP----XXPPPPPXXPXXXPXP 223 PP P P P PPP PP PPPPP P P Sbjct: 372 PPVPAPQMPSSAGP--PRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 28.3 bits (60), Expect = 8.7 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = +3 Query: 816 LXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRA----PRXAXXPPPA 971 L P P P P R PP PP P PPR P + PPPA Sbjct: 138 LATKPGSSPSPSPS-----RPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPPPPPA 188 Score = 23.8 bits (49), Expect(2) = 5.4 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -3 Query: 313 GXGGPPXPXPPGXR 272 G GGP P PPG + Sbjct: 396 GSGGPKPPPPPGPK 409 Score = 23.4 bits (48), Expect(2) = 5.4 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = -3 Query: 460 PXPXXXGGXXPPPPPPP 410 P P PP PPPP Sbjct: 375 PAPQMPSSAGPPRPPPP 391 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXP-----PXXPXXXPPRAPRXAXXPPP 968 P PPPPPPP RA P PPP P P P P R PPP Sbjct: 22 PLPPPPPPPPPPMRRRA-PLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPP 72 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP PPP P P PPP P AP P Sbjct: 24 PPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLP 55 Score = 33.5 bits (73), Expect = 0.23 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 5/57 (8%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXP-----XXXPPRAPRXAXXPPP 968 P+ PPPPPP P PPP P P R R A PPP Sbjct: 47 PMRRRAPLPPPPPPAMRRRVLPRPPPPPPPLPMFDAEVLCCCYPPTRVRREAPLPPP 103 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 459 GXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 G P PPPPP PPPP PP Sbjct: 19 GRVPLPPPPPPPPPPMRRRAPLPPPPPPP 47 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 PP P PPPPP P P PP PP Sbjct: 24 PPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPP 59 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 419 GGGGXXPPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXP 547 G P G P P P PPP R P PPP P P Sbjct: 8 GADAVVSPPMRGRVPLPPPP---PPPPPPMRRRAPLPPPPPPP 47 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P+ PPPPPP R P PPP PP PR P PPP Sbjct: 33 PMRRRAPLPPPPPP---PMRRRAP--LPPPPPPAMRRRVLPRPP---PPPPP 76 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWX--PPXXPPPPP 196 PP P P PL PPP P PPPPP Sbjct: 26 PPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPP 60 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXP 554 PPPP P PPP PP P Sbjct: 57 PPPPAMRRRVLPRPPPPPPPLP 78 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXP 554 PPPPP P P P PP P Sbjct: 26 PPPPPPPPMRRRAPLPPPPPPP 47 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 P PPPPPPP PP PP PP A Sbjct: 68 PRPPPPPPPLPMFDAEVLCCCYPPTRVRREAPLPPPPLIFVGAPPPTCA 116 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 5/34 (14%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXX-----PPPPPXPPXXPXP 560 P PPPPP P PPPPP P P Sbjct: 22 PLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLP 55 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXP---PXXPPPPPXXP 205 P P P PL PPP P PPPPP P Sbjct: 41 PPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPPLP 78 Score = 28.3 bits (60), Expect = 8.7 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +1 Query: 805 GXXPXXXPPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGG--PXXPPP 969 G P PP PPPPPP PP PP P PPP Sbjct: 19 GRVPLPPPP--PPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPP 73 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PPPPP P P PP P P Sbjct: 55 PPPPPPAMRRRVLPRPPPPPPPLP 78 Score = 23.8 bits (49), Expect(2) = 5.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -3 Query: 430 PPPPPPP 410 PPPPPPP Sbjct: 70 PPPPPPP 76 Score = 23.4 bits (48), Expect(2) = 5.4 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = -3 Query: 460 PXPXXXGGXXPPPPPP 413 P P PPPPPP Sbjct: 45 PPPMRRRAPLPPPPPP 60 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 41.1 bits (92), Expect = 0.001 Identities = 46/179 (25%), Positives = 48/179 (26%), Gaps = 9/179 (5%) Frame = -3 Query: 973 AAGGGXXAXRGA--RGGXXXGXX---GGXGGGXXXGXARXXXXXXGG---GGGGGXGXXX 818 AAGGG GA GG G G G G G A GG GGGGG G Sbjct: 45 AAGGGGGGGGGASVEGGTEKGIDDNANGYGDGNGNGNAHGRADCPGGIVVGGGGGGGGGG 104 Query: 817 RGXXPXPPAXGRXXRGXXXXXXXXXXXXGPPPP-PXGXXXXGXPXGPGXPXAPXAPXARX 641 G + G G G G G + Sbjct: 105 GGGGGSGGSNGSFFNGSGSGTGYGSGDGRVSSSGEYSASAGGGGSGEGSGGGGGGDGSSG 164 Query: 640 XXXXLXVXXXXXXGRXPPPXXXKRTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G P G G GG GGGGG G G G G G G Sbjct: 165 SGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 31.9 bits (69), Expect = 0.71 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G GGG G G G G GGG Sbjct: 193 GGGGGGGGGGGGGGVDGSGSGSGSGSGGG 221 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G GGG G G GG GG G G Sbjct: 90 GGIVVGGGGGGGGGGGGGGGSGGSNGSFFNG 120 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 195 GGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 GGGGG GG GGG G G G G Sbjct: 192 GGGGGGGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G G G G G G G G Sbjct: 191 GGGGG--GGGGGGGGGGGVDGSGSGSGSGSGG 220 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = -2 Query: 968 GGGXXGPPXGXG-GVXGGXXXXXXXXXXXXXXXXAXGXXGGGGGGGXGGXXXG 813 GGG G G G G G GGGGGGG GG G Sbjct: 157 GGGDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGGGGGGGGVDG 209 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G GG G G G G G G G Sbjct: 195 GGGGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXG-GXGGGXGGG 880 GGG GGG G G G G G G G G Sbjct: 145 GGGGSGEGSGGGGGGDGSSGSGSGSGSGSG 174 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 863 GXXGGGGGGGXGGXXXG 813 G GGGGGGG GG G Sbjct: 95 GGGGGGGGGGGGGGGSG 111 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 863 GXXGGGGGGGXGGXXXG 813 G GGGGGGG GG G Sbjct: 96 GGGGGGGGGGGGGGSGG 112 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 192 GGGGXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 GGGG GG GGG G G G G Sbjct: 191 GGGGGGGGGGGGGGGGVDGSGSGSGSGSGGG 221 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 40.7 bits (91), Expect = 0.002 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PPP PP P PPP PPP Sbjct: 310 PPPPPPPPPPLLQQPPPPPSVSKAPPPPP 338 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P+ P PPP PP PPP P APPP Sbjct: 305 PQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPP 336 Score = 37.5 bits (83), Expect = 0.014 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPP 545 P P PPPPP PPPPP PP Sbjct: 316 PPPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 35.9 bits (79), Expect = 0.043 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PPPPP P PPPPP P P Sbjct: 313 PPPPPPPLLQQPPPPPSVSKAPPP 336 Score = 35.1 bits (77), Expect = 0.076 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXP--XXXPPPXPPXXP 920 P P PPPPPPP P PPP PP P Sbjct: 305 PQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPP 545 P P PPPP PPPPP PP Sbjct: 315 PPPPPLLQQPPPPPSVSKAPPPPPPPP 341 Score = 33.9 bits (74), Expect = 0.17 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRA 941 PPPPPPP + P PP P PP++ Sbjct: 310 PPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPPKS 345 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 4/34 (11%) Frame = +3 Query: 465 PXTPXXXGPP----PPPXPXXXXPPPPPXPPXXP 554 P P PP PPP P PPPP PP P Sbjct: 310 PPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 32.3 bits (70), Expect = 0.53 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 893 PPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P P PPP P PPP Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPP 327 Score = 31.9 bits (69), Expect = 0.71 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 5/34 (14%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPP-----PPXPPXXPXP 560 P PPPPP PPP PP PP P P Sbjct: 310 PPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 4/31 (12%) Frame = +3 Query: 828 PXPPPPP----PPXXXXXXRAXPXXXPPPXP 908 P PPPPP PP +A P PPP P Sbjct: 313 PPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 4/37 (10%) Frame = +2 Query: 872 PRXPPPXPP----PXPPXXPXPXPPPXPXXGXAPPPR 970 P PPP PP P PP PPP P PPP+ Sbjct: 311 PPPPPPPPPLLQQPPPPPSVSKAPPPPP---PPPPPK 344 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 4/32 (12%) Frame = +3 Query: 828 PXPPPPPP----PXXXXXXRAXPXXXPPPXPP 911 P PPPPPP P P PPP PP Sbjct: 312 PPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 495 PPPXPXXXXPPPPPXPPXXPXP 560 PPP PPPPP PP P Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQP 324 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXP 205 PP P P PL PPP PPPPP P Sbjct: 310 PPPPPPPPP----PLLQQPPPPPSVSKAPPPPPPPP 341 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/47 (29%), Positives = 15/47 (31%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PPP + PP P PP P PPP Sbjct: 280 PRVPKPPPKRSISLGDSTENRADPPPQKSIPPPPPPPPPPLLQQPPP 326 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPP 936 P PPPPPPP P PP PP Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXP 205 PP P P P PPP PPPPP P Sbjct: 311 PPPPPPPPPLLQQP---PPPPSVSKAPPPPPPPPPP 343 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 887 PXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P PP P P PP PP Sbjct: 25 PSPLPLPPPPPPPLKPPSSGSATTKPP 51 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 829 PXPPPPPPPXXP 864 P PPPPPPP P Sbjct: 29 PLPPPPPPPLKP 40 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PP PP PPPPP P P Sbjct: 304 PPQKSIPPPPPPPPPPLLQQPPPP 327 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 PP P P PPPPP PPPPP PP Sbjct: 1093 PPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP PP PP P P PPP P PPP Sbjct: 1102 PLPPPPSQPPPPPLSPPPSPPPPP-----PPP 1128 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/52 (34%), Positives = 20/52 (38%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PL P PP PP P PP PP PP +P + PPP Sbjct: 1074 PLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPP 1125 Score = 37.5 bits (83), Expect = 0.014 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXP--PPXPXXGXAPPP 967 P P PPP PP P P P PP P PPP Sbjct: 1062 PPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPP 1095 Score = 37.5 bits (83), Expect = 0.014 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P+ PP PP PP P P PP P PPP Sbjct: 1065 PQESPPPLPPLPPSPPPPSPPLPPSSLPPPPP 1096 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPP--PXPXXXXPPPPP---XPPXXPXP 560 PP P P PPPP P P PPPPP PP P P Sbjct: 1062 PPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPP 1107 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PP PPP PP P PPP P P P Sbjct: 1073 PPLPPSPPPPSPPLPPSSLPPPPPAALFPPLP 1104 Score = 37.1 bits (82), Expect = 0.019 Identities = 22/56 (39%), Positives = 23/56 (41%), Gaps = 3/56 (5%) Frame = +3 Query: 813 PLXXXPXPP---PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P PP PPPPP P PPP PP P PP P PPP+ Sbjct: 1080 PPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPP-PPLSPPPSPPPPP-----PPPS 1129 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPP---PPPXPPXXPXP 560 PP P P PP PP P PP PPP PP P P Sbjct: 1084 PPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPP 1127 Score = 35.5 bits (78), Expect = 0.057 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 PP P P PPPP PPPP PP P Sbjct: 1076 PPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPP 1114 Score = 35.5 bits (78), Expect = 0.057 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P P P PP PP PPPPP P P P Sbjct: 1082 PSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPP 1123 Score = 35.1 bits (77), Expect = 0.076 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXP 205 PP P P PPP PP PPPPP P Sbjct: 1093 PPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPP P PP PP P P P Sbjct: 1073 PPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPP 1113 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 897 PPXPPXXPXXXPPRAPRXAXXPPPAA 974 PP PP P PP P PPPAA Sbjct: 1073 PPLPPSPPPPSPPLPPSSLPPPPPAA 1098 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P P F P PPP PP PPP P P P Sbjct: 1092 PPPPPAALFPPLP----PPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 31.9 bits (69), Expect = 0.71 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +3 Query: 471 TPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 +P PPP P PPPP PP P Sbjct: 1061 SPPLPQESPPPLPPLPPSPPPPSPPLPP 1088 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPP--PXXPXXXPXP 223 PP P P PPP P PPPP P P P P Sbjct: 1076 PPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPP 1119 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P P PPP P PP PP PP A PPP+ Sbjct: 1058 PEDSPPLPQESPPPLPPLPPSPPPPS--PPLPPSSLPPPPPAALFPPLPPPPS 1108 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/47 (31%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = +3 Query: 813 PLXXXPXPPPPP----PPXXXXXXRAXPXXXPPPXPPXXPXXXPPRA 941 PL PPPPP PP + P PP P P P ++ Sbjct: 1085 PLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPPSQS 1131 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 887 PXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P PP P PPP P +PPP Sbjct: 1056 PLPEDSPP-LPQESPPPLPPLPPSPPP 1081 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 PPP PPP PP P P PPP P PP Sbjct: 273 PPPQPPPPPP--PKPQPPPPPKIARPPP 298 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/57 (36%), Positives = 22/57 (38%) Frame = +3 Query: 804 GXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 G PL P PPPP A P PPP PP PP+ R PP A Sbjct: 252 GLPPLKLPPGRSAPPPPPAA----APPPQPPPPPPPKPQPPPPPKIARPPPAPPKGA 304 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 3/33 (9%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPX---PPPXPXXGXAP 961 P PPP PPP P P P PPP P G AP Sbjct: 274 PPQPPPPPPPKPQPPPPPKIARPPPAPPKGAAP 306 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P PPP PP P P P P P A PP Sbjct: 266 PPPPAAAPPPQPPPPPPPKPQPPPPPKIARPP 297 Score = 36.7 bits (81), Expect = 0.025 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 PPP P PP P P PPP P PPP+ Sbjct: 265 PPPPPAAAPP--PQPPPPPPPKPQPPPPPK 292 Score = 36.3 bits (80), Expect = 0.033 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +3 Query: 474 PXXXGPPPPP--XPXXXXPPPPPXPPXXPXPXXV 569 P PPPPP P PPPPP P P P + Sbjct: 260 PGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKI 293 Score = 35.5 bits (78), Expect = 0.057 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +3 Query: 426 GGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPP----PPPXPPXXPXP 560 G PP P P PPPPP P PP PPP PP P Sbjct: 261 GRSAPPPPPAAAPPPQPP---PPPPPKPQPPPPPKIARPPPAPPKGAAP 306 Score = 35.1 bits (77), Expect = 0.076 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVR 572 PP G P PPP P PPPPP P P P R Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPP---PPPPPKPQPPPPPKIAR 295 Score = 34.3 bits (75), Expect = 0.13 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 459 GXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 G P G PP P PPP P PP P P Sbjct: 252 GLPPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKP 285 Score = 33.9 bits (74), Expect = 0.17 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP---XPPXXP 554 PP P PPPP P PPPPP PP P Sbjct: 259 PPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAP 300 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPP 911 P P P P PPPPPP PPP PP Sbjct: 255 PLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPP 301 Score = 32.3 bits (70), Expect = 0.53 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP PP PPPPP P P Sbjct: 267 PPPAAAPPPQPPPPPPPKPQPPPP 290 Score = 32.3 bits (70), Expect = 0.53 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PP PP PPPPP P P P Sbjct: 268 PPAAAPPPQPPPPPPPKPQPPPPP 291 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXPXGG 232 PPP P PPPPP P P G Sbjct: 277 PPPPPPPKPQPPPPPKIARPPPAPPKG 303 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +3 Query: 798 GXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXA 953 G P PPP PPP P P P PP PP P+ A Sbjct: 261 GRSAPPPPPAAAPPPQPPP--------PPPPKPQPPPPPKIARPPPAPPKGA 304 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP P PPPP P P P Sbjct: 266 PPPPAAAPPPQPPPPPPPKPQPPP 289 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/55 (34%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXR---AXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P+ P PPPP PP + P PPP PP PP + PPP Sbjct: 406 PIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPP 460 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRF 575 PP P +P PPPPP PPPPP P P F Sbjct: 428 PPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSPEF 473 Score = 35.5 bits (78), Expect = 0.057 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PP PP PP PPP P +PPP Sbjct: 437 PPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPP 468 Score = 32.3 bits (70), Expect = 0.53 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPP---PPPXPPXXPXP 560 P P PPPPP PP PPP PP P Sbjct: 403 PSPPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPP 437 Score = 31.9 bits (69), Expect = 0.71 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP P PPPPP P P Sbjct: 418 PPLPPPVYSPPPSPPVFSPPPS-PPVYSPPPPPSIHYSSPPP 458 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/42 (33%), Positives = 16/42 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P++ PPP PPPPP P P Sbjct: 428 PPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPP 469 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PP PP P PPP P P P Sbjct: 415 PPSPPLPPPVYSPPPSPPVFSPPP 438 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPP PP + PPP PP PP +P PP Sbjct: 436 PPPSPPVYSPPPPPSIHYSSPPP-PPVHHSSPPPPSPEFEGPLPP 479 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +2 Query: 152 PPPXWXPPXXPP---PPPXXPXXXPXP 223 PPP PP PP PPP P P P Sbjct: 412 PPPPPSPPLPPPVYSPPPSPPVFSPPP 438 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPP 533 PP P P PPPP P P PP Sbjct: 448 PPSIHYSSPPPPPVHHSSPPPPSPEFEGPLPP 479 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/39 (33%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +3 Query: 465 PXTPXXXGP--PPPPXPXXXXPPPPPXPPXXPXPXXVRF 575 P +P P PPP P PPP P P P + + Sbjct: 415 PPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHY 453 Score = 28.3 bits (60), Expect = 8.7 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 6/53 (11%) Frame = +3 Query: 828 PXPP---PPPPPXXXXXXRAXP---XXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P PPP P PP PPP Sbjct: 438 PSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSPEFEGPLPPVIGVSYASPPP 490 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP 536 PP P +P GP PP PPPP Sbjct: 459 PPVHHSSPPPPSPEFEGPLPPVIGVSYASPPPP 491 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPPPP A P PP P P PP + A PPP Sbjct: 384 PPPPPPPSAA----APPPPPPPKKGPAAPPPPPPPGKKGAGPPPP 424 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/45 (40%), Positives = 20/45 (44%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPPPP + P PPP PP PP P + PP Sbjct: 395 PPPPPPP------KKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPP 433 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP PP P PPP P G A PP Sbjct: 378 PANQTSPPPPPPPSAAAPPPPPPPKKGPAAPP 409 Score = 37.5 bits (83), Expect = 0.014 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P PPPPP P PPPPP P P Sbjct: 376 PGPANQTSPPPPPPPSAAAPPPPPPPKKGP 405 Score = 36.7 bits (81), Expect = 0.025 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PPP P PPP G PPP Sbjct: 395 PPPPPPPKKGPAAPPPPPPPGKKGAGPPP 423 Score = 35.5 bits (78), Expect = 0.057 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPP 545 P P PPPPP P PPP PP Sbjct: 387 PPPPSAAAPPPPPPPKKGPAAPPPPPP 413 Score = 35.5 bits (78), Expect = 0.057 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP PPP P PPP G PP Sbjct: 405 PAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPP 436 Score = 34.3 bits (75), Expect = 0.13 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPP 545 P P PPPP P PPPP PP Sbjct: 375 PPGPANQTSPPPPPPPSAAAPPPPPPP 401 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 5/44 (11%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXG-----PPPPPXPXXXXPPPPPXPPXXP 554 PP G P P G PPPPP PP PP P P Sbjct: 399 PPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNPKGP 442 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXP-PXXPXP 560 PP G +P PPPPP PPPPP P P P Sbjct: 372 PPAPPGPANQTSPP---PPPPPSAAAPPPPPPPKKGPAAPPP 410 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXP--PPPPXPP 545 P P PPPP P P PPPP PP Sbjct: 386 PPPPPSAAAPPPPPPPKKGPAAPPPPPPP 414 Score = 33.1 bits (72), Expect = 0.31 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 467 PHPXXXGPXPPPXPRXXXPXPPPXPXP 547 P P P PPP P+ PPP P P Sbjct: 388 PPPSAAAPPPPPPPKKGPAAPPPPPPP 414 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PP PP P + P PPP P PP+ A PPP Sbjct: 372 PPAPPGP----ANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPP 412 Score = 32.3 bits (70), Expect = 0.53 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 887 PXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PP P P PPP P PPP Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPP 398 Score = 32.3 bits (70), Expect = 0.53 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +2 Query: 875 RXPPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 + P PPP PP PPP P PP+ Sbjct: 403 KGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPK 434 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 1/67 (1%) Frame = +1 Query: 772 PGXXARARGGXGXXPXXXPPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXG- 948 PG A PPPPPP P PP PP G Sbjct: 363 PGQFTTANAPPAPPGPANQTSPPPPPP---PSAAAPPPPPPPKKGPAAPPPPPPPGKKGA 419 Query: 949 GPXXPPP 969 GP PPP Sbjct: 420 GPPPPPP 426 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 4/45 (8%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGP----PPPPXPXXXXPPPPPXPPXXPXP 560 PP P P GP PPPP PPPP P P Sbjct: 388 PPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGP 432 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXPXG 229 PP P P P PPP PPPPP P P G Sbjct: 396 PPPPPPKKGPAAPP--PPPPPGKKGAGPPPPPPMSKKGPPKPPG 437 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P P P PPP P PPPP P P P Sbjct: 373 PAPPGPANQTSPPP---PPPPSAAAPPPPPPPKKGPAAPPPP 411 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = -3 Query: 805 PXPPAXGRXXRGXXXXXXXXXXXXGPPPPPXGXXXXGXPXGPGXPXAP 662 P PP + GPPPPP G P PG P P Sbjct: 396 PPPPPPKKGPAAPPPPPPPGKKGAGPPPPPP-MSKKGPPKPPGNPKGP 442 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXP 962 PPPPPPP PP PP PP+ P P Sbjct: 408 PPPPPPPGKKGAG--------PPPPPPMSKKGPPKPPGNPKGP 442 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 460 PXPXXXGGXXPPPPPPP 410 P P G PPPPPPP Sbjct: 398 PPPPKKGPAAPPPPPPP 414 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXP-PPPPXXPXXXPXP 223 PP P P P PPP P P PPPP P P Sbjct: 384 PPPPPPPSAAAPPP---PPPPKKGPAAPPPPPPPGKKGAGPPP 423 Score = 27.1 bits (57), Expect(2) = 1.5 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -3 Query: 460 PXPXXXGGXXPPPPPPP 410 P P PPPPPPP Sbjct: 385 PPPPPPSAAAPPPPPPP 401 Score = 22.2 bits (45), Expect(2) = 1.5 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -3 Query: 313 GXGGPPXPXPPGXR 272 G PP P PPG + Sbjct: 404 GPAAPPPPPPPGKK 417 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P PPPP P PPP P PP P P Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP PP PP P P PPP +PPP Sbjct: 64 PPPPPPTSPP-PPSPPPPSPPPPSPPPPSPPP 94 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PP PPP P P P PPP P PPP Sbjct: 65 PPPPPTSPPPPSPPPPSP-PPPSPPPPSPPPP 95 Score = 35.5 bits (78), Expect = 0.057 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRA 941 PPPPPP P PPP PP P PP A Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPP--PPSPPPPA 96 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXA 958 PPP PPP P P P PP P A Sbjct: 73 PPPSPPPPSPPPPSPPPPSPPPPAFA 98 Score = 33.5 bits (73), Expect = 0.23 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P PP PP P P PP P P Sbjct: 72 PPPPSPPPPSPPPPSPPPPSPPPPAFAVGKTP 103 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 PPPPPP PPP PP P PP +P PPPA Sbjct: 64 PPPPPP-----------TSPPPPSPP--PPSPPPPSPPPPSPPPPA 96 Score = 32.7 bits (71), Expect = 0.40 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +3 Query: 828 PXPPPP--PPPXXXXXXRAXPXXXPPPXPP 911 P PPPP PPP P PPP PP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPP 93 Score = 32.7 bits (71), Expect = 0.40 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP PP PPPP P P P Sbjct: 66 PPPPTSPPPPSPPPPSPPPPSPPP 89 Score = 32.3 bits (70), Expect = 0.53 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPP 193 PP P P P PPP PP PPPP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 32.3 bits (70), Expect = 0.53 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP PP PPPP P P P Sbjct: 67 PPPTSPPPPSPPPPSPPPPSPPPP 90 Score = 32.3 bits (70), Expect = 0.53 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP PP PPPP P P P Sbjct: 72 PPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 473 PXXXGPXPPPXPRXXXPXPPPXPXPXPXPXXXXF 574 P P PP P P PPP P P P F Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPPPAF 97 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/39 (33%), Positives = 15/39 (38%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 P PPP PP + P PPP P P + P Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSPPPPAFAVGKTP 103 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPP 530 PP P +P PPPP P PPP Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP PP PPPP P P P Sbjct: 64 PPPP--PPTSPPPPSPPPPSPPPP 85 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/18 (61%), Positives = 11/18 (61%), Gaps = 1/18 (5%) Frame = +1 Query: 814 PXXXPPXPPPP-PPPXXP 864 P PP PPPP PPP P Sbjct: 75 PSPPPPSPPPPSPPPPSP 92 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 G G G GG G GG GG G R GGGGGG G G Sbjct: 96 GSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGG 147 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G GG GG GGG G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSG 119 Score = 35.1 bits (77), Expect = 0.076 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG + G R G G GG GGG G GG G GG G Sbjct: 92 GGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGG 138 Score = 33.9 bits (74), Expect = 0.17 Identities = 20/56 (35%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXG---GXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 +GGG G+ GG G G G GGG G GG G G G RG Sbjct: 87 SGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRG 142 Score = 32.7 bits (71), Expect = 0.40 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 +GGG GG G GG GG G R GGG GG G G Sbjct: 118 SGGGGGGYERRSGGYGSG--GGGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 168 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G G G G GG GG GGG G Sbjct: 137 GGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 168 Score = 31.9 bits (69), Expect = 0.71 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPP 794 A G G RGG G G GGG G GGGGGG G Sbjct: 82 AQSRGSGGGGGGRGGSGGGYRSGGGGGYSGGGG----GGYSGGGGGGYERRSGGYGSGGG 137 Query: 793 AXGRXXRG 770 GR G Sbjct: 138 GGGRGYGG 145 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 GG G GGG G GGGG G G GG Sbjct: 130 GGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGG 165 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXA--RXXXXXXGGGGGGGXGXXXRG 812 +GGG G GG GG G G G GGG GGG G G Sbjct: 110 SGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGG 164 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G GG GGGG G GGGG G G Sbjct: 104 GGGGGYSGGGGGGYSGGGGGGYERRSGGYG 133 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXG 466 G G G G GGG G GGG G G G Sbjct: 136 GGGGGRGYGGGGRREGGGYGGGDGGSYGGGG 166 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GG GGG G G GGG G G Sbjct: 114 GGGYSGGGGGGYERRSGGYGSGGGGGGRGYGG 145 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXR 874 GGG GG G G GG G GGG R Sbjct: 119 GGGGGGYERRSGGYGSGGGGGGRGYGGGGRR 149 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -1 Query: 960 GAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 G+ G GG G G G GGG GG G Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGG 115 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = -3 Query: 559 GXGXXGGXGGG---GGXXXXGXGGGGGPXXXGVXG 464 G G GG GGG GG GGGGG G G Sbjct: 90 GGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G G GGGG G GGG G G G Sbjct: 136 GGGGGRGYGGGGRREGGGYGGGDGGSYGGGGG 167 Score = 28.3 bits (60), Expect = 8.7 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXG----GGGGPXXXGVXGXPXPXXXGG 437 G GG GG GG G G GGGG G G GG Sbjct: 89 GGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGG 131 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = -1 Query: 222 GXGXXXGX--XGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGGG GG G G + G G GG Sbjct: 93 GRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGG 136 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +3 Query: 486 GPPPPPX-PXXXXPPPPPXPPXXPXPXXVRF 575 GPPPP P PPPPP PP P P V F Sbjct: 19 GPPPPVGVPPQYYPPPPPPPPPPPPPRKVGF 49 Score = 34.3 bits (75), Expect = 0.13 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 805 GXXPXXXPPXPPPPPPPXXP 864 G P PP PPPPPPP P Sbjct: 25 GVPPQYYPPPPPPPPPPPPP 44 Score = 32.7 bits (71), Expect = 0.40 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXP 205 P P P P PP + PP PPPPP P Sbjct: 9 PYPAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPPP 43 Score = 31.9 bits (69), Expect = 0.71 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 P P PPP P PPP P PPPR Sbjct: 13 PGNYPQGPPPPVGVPPQYYPPPPPPPPPPPPPR 45 Score = 31.9 bits (69), Expect = 0.71 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP PP PPPP P P P Sbjct: 21 PPPVGVPPQYYPPPPPPPPPPPPP 44 Score = 31.5 bits (68), Expect = 0.93 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPP 545 P G PP P PPPPP PP Sbjct: 21 PPPVGVPPQYYPPPPPPPPPPPPP 44 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 137 PLFXXPPPXWXPPXXPPPPPXXP 205 P PP + PP PPPPP P Sbjct: 22 PPVGVPPQYYPPPPPPPPPPPPP 44 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 804 GXXPLXXXPXPPPPPPP 854 G P P PPPPPPP Sbjct: 25 GVPPQYYPPPPPPPPPP 41 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPR 938 P P P P P P PP PP P PPR Sbjct: 4 PKYAYPYPAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPPPPR 45 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 GG + R GG G GG GGG G GGGGGGG Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GG GGGGG G GGGGG G G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGG 99 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GG GGGGG G GGGGG G G Sbjct: 80 GGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGG 111 Score = 36.7 bits (81), Expect = 0.025 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG GGGGG G GGGGG Sbjct: 77 GGGGGGGGGGGGGGGGWGWGGGGG 100 Score = 36.7 bits (81), Expect = 0.025 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG GGGGG G GGGGG Sbjct: 79 GGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 35.5 bits (78), Expect = 0.057 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 G G G GGGGG GG GGG G + G G G Sbjct: 75 GGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKG 115 Score = 35.1 bits (77), Expect = 0.076 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -3 Query: 571 RTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 R G G GG GGGGG G GGGG G G Sbjct: 66 RWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGG 101 Score = 34.7 bits (76), Expect = 0.10 Identities = 23/66 (34%), Positives = 23/66 (34%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPPAX 788 G G GG G GG GGG G GGGGGG G G Sbjct: 61 GSGSYRWGWGGGGGGGGGGGGGGGGGGGGGG----GWGWGGGGGGGGWYKWGCGGGGKGK 116 Query: 787 GRXXRG 770 GR RG Sbjct: 117 GREGRG 122 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGGGG G GGG G G G GG Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGG 111 Score = 33.9 bits (74), Expect = 0.17 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 204 GXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G GGGGG GG GGG G G G GG Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G GGGGG GG GGG G G G GG Sbjct: 61 GSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 32.7 bits (71), Expect = 0.40 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G G GGG G G GGG G G G GG Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGG 111 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G GGGGG G GGGGG G G GG Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGG 491 G GG GGGGG G GGGG Sbjct: 91 GGWGWGGGGGGGGWYKWGCGGGG 113 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -1 Query: 222 GXGXXXGXXGGGGG-XXGGXXXGGGXXXXGXXQXXKXGXGXGGXXXXXKR 76 G G G GGGGG GG GGG G K G G G KR Sbjct: 79 GGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGK-GKGREGRGEFVKR 127 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXG 466 G G G G GGG G G GGG G G Sbjct: 82 GGGGGGGGGGGWGWGGGGGGGGWYKWGCGGG 112 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GGGG G GGGGG G G GG Sbjct: 61 GSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGG 101 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 Query: 574 KRTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 KR+ G G GGG G GGGGG G G Sbjct: 55 KRSYNGGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGG 91 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -3 Query: 943 GARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGG-GXGXXXRG 812 G G G GG GGG G GGGGGG G G G Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGG---GGGGGGGGGGWGWGGGGGG 101 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPPAX 788 GGG G GG G GG GGG GGGGGG G P A Sbjct: 371 GGGVQMNGGPNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGGGGGGPQSMSMPMGGAM 430 Query: 787 G 785 G Sbjct: 431 G 431 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG G GG G G GGG GGGGGGG G Sbjct: 348 GGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGG 394 Score = 35.1 bits (77), Expect = 0.076 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 204 GXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G GGGGG G GGG G K G G GG Sbjct: 356 GKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGG 391 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -3 Query: 919 GXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXP 803 G GG GGG + GGGGGGG G G P Sbjct: 103 GKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGPP 141 Score = 33.9 bits (74), Expect = 0.17 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 919 GXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXP 803 G GG GGG GGGGGGG G G P Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGP 140 Score = 33.9 bits (74), Expect = 0.17 Identities = 36/154 (23%), Positives = 40/154 (25%), Gaps = 5/154 (3%) Frame = -3 Query: 967 GGGXXAXRGARGGXXX--GXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPP 794 GGG +G GG G GGG G G GGGG G Sbjct: 316 GGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQ 375 Query: 793 AXGRXXRGXXXXXXXXXXXXGPPP---PPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLX 623 G G GP PP G G G P + P + Sbjct: 376 MNGGPNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGGGGGGPQSMSMPMGGAMGGPMG 435 Query: 622 VXXXXXXGRXPPPXXXKRTXXGXGXXGGXGGGGG 521 G P + G GGGGG Sbjct: 436 SLPQMGGGPGPMSNNMQAVQGLPAMGPGGGGGGG 469 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G GG GGGG G GGGGGP G+ P GG Sbjct: 379 GPNGGKKGGGG----GGGGGGGPMSGGLPPGFRPMGGGG 413 Score = 32.3 bits (70), Expect = 0.53 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG P G G GG GGG GGG G Sbjct: 108 GGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGGP 485 GG GGGGG G GGGGGP Sbjct: 123 GGGGGGGG--GGGGGGGGGP 140 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G G GG GGG GGG G Sbjct: 107 GGGGGGPANNNKGQKIGGGGGGGGGGGGGGGG 138 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 541 GXGGGGGXXXXGXGGGGGP 485 G GGGGG G GGGG P Sbjct: 123 GGGGGGGGGGGGGGGGGPP 141 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG GGGG GGGGG Sbjct: 340 GGGKNGGKGGGGHPLDGKMGGGGG 363 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 6/38 (15%) Frame = -3 Query: 553 GXXGGXGGGG------GXXXXGXGGGGGPXXXGVXGXP 458 G GG GGGG G G GGGGG G G P Sbjct: 103 GKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGP 140 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGG 488 GG GGG G G GGGGG Sbjct: 313 GGGGGGPGGKKGGPGGGGG 331 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 5/47 (10%) Frame = -1 Query: 222 GXGXXXGXXGGGGG-----XXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGGG GG GG G K G G GG Sbjct: 318 GPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGG 364 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G G GGGG G GGGG G G GG Sbjct: 339 GGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGG 379 Score = 29.5 bits (63), Expect = 3.8 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = -2 Query: 965 GGXXGPPXGXGGVXGGXXXXXXXXXXXXXXXXAXGXXGGGGGGGXGGXXXGXXPXPPRAR 786 GG P G G GG G GGGGGG GG PP R Sbjct: 348 GGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGGPMSGGLPPGFR 407 Query: 785 AXXPG 771 G Sbjct: 408 PMGGG 412 Score = 29.1 bits (62), Expect = 5.0 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = -3 Query: 553 GXXGGXG-GGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPP 422 G GG G GGG GGGG G G P GG P Sbjct: 321 GKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGP 365 Score = 29.1 bits (62), Expect = 5.0 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGP---XXXGVXGXPXPXXXGG 437 G G G GGG G GGGG P G G P GG Sbjct: 329 GGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGG 372 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 934 GGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG G GG G GGGGGGG G Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 +GGG G GG GGG GGG G Sbjct: 104 KGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGG 136 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -2 Query: 851 GGGGGGXGGXXXGXXPXPPR 792 GGGGGG GG G PP+ Sbjct: 123 GGGGGGGGGGGGGGGGGPPK 142 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/59 (28%), Positives = 19/59 (32%) Frame = +3 Query: 558 PXXVRFXXXGGGXRPXXXXXXTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGP 734 P V+ GGG + G G G G G P GGGGGP Sbjct: 307 PFPVQMGGGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGP 365 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 654 GAXGAXGXPGPXGXPXXXXPXGGGGG 731 G G G P G P P GGGGG Sbjct: 389 GGGGGGGGPMSGGLPPGFRPMGGGGG 414 Score = 28.3 bits (60), Expect = 8.7 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 8/40 (20%) Frame = -3 Query: 553 GXXGGXGGGGGXXXX--------GXGGGGGPXXXGVXGXP 458 G GG GGGGG G GGGGG G G P Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGPP 141 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 943 GARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 G GG G GG GGG G GGG GG G Sbjct: 313 GGGGGGPGGKKGGPGGG---GGNMGNQNQGGGGKNGGKG 348 Score = 28.3 bits (60), Expect = 8.7 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = -3 Query: 586 PXXXKRTXXGXGXXGGXGGGGGXXXXGXGGG--GGPXXXGVXGXP 458 P K G G G GGGG G GG GG G G P Sbjct: 353 PLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGGP 397 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = -3 Query: 946 RGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 +G GG G GG GGG G GGGG GG G RG Sbjct: 83 QGNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGRG 127 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G GG G G GG GGG GGG RG Sbjct: 147 GGGGYGGGGGGYGGGGGYGGGGGGYGGGGRG 177 Score = 35.9 bits (79), Expect = 0.043 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G GGG G GG GGG GGG Sbjct: 155 GGGYGGGGGYGGGGGGYGGGGRGGGGGGG 183 Score = 35.5 bits (78), Expect = 0.057 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G G GGG GG GGG G + G G GG Sbjct: 87 GGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGRGG 128 Score = 35.5 bits (78), Expect = 0.057 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G GGG G G G GGG GGG G Sbjct: 152 GGGGGGYGGGGGYGGGGGGYGGGGRGGGGGG 182 Score = 35.1 bits (77), Expect = 0.076 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 G G RGG G GG G G G GGGG GG Sbjct: 84 GNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGRGG 128 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G G G G G GG GG GGG G Sbjct: 147 GGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGG 178 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 934 GGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG G GG GGG G G GGGGG G Sbjct: 148 GGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGGG 183 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G GG G G GG GG GGG Sbjct: 154 GGGGYGGGGGYGGGGGGYGGGGRGGGGGG 182 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG GGGGG G GGGG Sbjct: 157 GYGGGGGYGGGGGGYGGGGRGGGG 180 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 G P G GG G GG GGG GGG Sbjct: 76 GPDGAPVQGNSGGGSSGGRGGFGGGRGGG 104 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G G G G G GG G G GGG Sbjct: 153 GGGGGYGGGGGYGGGGGGYGGGGRGGGGG 181 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG GGG G G GGGGG Sbjct: 160 GGGGYGGGGGGYGGGGRGGGGGGG 183 Score = 32.3 bits (70), Expect = 0.53 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G GG GGGGG G G GGG G G Sbjct: 153 GGGGGYGGGGGYGGGGGGYGGGGRGGGGGG 182 Score = 31.5 bits (68), Expect = 0.93 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 GGG G GG G GG GGG G GGGGGGG Sbjct: 148 GGGYGGGGGGYGGG--GGYGGGGGGYGGGGR-------GGGGGGG 183 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -1 Query: 204 GXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G GGGGG GG GGG G + G G GG Sbjct: 150 GYGGGGGGYGGGGGYGGGGGGYGG--GGRGGGGGGG 183 Score = 31.1 bits (67), Expect = 1.2 Identities = 24/65 (36%), Positives = 25/65 (38%), Gaps = 13/65 (20%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXG--GXGGGXXXGX-----------ARXXXXXXGGGGGGGXG 827 GGG RG+ GG G G G GGG G AR GG GGGG G Sbjct: 98 GGGRGGGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGGGGG 157 Query: 826 XXXRG 812 G Sbjct: 158 YGGGG 162 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGG 151 G G G GGGGG GG GGG Sbjct: 157 GYGGGGGYGGGGGGYGGGGRGGGG 180 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXP 458 G G GG GGGGG GGG G G P Sbjct: 104 GRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEP 137 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGGPXXXGVXG 464 GG GGGGG G G GGG G G Sbjct: 149 GGYGGGGGGYGGGGGYGGGGGGYGGGG 175 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG GGG G GGGGG Sbjct: 93 GRGGFGGGRGGGRGSGGGYGGGGG 116 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GG GGGG G GGGGG G G Sbjct: 147 GGGGYGG-GGGGYGGGGGYGGGGGGYGGGGRG 177 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXG 466 G G G G GGG G G GGG G G Sbjct: 153 GGGGGYGGGGGYGGGGGGYGGGGRGGGGGGG 183 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 GG G GGG G GGG G G G GG Sbjct: 147 GGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGG 182 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G GG GGG G GGGGG G G Sbjct: 96 GFGGGRGGGRGSGGGYGGGGGGYGGRGGGG 125 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 195 GGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 GGG G GG GGG G G G GG Sbjct: 148 GGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGG 180 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG + G GGG G GGGGGG G RG Sbjct: 127 GGSDCYKCGEPGHMARDCSEGGGGYGGGGGGYGGGGGYGGGGGGYGGGGRG 177 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 39.1 bits (87), Expect = 0.005 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 5/70 (7%) Frame = +3 Query: 774 RXXRPXAGGXGXXPLXXXPXPPPPP---PPXXXXXXRAXPXXXPPPXPPXXPXXXPP--R 938 R P A P P PPPPP PP P PPP PP PP Sbjct: 515 RRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFS 574 Query: 939 APRXAXXPPP 968 P PPP Sbjct: 575 PPPPVYSPPP 584 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXW--XPPXXPPPPPXXPXXXPXP 223 PP P P P+F PPP + PP PPPP P P Sbjct: 558 PPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAP 601 Score = 37.5 bits (83), Expect = 0.014 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPP----PPXPXXXXPPPPPXPPXXPXP 560 PP P P PPP PP P PPPPP P P P Sbjct: 526 PPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPP 570 Score = 37.1 bits (82), Expect = 0.019 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PP P P PPP P PPP Sbjct: 534 PPPPPPVHSPPPPVHSPPPPPVYSPPPPP 562 Score = 36.7 bits (81), Expect = 0.025 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 8/60 (13%) Frame = +3 Query: 813 PLXXXPXPPP-----PPPPXXXXXXRAXPXXXPPP---XPPXXPXXXPPRAPRXAXXPPP 968 P+ PPP PPPP P PPP PP P PP P PPP Sbjct: 511 PVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPP 570 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPP---PPXPPXXPXP 560 P P PPPPP P PPP PP P P P Sbjct: 550 PPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPP 584 Score = 35.5 bits (78), Expect = 0.057 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPP---PXXPXXXPXP 223 PP P P P+ PPP P PPPP P P P P Sbjct: 533 PPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPP 577 Score = 35.1 bits (77), Expect = 0.076 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 9/71 (12%) Frame = +3 Query: 786 PXAGGXGXXPLXXXPXPPP----PPPPXXXXXXRAXP--XXXPPPXPP---XXPXXXPPR 938 P A P P PPP PPPP P PPP PP P PP Sbjct: 598 PPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPP 657 Query: 939 APRXAXXPPPA 971 AP PPA Sbjct: 658 APVEKKETPPA 668 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +3 Query: 834 PPPP---PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 PPPP PPP P PPP PP P +P + PP Sbjct: 589 PPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPP 635 Score = 34.3 bits (75), Expect = 0.13 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 875 RXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 R PPP P PP PPP P PPP Sbjct: 516 RSPPPAPVNSPPPPVYSPPPPPPPVHSPPPP 546 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXP---PPPPXXPXXXPXP 223 PP P P+ PPP PP P PPPP P P P Sbjct: 526 PPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPP 570 Score = 33.9 bits (74), Expect = 0.17 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 PPP P PP P PPP P PP Sbjct: 544 PPPVHSPPPPPVYSPPPPPPPVHSPPPP 571 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 5/46 (10%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPP---PXPXXXXPPPPP--XPPXXPXP 560 PP P PPPP P P PPPPP PP P P Sbjct: 519 PPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPP 564 Score = 33.1 bits (72), Expect = 0.31 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 5/57 (8%) Frame = +3 Query: 813 PLXXXPXPP---PPPPPXXXXXXRAXPXXXPPP--XPPXXPXXXPPRAPRXAXXPPP 968 P P PP PPPPP P PPP P P PP P PPP Sbjct: 538 PPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPP--PPVHSPPPP 592 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P P P PPP P PPP Sbjct: 596 PPPPAPVHSPPPPVHSPPPPPPVYSPPPP 624 Score = 32.3 bits (70), Expect = 0.53 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 4/55 (7%) Frame = +3 Query: 813 PLXXXPXPPPP--PPPXXXXXXRAXPXXXPPP--XPPXXPXXXPPRAPRXAXXPP 965 P+ P PPPP PP PPP PP PP AP + PP Sbjct: 554 PVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPP 608 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPP--PPXPXXXXPPPPPXPPXXPXP 560 PP P P PPP P P PPPP P P P Sbjct: 559 PPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAP 601 Score = 31.9 bits (69), Expect = 0.71 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +3 Query: 465 PXTPXXXGPPPP---PXPXXXXPPPPPXPPXXPXP 560 P T PP P P P PPPPP P P P Sbjct: 511 PVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPP 545 Score = 31.9 bits (69), Expect = 0.71 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 5/58 (8%) Frame = +3 Query: 813 PLXXXPXPPP--PPPPXXXXXXRAXPXXXPPPXP---PXXPXXXPPRAPRXAXXPPPA 971 P P PPP PPP P PP P P P PP P PPPA Sbjct: 545 PPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPP--PPVHSPPPPA 600 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P PP P P P P PPP Sbjct: 550 PPPPPVYSPPPPPPPVHSPPPPVFSPPPP 578 Score = 31.5 bits (68), Expect = 0.93 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPP--RAPRXAXXPPPA 971 P+ P P PPP P PPP P P PP P PPP+ Sbjct: 578 PVYSPPPPVHSPPPPVHSPPPPAPVHSPPP-PVHSPPPPPPVYSPPPPVFSPPPS 631 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 PPP PPP P PP P PP Sbjct: 558 PPPPPPPVHSPPPPVFSPPPPVYSPPPP 585 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPP---PPXPXXXXPPPPP--XPPXXPXPXXV 569 PP P P PPP PP P PPPP PP P V Sbjct: 589 PPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVV 637 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/58 (32%), Positives = 22/58 (37%), Gaps = 6/58 (10%) Frame = +3 Query: 813 PLXXXPXP---PPPPPPXXXXXXRAXPXXXPPPX--PPXXPXXXPP-RAPRXAXXPPP 968 P+ P P PPPP P PPP PP PP ++P PPP Sbjct: 585 PVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPP 642 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P P P+F PPP PP PPP P P Sbjct: 612 PPPPPPVYSPPPPVFS-PPPSQSPPVVYSPPPRPPKINSPP 651 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/31 (41%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +2 Query: 137 PLFXXPPPXWXPPXXPPP--PPXXPXXXPXP 223 P+ PPP + PP PPP P P P P Sbjct: 522 PVNSPPPPVYSPPPPPPPVHSPPPPVHSPPP 552 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 4/45 (8%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPX----PXXXXPPPPPXPPXXPXP 560 PP P P PPPPP P PPP PP P Sbjct: 596 PPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSP 640 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 467 PHPXXXGPXPPPXPRXXXPXPPPXPXPXP 553 P P P PPP P P P P P P Sbjct: 526 PPPPVYSPPPPPPPVHSPPPPVHSPPPPP 554 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 6/48 (12%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPP---XXPPPP---PXXPXXXPXP 223 PP P P+ PPP + PP PPPP P P P P Sbjct: 551 PPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPP 598 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PP PPP P P P P PPP Sbjct: 554 PVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPP 585 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +3 Query: 465 PXTPXXXGPPP---PPXPXXXXPPPPPXPPXXPXP 560 P P PPP PP P PPPP P P Sbjct: 582 PPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPP 616 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 7/51 (13%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPX----PXXXXPPPP---PXPPXXPXPXXV 569 PP P PPPPP P PPPP P PP P V Sbjct: 543 PPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPV 593 Score = 28.3 bits (60), Expect = 8.7 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPPP--PPPPXXXXXXRAXPXXXPPPXP---PXXPXXXPPRAPRXAXXPPP 968 P PP P P PPP P P P PP P PPP Sbjct: 494 PQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPP 545 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/63 (33%), Positives = 23/63 (36%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPP 794 A GGG +GA GG G GG G GGGGGG +G P Sbjct: 263 AGGGGAGGGKGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGGGGGPNAGKKGNGGGGP 322 Query: 793 AXG 785 G Sbjct: 323 MAG 325 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = -3 Query: 574 KRTXXGXGXXGGXGGGGGXXXXGX--GGGGGPXXXGVXGXPXPXXXGG 437 K G G GGGGG G GGGGP GV G P GG Sbjct: 291 KNGGGGHPQDGKNGGGGGGPNAGKKGNGGGGPMAGGVSGGFRPMGGGG 338 Score = 32.7 bits (71), Expect = 0.40 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -3 Query: 919 GXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 G GG GGG + GGGGGGG G Sbjct: 100 GKAGGGGGGNNNNNKKGQKNGGGGGGGGGGG 130 Score = 31.9 bits (69), Expect = 0.71 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = -1 Query: 231 PPXGXGXXXGXXGGGGGXXGGX---XXGGG-XXXXGXXQXXKXGXGXGG 97 P G G G G GGG GG GGG G Q K G G GG Sbjct: 261 PAAGGGGAGGGKGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGGGGG 309 Score = 30.3 bits (65), Expect = 2.2 Identities = 21/68 (30%), Positives = 22/68 (32%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPP 794 A GG A A GG G G GGG G GGGG G P Sbjct: 253 AKNGGKGAP--AAGGGGAGGGKGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGGGGGP 310 Query: 793 AXGRXXRG 770 G+ G Sbjct: 311 NAGKKGNG 318 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -1 Query: 552 GXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G GGG +G GGG GP G P GG Sbjct: 301 GKNGGGGGGPNAGKKGNGGG-GPMAGGVSGGFRPMGGGG 338 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -1 Query: 228 PXGXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 P G GGGG GG GGG Q G GG Sbjct: 252 PAKNGGKGAPAAGGGGAGGGKGAGGGAKGGPGNQNQGGGKNGGG 295 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 881 PPPXP---PPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PP P P P P P P PPP Sbjct: 421 PPPAVNYMPPNPHQYPNPHPYPYPYPYPYPPP 452 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGG 488 GG GGGG G GGGG Sbjct: 289 GGKNGGGGHPQDGKNGGGG 307 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 G +G GG G GG GGG G GGGGGGG Sbjct: 8 GSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGG 51 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG+ G GG G G GG GGG GGG +G Sbjct: 5 GGSGSGGGGKGGGGGGSGGGRGGGGGGGAKG 35 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/46 (39%), Positives = 20/46 (43%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG + G +GG G GG GGG G GGGGG G Sbjct: 5 GGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGG 50 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGG 836 +G G G GG G GG GGG G GGGGGG Sbjct: 7 SGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGG 51 Score = 35.9 bits (79), Expect = 0.043 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = -3 Query: 961 GXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXP 797 G G+ GG G GG GGG G GGGG G G G P Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAP 56 Score = 35.9 bits (79), Expect = 0.043 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 GG GGGGG G GGGGG G G GG Sbjct: 12 GGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGG 47 Score = 35.5 bits (78), Expect = 0.057 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G G G GG GG G GGGG GG G Sbjct: 84 GGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSG 135 Score = 35.1 bits (77), Expect = 0.076 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGG G G GGGG G G GG Sbjct: 10 GGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGG 50 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGG--XXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGGG GG GGG G K G G GG Sbjct: 6 GSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGG 49 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 +GGG G GG G GG G G GGG GG G Sbjct: 91 SGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGGGG 138 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G G GGGGG GGGGG G G GG Sbjct: 8 GSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGG 48 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -3 Query: 937 RGGXXXGXXGGXGGGXXXGXARXXXXXXGGG--GGGGXGXXXRG 812 +GG G GG GGG G GGG GGGG G G Sbjct: 74 KGGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGG 117 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 216 GXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G GGGG GG GG G K G G GG Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGG 41 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = -3 Query: 571 RTXXGXGXXGGXGGGGGXXXXGXGGGGG 488 ++ G G GG GGGGG G GGGGG Sbjct: 98 KSGCGGGKSGG-GGGGGKNGGGCGGGGG 124 Score = 32.7 bits (71), Expect = 0.40 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G GG G GGG G GG GG G G GG Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGG 40 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G GGGGG GG GGG G K G G GG Sbjct: 100 GCGGGKSGGGGGGGKNGGGCGGGGGGKGG-----KSGGGSGG 136 Score = 31.5 bits (68), Expect = 0.93 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -1 Query: 552 GXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G GGG RG GGG G G ++ GG Sbjct: 11 GGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGG 49 Score = 31.5 bits (68), Expect = 0.93 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = -3 Query: 970 AGGGXXAXRGARG--GXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 +GGG G G G G G GGG G G GGGGG Sbjct: 77 SGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGG 124 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = -3 Query: 943 GARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGG--GGGXGXXXRG 812 G +GG G G G G G GGGG GGG G G Sbjct: 80 GGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGG 125 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GGGG G G GGG G G GG Sbjct: 3 GKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGG 41 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -3 Query: 559 GXGXXGGXGG-GGGXXXXGXGGGGG 488 G G G GG GGG G GGGGG Sbjct: 27 GGGGGGAKGGCGGGGKSGGGGGGGG 51 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -1 Query: 228 PXGXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 P G G GGGGG G GG G G G G Sbjct: 73 PKGGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNG 116 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G GGG G G GGG G G GG Sbjct: 10 GGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGG 50 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGGXXPPP 421 G G G G GG G G GGG G G GG P Sbjct: 11 GGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAP 56 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGG 491 G GG GGGGG G G GG Sbjct: 75 GGSGGGGKGGGGGGGISGGGAGG 97 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/54 (35%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGG--GGGGGXGXXXRG 812 G G G GG G GG GG G + GG GGG G G +G Sbjct: 76 GSGGGGKGGGGGGGISG--GGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKG 127 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GGGGG G GGGG G G Sbjct: 100 GCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSG 131 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGG 488 G GG GGG G G GGGG Sbjct: 117 GGCGGGGGGKGGKSGGGSGGGG 138 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = -1 Query: 960 GAXPXXGXGGGXGXGXXGGXGG---GXGGGXRG 871 G G GGG G G GG G G GGG G Sbjct: 75 GGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSG 107 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGG 491 G G GG GGGG G GGG Sbjct: 111 GGGKNGGGCGGGGGGKGGKSGGG 133 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 5/56 (8%) Frame = +3 Query: 813 PLXXXPXPP---PPPPPXXXXXXRAXPXXXPPPXP--PXXPXXXPPRAPRXAXXPP 965 P P PP PPPPP P PPP P P P PP P PP Sbjct: 101 PTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPP 156 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXP-PXXPXP 560 P P PPP P P PPPPP P P P P Sbjct: 146 PPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKP 178 Score = 37.1 bits (82), Expect = 0.019 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 5/57 (8%) Frame = +3 Query: 813 PLXXXPXPP---PPPPPXXXXXXRAXPXXXPPPX--PPXXPXXXPPRAPRXAXXPPP 968 P P PP PPPPP PPP PP P PP P PPP Sbjct: 77 PPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPP 133 Score = 37.1 bits (82), Expect = 0.019 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P P P P P PP P PPP Sbjct: 121 PPPPPTPYTPPPPTPYTPPPPTVKPPPPP 149 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PPPP P P PP P PP P PPP Sbjct: 71 PYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPP 117 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 8/60 (13%) Frame = +3 Query: 813 PLXXXPXPP---PPPPPXXXXXXRAXPXXXPPP--XPPXXPXXXPP---RAPRXAXXPPP 968 P P PP PPPPP P PPP PP P PP P PPP Sbjct: 109 PYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPP 168 Score = 36.3 bits (80), Expect = 0.033 Identities = 21/69 (30%), Positives = 22/69 (31%), Gaps = 3/69 (4%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPXPP---PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRA 941 P +P P P PP PPPPP PPP P P P Sbjct: 79 PYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTP 138 Query: 942 PRXAXXPPP 968 P PPP Sbjct: 139 PPPTVKPPP 147 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPP----PPXPXXXXPPPPPXPPXXPXP 560 PP P P PPP PP P PPPPP P P P Sbjct: 89 PPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPP 133 Score = 36.3 bits (80), Expect = 0.033 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P PP P PPP P PPP Sbjct: 97 PPPPPTVKPPPPPYVKPPPPPTVKPPPPP 125 Score = 36.3 bits (80), Expect = 0.033 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P PP P P PP P PPP Sbjct: 113 PPPPPTVKPPPPPTPYTPPPPTPYTPPPP 141 Score = 35.5 bits (78), Expect = 0.057 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 467 PHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 P P PPP P P PPP P P P P Sbjct: 145 PPPPPVVTPPPPTPTPEAPCPPPPPTPYPPP 175 Score = 35.1 bits (77), Expect = 0.076 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPP---PPPXPXXXXPPPPPXP--PXXPXP 560 PP P TP PP PPP P PPP P P P P P Sbjct: 123 PPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPP 168 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 7/48 (14%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPP----PXPXXXXPPPPP---XPPXXPXP 560 PP P P PPPP P P PPPPP PP P P Sbjct: 113 PPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTP 160 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 440 PXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXP 553 P + P P P P P P P PPP P P P Sbjct: 138 PPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPP 175 Score = 33.9 bits (74), Expect = 0.17 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PP P PP PP P PP P+ PP Sbjct: 45 PAKPPKPPTVKPPTHTPKPPTVKPP-PPYIPCPPPPYTPKPPTVKPP 90 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPX--PPXXPXXXPPRAPRXAXXPPP 968 P P PP PP P PP PP P PP P PPP Sbjct: 56 PPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPP 109 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 PP P TP PPP P PPPP P P Sbjct: 70 PPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPP 108 Score = 33.9 bits (74), Expect = 0.17 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPP---PXPPXXPXPXXV 569 P P PPPPP P PP P P P P P V Sbjct: 113 PPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPV 150 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +2 Query: 875 RXPPPX----PPPXPPXXPXPXPPPXPXXGXAPPP 967 + PPP PPP P P PPP P PPP Sbjct: 67 KPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPP 101 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPP----PPPXPPXXPXPXXVR 572 P P PPPPP PP PPP P P P V+ Sbjct: 105 PPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVK 144 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP 536 PP P TP P PPP P PPP P Sbjct: 146 PPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKP 178 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +3 Query: 813 PLXXXPXPP---PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPR 938 P P PP PPPPP P P PP P PP+ Sbjct: 133 PTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPK 177 Score = 32.7 bits (71), Expect = 0.40 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPP---PPPXPXXXXPPPP-PXPPXXPXP 560 PP P T PP PPP P PPPP P P P P Sbjct: 91 PPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTP 135 Score = 32.7 bits (71), Expect = 0.40 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Frame = +3 Query: 813 PLXXXPXPPPP-PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P P PP P PP P PPP P PP P PP Sbjct: 125 PTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPP 176 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWX----PPXXPPPPPXXPXXXPXP 223 P P P P PPP + PP PPPP P P P Sbjct: 89 PPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPP 133 Score = 31.9 bits (69), Expect = 0.71 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +1 Query: 826 PPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 P PPPPP P PP P P P PPP Sbjct: 85 PTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPP 132 Score = 31.9 bits (69), Expect = 0.71 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 PP P P PPPPP P PP P PP Sbjct: 105 PPPPPYVKPPPPPTVK-PPPPPTPYTPPPPTPYTPP 139 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 P PP PP P P PP P PPP+ Sbjct: 145 PPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPK 177 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P P PP P PP P P PP P PPP Sbjct: 34 PSPHPVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPP-PPYIPCPPPP 79 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXP--PPXPPXXPXXXPPRAPRXAXXPPP 968 P P PPPP P P P P PP P P PPP Sbjct: 122 PPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPP 175 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 4/45 (8%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPPXXPP----PPPXXPXXXPXP 223 P P P P PPP P PP PPP P P P Sbjct: 97 PPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPP 141 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 4/40 (10%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPP----PXPPXXPXPXXVR 572 P P P P P PPPP P PP P P V+ Sbjct: 49 PKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVK 88 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P PPPP P PPP P P P Sbjct: 68 PPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPP 99 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +3 Query: 465 PXTPXXXGPPPP---PXPXXXXPPPPPXPPXXPXPXXVR 572 P P PPPP P P PPPP P P V+ Sbjct: 82 PKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVK 120 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXP-PXXPXXXPPRAPRXAXXPPP 968 P P P PPP PPP P P P PP P PPP Sbjct: 127 PYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTP---YPPPP 176 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P P + P PPP PP PPPP P P Sbjct: 127 PYTPPPPTPYTPPPPTVKPPP---PPVVTPPPPTPTPEAPCP 165 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP P P P P P P P Sbjct: 130 PPPPTPYTP--PPPTVKPPPPPVVTPPPPTPTPEAPCPPPPP 169 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 PP P+ PP P P PPP P P P Sbjct: 69 PPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPP 109 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P P + P PPP PP PPPP P P P Sbjct: 71 PYIPCPPPPYTPKPPTVKPPP---PPYVKPPPP--PTVKPPP 107 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Frame = +2 Query: 440 PXXXGARXXPHPXXXGPXP----PPXPRXXXPXPPPXPXPXPXP 559 P + P P P P PP P P PPP P P P Sbjct: 82 PKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPP 125 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P + PPP PP PPP P P P Sbjct: 122 PPPPTPYTPPPPTP-YTPPPPTVKPP--PPPVVTPPPPTPTP 160 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXP-PPPPXXPXXXP 217 P P P P PPP P P PPPP P P Sbjct: 135 PYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPP 175 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 4/33 (12%) Frame = +2 Query: 881 PPPX---PPPXP-PXXPXPXPPPXPXXGXAPPP 967 PPP PPP P P P P PPP P P P Sbjct: 147 PPPVVTPPPPTPTPEAPCPPPPPTP-YPPPPKP 178 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 3/43 (6%) Frame = +3 Query: 813 PLXXXPXPPP---PPPPXXXXXXRAXPXXXPPPXPPXXPXXXP 932 P P PPP PPPP P P PP P P Sbjct: 140 PPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKPETCP 182 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 826 PPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 PP PPPPPPP PP PP P P PP Sbjct: 120 PPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTITPP 167 Score = 32.7 bits (71), Expect = 0.40 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 3/52 (5%) Frame = +3 Query: 828 PXPPPPPP---PXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 P PPPPPP P PPP PP + PPP A Sbjct: 155 PPPPPPPPTITPPVTTTTTGHHHHRPPPPPPATTTPITNTSDHHQLHPPPPA 206 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 5/41 (12%) Frame = +3 Query: 828 PXPPPPPP-----PXXXXXXRAXPXXXPPPXPPXXPXXXPP 935 P PPPPPP R P PPP PP P PP Sbjct: 97 PPPPPPPPLSAITTTGHHHHRRSP-PPPPPPPPPPPTITPP 136 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 875 RXPPPXPPPXPPXXPXPXPP 934 R PP PPP PP P PP Sbjct: 148 RRSPPPPPPPPPPPPTITPP 167 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 14/44 (31%) Frame = +3 Query: 471 TPXXXGPPPPPXPXXXXP--------------PPPPXPPXXPXP 560 +P PPPPP P P PPPP PP P P Sbjct: 119 SPPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPP 162 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 14/41 (34%) Frame = +3 Query: 489 PPPPPXPXXXXPP--------------PPPXPPXXPXPXXV 569 PPPPP P PP PPP PP P P + Sbjct: 124 PPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTI 164 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 PPP PPP P P PPP P PP R Sbjct: 9 PPPPPPPPPSFRSIPRPPPPPSFRSIPPRR 38 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = +3 Query: 816 LXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 L P PPPPPPP R+ P PPP P + PPP Sbjct: 5 LSFTPPPPPPPPP----SFRSIPRPPPPPSFRSIPPRRHFFKKKSKSLPPP 51 Score = 30.7 bits (66), Expect(2) = 0.018 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPP 545 PPPPP P P PP PP Sbjct: 11 PPPPPPPSFRSIPRPPPPP 29 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXPXXVRF 575 PPPPP P PPP P P F Sbjct: 12 PPPPPPSFRSIPRPPPPPSFRSIPPRRHF 40 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 471 TPXXXGPPPPPXPXXXXPPPPP 536 TP PPPP PPPPP Sbjct: 8 TPPPPPPPPPSFRSIPRPPPPP 29 Score = 25.4 bits (53), Expect(2) = 0.018 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 522 PPPPPXPPXXP 554 PPPPP PP P Sbjct: 50 PPPPPLPPARP 60 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PP P P PPP P PP P P Sbjct: 130 PPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTP 170 Score = 35.1 bits (77), Expect = 0.076 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXR-AXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P P PP P P PPP P P PP P+ PP Sbjct: 95 PTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPP 147 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 4/56 (7%) Frame = +3 Query: 813 PLXXXPXPPPP----PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P+ P PPP PP P PPP P P PP P P P Sbjct: 115 PIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTP 170 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = +3 Query: 813 PLXXXPXPPPP--PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P P PP PP + P PP P P PP P+ PPP+ Sbjct: 85 PPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKP--PTKPPPSTPKPPTKPPPS 137 Score = 32.3 bits (70), Expect = 0.53 Identities = 17/55 (30%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Frame = +3 Query: 813 PLXXXPXPP---PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PP PPP + P PPP P P P P PP Sbjct: 134 PPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPP 188 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P P PP P P P P P Sbjct: 164 PPPTPTPTPPVVTPPTPTPPVITPPTPTP 192 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P PP PP P PP P P P Sbjct: 123 PPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCP 164 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P TP PPP P PPP P P Sbjct: 125 PSTPKPPTKPPPSTPKPPTTKPPPSTPKPP 154 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PP PP PP P P P PP Sbjct: 46 PPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPP 77 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P T P PP P PP PP P P Sbjct: 85 PPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPP 125 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P P P P PP P PP P Sbjct: 119 PPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPP 159 Score = 28.7 bits (61), Expect = 6.6 Identities = 20/68 (29%), Positives = 21/68 (30%), Gaps = 7/68 (10%) Frame = +3 Query: 783 RPXAGGXGXXPLXXXPXPPPP-----PPPXXXXXXRAXPXXXPPPXPP--XXPXXXPPRA 941 +P A P P P PP P P P P P PP P PP Sbjct: 48 KPPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTK 107 Query: 942 PRXAXXPP 965 P PP Sbjct: 108 PHPHPKPP 115 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 P P PP P P P PP P P P + Sbjct: 151 PKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVI 185 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PP PP PPP P P P Sbjct: 99 PPHPKPPTKPHPHP----KPPIVKPPTKPPPSTPKPPTKPPP 136 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P PP P PP P PP P P Sbjct: 105 PTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPP 136 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXP 553 PP P P PP P PPP P P P Sbjct: 134 PPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTP 172 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G G GG GGG GG G Sbjct: 591 GGGYGGGGGYGGGGGYGGGGGYGGGYGGASSG 622 Score = 35.5 bits (78), Expect = 0.057 Identities = 18/34 (52%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXG-GGXRG 871 RGG G GGG G G GG GGG G GG G Sbjct: 584 RGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYG 617 Score = 35.5 bits (78), Expect = 0.057 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G GGG G G G GGG GGG G Sbjct: 588 GGGGGGYGGGGGYGGGGGYGGGGGYGGGYGG 618 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXP 428 G G GG GGGG G G GGG G G GG P Sbjct: 586 GYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYGGEPP 629 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG R G G GG GGG G GGGGG G G Sbjct: 570 GGRDFRREGSFGSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGG 615 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGGG GG GGG G G G GG Sbjct: 586 GYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSG-GYGG 626 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G G G G G GG GG GG G Sbjct: 595 GGGGGYGGGGGYGGGGGYGGGYGGASSGGYGG 626 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 559 GXGXXGGXGGGGG-XXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPPPP 416 G G G GGGGG G GGGGG G G G PP Sbjct: 581 GSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYGGEPP 629 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 934 GGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG G GG GGG G GG GG G Sbjct: 590 GGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYG 625 Score = 28.3 bits (60), Expect = 8.7 Identities = 20/59 (33%), Positives = 21/59 (35%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPPA 791 G G G GG G G GGG G GG GGG G G PP+ Sbjct: 581 GSGRGGYGGGGGGYGGGGGYGGGGGYGGG---------GGYGGGYGGASSGGYGGEPPS 630 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 33.9 bits (74), Expect = 0.17 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXP 554 PPPPP P PPP P P P Sbjct: 165 PPPPPYPSPLPPPPSPSPTPGP 186 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PP PPP PP P P PPP P P P Sbjct: 161 PPLPPP-PPPYPSPLPPP-PSPSPTPGP 186 Score = 32.7 bits (71), Expect(2) = 0.008 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 492 PPPPXPXXXXPPPPPXPPXXPXP 560 PPPP P PPPP P P P Sbjct: 164 PPPPPPYPSPLPPPPSPSPTPGP 186 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 467 PHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 P P P P P P P P P P P P P Sbjct: 182 PTPGPDSPLPSPGPDSPLPLPGPPPSPSPTP 212 Score = 32.3 bits (70), Expect = 0.53 Identities = 15/46 (32%), Positives = 17/46 (36%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P PPPPP P P P P P +P PPP+ Sbjct: 162 PLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPS 207 Score = 31.9 bits (69), Expect = 0.71 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXP 943 P PPP PP P P P P P P Sbjct: 161 PPLPPPPPPYPSPLPPPPSPSPTP 184 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 467 PHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 P P P P P P PPP P P P P Sbjct: 184 PGPDSPLPSPGPDSPLPLPGPPPSPSPTPGP 214 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 473 PXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 P P P P P PPP P P P P Sbjct: 233 PPSSSPTPGPDSPLPSPGPPPSPSPTPGP 261 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXP-XPXPXP 559 PP P P P P P P P P P P P P P Sbjct: 161 PPLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLP 202 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +2 Query: 881 PPPXPPPXP-PXXPXPXPPPXPXXGXAPPP 967 PPP P P P P P P P P P P Sbjct: 232 PPPSSSPTPGPDSPLPSPGPPPSPSPTPGP 261 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXP 962 P P P PPPP P P P P P PP +P P Sbjct: 166 PPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSP-LPLPGPPPSPSPTPGP 214 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/51 (31%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXP-PRAPRXAXXP 962 PL P P P P P P P PP P P P +P + P Sbjct: 173 PLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGP 223 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 467 PHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 P P P P P P P P P P P P Sbjct: 210 PTPGPDSPLPSPGPDSPLPLPGPPPSSSPTP 240 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +3 Query: 486 GPPPP--PXPXXXXPPPPPXPPXXPXP 560 GPPP P P P P P PP P P Sbjct: 231 GPPPSSSPTPGPDSPLPSPGPPPSPSP 257 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +3 Query: 438 PPXXXGXGXPXTPXX-XGPPPPPXPXXXXPPPPPXP-PXXPXP 560 PP P +P GPPP P P P P P P P P Sbjct: 233 PPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLP 275 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PP PP P P PP P P P Sbjct: 161 PPLPPPPPPYPSPLPPPPSPSPTP 184 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXP-PPXPXXGXAPPP 967 P P P P PP P P P P PPP Sbjct: 221 PGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPP 253 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 471 TPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 TP P P P P P P P PP P P Sbjct: 258 TPGPDSPLPSPGPDSPLPSPGPDPP-LPSP 286 Score = 24.6 bits (51), Expect(2) = 0.008 Identities = 24/102 (23%), Positives = 26/102 (25%), Gaps = 5/102 (4%) Frame = +3 Query: 678 PGPXGXPXXXXPXGGGGGPXXXXXXXXXXXX-PRXXRPXAGGXGXXPLXXXPXPPPPPPP 854 P P P P G P P P PL PP P Sbjct: 180 PSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPT 239 Query: 855 XXXXXXRAXPXXXPPPXP---PXXPXXXP-PRAPRXAXXPPP 968 P P P P P P P P +P + P P Sbjct: 240 PGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDP 281 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRX 950 P P P P PPP PP P PPP P P PP Sbjct: 14 PSHQHPLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPH 73 Query: 951 AXXPPP 968 PPP Sbjct: 74 PHQPPP 79 Score = 35.1 bits (77), Expect = 0.076 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPP-XPPXXPXP 560 P P PPPPP PPPP PP P P Sbjct: 25 PPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPP 57 Score = 35.1 bits (77), Expect = 0.076 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPX--PPXXPXP 560 P PPP P P PPPPP PP P P Sbjct: 61 PHPHPPPPSPYPHPHQPPPPPHVLPPPPPTP 91 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 PP PHP P P P P P PPP P P P Sbjct: 51 PPHQPPPSPYPHPHP--PPPSPYPHPHQPPPPPHVLPPPPP 89 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +3 Query: 813 PLXXXPXPPPPP--PPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PPPP P P PPP P PP P PPP Sbjct: 36 PPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPP 89 Score = 33.9 bits (74), Expect = 0.17 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P P P PPP + PP PPPP P P P Sbjct: 21 PSPVPPPPSHISP----PPPPFSPPHHPPPPHFSPPHQPPP 57 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 P P PPP PP P P PP P P PPP Sbjct: 28 PSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPP 79 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +3 Query: 492 PPPPXPXXXXPPPPPX-PPXXPXP 560 P PP P PPPPP PP P P Sbjct: 23 PVPPPPSHISPPPPPFSPPHHPPP 46 Score = 31.9 bits (69), Expect = 0.71 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +2 Query: 467 PHPXXXGPXP----PPXPRXXXPXPPPXPXP 547 PHP P P PP P P PPP P P Sbjct: 63 PHPPPPSPYPHPHQPPPPPHVLPPPPPTPAP 93 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +2 Query: 467 PHPXXXGPXPPPXPRXXXPX-PPPXPXPXPXP 559 P P P PP P P PPP P P P P Sbjct: 34 PPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHP 65 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P PPPP PPP P P P P Sbjct: 27 PPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPP 67 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 PP P P P PP P PPP P P P P Sbjct: 35 PPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPP-PSPYPHP 74 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 137 PLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P PPP + PP PPP P P P Sbjct: 40 PPHHPPPPHFSPPHQPPPSPYPHPHPPPP 68 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 5/32 (15%) Frame = +2 Query: 872 PRXPPPXP-----PPXPPXXPXPXPPPXPXXG 952 P PPP P P PP P PPP P G Sbjct: 63 PHPPPPSPYPHPHQPPPPPHVLPPPPPTPAPG 94 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXP 920 P PPPP P P PPP P P Sbjct: 63 PHPPPPSPYPHPHQPPPPPHVLPPPPPTPAP 93 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPP 545 P +P PPP P PPPP P Sbjct: 67 PPSPYPHPHQPPPPPHVLPPPPPTPAP 93 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPX--PPXXPXPXXV 569 PPP P P PPP P P P P V Sbjct: 55 PPPSPYPHPHPPPPSPYPHPHQPPPPPHV 83 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PP PPP PP P P P P APPP Sbjct: 1129 PHESPPSPPPQPPSSP-PPPSSPPQLAPAPPP 1159 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 459 GXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 G P P P PPP P PPP P P P Sbjct: 1124 GSPPLPHESPPSPPPQPPSSPPPPSSPPQLAPAP 1157 Score = 33.9 bits (74), Expect = 0.17 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 804 GXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 G PL P PPP P + P P PP PP AP Sbjct: 1124 GSPPLPHESPPSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAP 1170 Score = 31.9 bits (69), Expect = 0.71 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +2 Query: 872 PRXPPPXP---PPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP P PP P P P P P PPP Sbjct: 1133 PPSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPP 1167 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 429 GXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 G P P PPPP P P PPP P P Sbjct: 1124 GSPPLPHESPPSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPP 1167 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 P G+ PH P P P P PP P P P Sbjct: 1119 PSFPAGSPPLPHESPPSPPPQPPSSPPPPSSPPQLAPAPPP 1159 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/63 (28%), Positives = 18/63 (28%), Gaps = 2/63 (3%) Frame = +1 Query: 799 GXGXXPXXXPPXPPPPPP--PXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPPX 972 G P PP PPP PP P P PP P P PP Sbjct: 1124 GSPPLPHESPPSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAPLAPAQSIALPPSS 1183 Query: 973 XXR 981 R Sbjct: 1184 ITR 1186 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP PP PPPP P P P Sbjct: 1136 PPPQ--PPSSPPPPSSPPQLAPAP 1157 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G G G G G GG GGG GGG G Sbjct: 123 GGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDG 154 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GG G GGG G G G GGG GGG Sbjct: 129 GGGGGYGGGGGGYGGGGGGYGGGGDGGG 156 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 571 RTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 R G G G GGG G G GGGGG G G Sbjct: 119 RAYGGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDG 154 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGG 488 G GG GGGGG G GGGG Sbjct: 136 GGGGGYGGGGGGYGGGGDGGGG 157 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGG 151 G G G GGGGG GG GGG Sbjct: 133 GYGGGGGGYGGGGGGYGGGGDGGG 156 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGG 491 G G G GGGGG G GGGG Sbjct: 135 GGGGGGYGGGGGGYGGGGDGGGG 157 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG GGGG G G GGG Sbjct: 133 GYGGGGGGYGGGGGGYGGGGDGGG 156 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = -3 Query: 586 PXXXKRTXXGXGXXGGXGG--GGGXXXXGXGGGGGPXXXGVXG 464 P + G G GG GG GGG G GGG G G G Sbjct: 115 PSAPRAYGGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G GG GGGG G GGGGG G G GG Sbjct: 122 GGGGGYSGGGG----GYGGGGGGYGGGGGGYGGGGDGGG 156 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 934 GGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG G GG GGG G GGGG GG G Sbjct: 124 GGGYSGGGGGYGGG--GGGYGGGGGGYGGGGDGGGG 157 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 216 GXXXGXXGGGGGXXGGXXXGGG 151 G G GGGGG GG GGG Sbjct: 136 GGGGGYGGGGGGYGGGGDGGGG 157 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 195 GGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 GGGG GG GGG G G G GG Sbjct: 123 GGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGG 155 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXG 898 GGG G GGG G G GG G Sbjct: 135 GGGGGGYGGGGGGYGGGGDGGGG 157 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 943 GARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGG 836 G GG G G GGG G G GGGG Sbjct: 122 GGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G G GGG G GG GGG G Sbjct: 129 GGGGGYGGGGGGYGGGGGGYGGGGDGGGG 157 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G GGG G G GG GGG GG RG Sbjct: 44 GGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRG 75 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 G RGA GG G GG GGG G GG GG G G Sbjct: 32 GDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGG 83 Score = 34.7 bits (76), Expect = 0.10 Identities = 22/59 (37%), Positives = 23/59 (38%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXP 797 A+GGG RG GG G GGG G R GG G GG G P P Sbjct: 41 ASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDR------GGRGSGGGGRDGDWRCPNP 93 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G G G G GG GG GGG RG Sbjct: 30 GGGDAGYGGRGASGGGSYGGRGGYGGGGGRG 60 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGG 491 G GG GGGGG G GGGG Sbjct: 48 GGRGGYGGGGGRGNRGGGGGG 68 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGG-GXRG 871 GGG P GG G G GG GGG G G RG Sbjct: 9 GGGGAPIPSYGGD-GYGGGGGYGGGDAGYGGRG 40 Score = 31.5 bits (68), Expect = 0.93 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -3 Query: 571 RTXXGXGXXGGXGG-GGGXXXXGXGGGGGPXXXGVXG 464 R G G GG GG GGG GGGGG G G Sbjct: 39 RGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRG 75 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G G GGG G GGGGG G G Sbjct: 35 GYGGRGASGGGSYGGRGGYGGGGGRGNRGGGG 66 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G G GGG G GGG G + + G G GG Sbjct: 43 GGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGR-GSGGGG 83 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G GGG G G GG GGG GG RG Sbjct: 44 GGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRG 75 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 G RGA GG G GG GGG G GG GG G G Sbjct: 32 GDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGG 83 Score = 34.7 bits (76), Expect = 0.10 Identities = 22/59 (37%), Positives = 23/59 (38%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXP 797 A+GGG RG GG G GGG G R GG G GG G P P Sbjct: 41 ASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDR------GGRGSGGGGRDGDWRCPNP 93 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G G G G GG GG GGG RG Sbjct: 30 GGGDAGYGGRGASGGGSYGGRGGYGGGGGRG 60 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGG 491 G GG GGGGG G GGGG Sbjct: 48 GGRGGYGGGGGRGNRGGGGGG 68 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGG-GXRG 871 GGG P GG G G GG GGG G G RG Sbjct: 9 GGGGAPIPSYGGD-GYGGGGGYGGGDAGYGGRG 40 Score = 31.5 bits (68), Expect = 0.93 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -3 Query: 571 RTXXGXGXXGGXGG-GGGXXXXGXGGGGGPXXXGVXG 464 R G G GG GG GGG GGGGG G G Sbjct: 39 RGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRG 75 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G G GGG G GGGGG G G Sbjct: 35 GYGGRGASGGGSYGGRGGYGGGGGRGNRGGGG 66 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G G GGG G GGG G + + G G GG Sbjct: 43 GGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGR-GSGGGG 83 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G G G GGG GGG G Sbjct: 128 GGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGG 159 Score = 37.5 bits (83), Expect = 0.014 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G G G G G GG GGG GGG Sbjct: 132 GGGRGGGGGSGNGEGYGEGGGYGGGYGGG 160 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 ++ GG G+ G G G G G G R GGG GGG G Sbjct: 82 SSSGGGGGDAGSEAGSYAGSHAGSGSGGRSGSGRGRGSGGGGGHGGGGG 130 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 +G G G GG G GG G G G GGG GGG G Sbjct: 111 SGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYG 158 Score = 35.5 bits (78), Expect = 0.057 Identities = 20/48 (41%), Positives = 21/48 (43%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 AG G G+ G G GG GGG G R GGGGG G G Sbjct: 103 AGSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGR------GGGGGSGNG 144 Score = 35.5 bits (78), Expect = 0.057 Identities = 19/53 (35%), Positives = 21/53 (39%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 +GG + RG G G GG GGG G G G GGG G G Sbjct: 107 SGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGG 159 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 AG + G R G G G GGG G GGG G G G G Sbjct: 99 AGSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGG 151 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 216 GXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G GGGG GG GGG G G G GG Sbjct: 112 GSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGG 151 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGGG G GG G + G G GG Sbjct: 118 GSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGG 159 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG GGGGG G GGGGG Sbjct: 118 GSGGGGGHGGGGG-GGGGRGGGGG 140 Score = 32.3 bits (70), Expect = 0.53 Identities = 17/48 (35%), Positives = 19/48 (39%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 +G G + G G G GG GGG G G GGG G G Sbjct: 113 SGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGGG 160 Score = 32.3 bits (70), Expect = 0.53 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -3 Query: 571 RTXXGXGXXGGXGGGGGXXXXGXGGGGG 488 R G G GG GGGGG G G G G Sbjct: 117 RGSGGGGGHGGGGGGGGGRGGGGGSGNG 144 Score = 31.9 bits (69), Expect = 0.71 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G G GGGGG G GGGGG G G GG Sbjct: 112 GSGRGRGSGGGGG-HGGGGGGGGGRGGGGGSGNGEGYGEGG 151 Score = 31.9 bits (69), Expect = 0.71 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 G G G GGGG GG GGG G G G G Sbjct: 116 GRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGG 156 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G G GGG G G GGG G G GG Sbjct: 112 GSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGG 152 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G G GGGGG G GG G G G GG Sbjct: 120 GGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGGG 160 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 G G G GGG G G G G G GGG Sbjct: 41 GAGIGIGIGIGGG-GSGSGAGAGSGSGGG 68 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXR 874 GGA G GGG G G GG GGG G G R Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGGGGGHGAR 41 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXG-GGXRG 871 G GGG G G GG GGG G GG G Sbjct: 15 GGGGGHGGGAGGGFGGGAGGGGGHG 39 Score = 32.3 bits (70), Expect = 0.53 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -3 Query: 559 GXGXXGGXGGG-GGXXXXGXGGGGG 488 G G GG GGG GG G GGGGG Sbjct: 13 GAGGGGGHGGGAGGGFGGGAGGGGG 37 Score = 31.9 bits (69), Expect = 0.71 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGGXRG 871 G GGG G G GG GGG GGG G Sbjct: 13 GAGGGGGHG--GGAGGGFGGGAGG 34 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 910 GGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG GGG G G GGGGG G Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGGGGGHG 39 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGG 892 GGG G GGG G G GG G G Sbjct: 15 GGGGGHGGGAGGGFGGGAGGGGGHG 39 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGG 151 G G G GG GG GG GGG Sbjct: 13 GAGGGGGHGGGAGGGFGGGAGGGG 36 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXG 487 G G G G GGG G G GG G Sbjct: 13 GAGGGGGHGGGAGGGFGGGAGGGG 36 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -1 Query: 960 GAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 G+ P GGG G G GG G G GGG RG Sbjct: 51 GSKPNKKWGGGMGGGGGGGGGSGGGGGGRG 80 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGV 470 G G GG GGGGG G G GGGP G+ Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGGGPPRGGL 88 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 936 GGGXGXGXXGGXGGGXGGG 880 GGG G G GG GGG GGG Sbjct: 64 GGGGGGGGSGGGGGGRGGG 82 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 854 GGGGGGGXGGXXXGXXPXPPR 792 GGGGGGG GG G PPR Sbjct: 65 GGGGGGGSGGGGGGRGGGPPR 85 Score = 31.9 bits (69), Expect = 0.71 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXR 457 G G G G GGG G G G G GP G R Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGGGPPRGGLDNVR 92 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G GGG G G G GG GG Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGGGPPRGG 87 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G G GGGG GG GGG G Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGGGPPRGG 87 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = +3 Query: 813 PLXXXPX-PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXP-PRAPRXAXXPPP 968 PL P PPPPPPP P P PP P P PR PPP Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPP 114 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +2 Query: 872 PRXPPPX-PPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP PPP PP P P P P PPP Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPP 93 Score = 35.5 bits (78), Expect = 0.057 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +2 Query: 422 GGGXXPPXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 GGG P P P PPP P+ P PPP P P P Sbjct: 39 GGGSDSTNYNSPAPSPEPEDYLPLPPP-PQTPPPPPPPQSLPPPSP 83 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPP-PPPXPPXXPXP 560 P P PPPPP P PP P P P P P Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPP 93 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/52 (32%), Positives = 19/52 (36%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PPPP P ++ P P P P P PP PPP Sbjct: 56 PEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYP--PPPYHHYITPSPPP 105 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRF 575 PP P PPPP PPPP P P P + F Sbjct: 74 PPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPPPPLHF 119 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +3 Query: 438 PPXXXGXGXPX-TPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P +P PPPP P PPP P P P Sbjct: 72 PPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPP 113 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 P P P PPPP PP P P Sbjct: 52 PSPEPEDYLPLPPPPQTPPPPPPP 75 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 9/38 (23%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPX---------PPPXPXXGXAPPP 967 PPP P P P P P PPP P PPP Sbjct: 79 PPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPPPP 116 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPPXXPPP-PPXXPXXXPXP 223 P P P P PPP P PPP P P P P Sbjct: 52 PSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPP 93 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +2 Query: 881 PPPX----PPPXPPXXPXPXPPPXPXXGXAP 961 PPP P PP P P PPP P +P Sbjct: 92 PPPYHHYITPSPPPPRPLPPPPPPPLHFSSP 122 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 37.9 bits (84), Expect = 0.011 Identities = 22/48 (45%), Positives = 22/48 (45%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 AGGG GA GG G GG GGG G GGG GGG G Sbjct: 37 AGGGEWG--GAEGGGAWGGGGG-GGGAWGGEGEGGGEWGGGGEGGGGG 81 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G G G G GG G G GGG RG Sbjct: 53 GGGGGGGAWGGEGEGGGEWGGGGEGGGGGRRG 84 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GG GGGGG G G GGG G G Sbjct: 47 GGGAWGG-GGGGGGAWGGEGEGGGEWGGGGEG 77 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 910 GGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG GGG G GGGGGG G G Sbjct: 35 GGAGGGEWGGAEGGGAWGGGGGGGGAWGGEGEG 67 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG G GGG G GGGG Sbjct: 57 GGGAWGGEGEGGGEWGGGGEGGGG 80 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 216 GXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G GGGGG GG GGG G Sbjct: 48 GGAWGGGGGGGGAWGGEGEGGGEWGGG 74 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 G G G GG G GG GG GG G Sbjct: 36 GAGGGEWGGAEGGGAWGGGGGGGGAWGGEGEG 67 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G G G GGG GG GGG G Sbjct: 56 GGGGAWGGEGEGGGEWGGGGEGGGGGRRG 84 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 37.9 bits (84), Expect = 0.011 Identities = 24/68 (35%), Positives = 25/68 (36%), Gaps = 1/68 (1%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGX-GGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPP 794 +GGG G GG G GG GGG G GG GGG G RG Sbjct: 89 SGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSY 148 Query: 793 AXGRXXRG 770 GR G Sbjct: 149 GGGRREGG 156 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 4/55 (7%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXG----GXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG R GG G G G GGG G R GGG GGG G G Sbjct: 119 GGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 173 Score = 32.7 bits (71), Expect = 0.40 Identities = 18/47 (38%), Positives = 20/47 (42%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 + GGG + RG GG G GGG G G GGGGG Sbjct: 132 SGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEG---GGYGGSGGGGG 175 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGGG GGGG G G GG Sbjct: 88 GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGG 128 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG + G G G GGG G GG GG G G Sbjct: 127 GGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 173 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G GGGG GG GGG G G GG Sbjct: 134 GGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 175 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGG 488 GG GGG G G GGGGG Sbjct: 157 GGYGGGEGGGYGGSGGGGG 175 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 RG G GGG G GG G GGG G Sbjct: 87 RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYG 119 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = -1 Query: 216 GXXXGXXGGGG--GXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 G G GGGG G GG GGG G G G G Sbjct: 106 GGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 146 Score = 28.3 bits (60), Expect = 8.7 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGG---GGGGXGXXXRG 812 +GGG G GG G G GGG GGG GGGG G G Sbjct: 112 SGGG--GSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGG 165 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 G G G GGG G G GG GGG GGG Sbjct: 61 GDGGGDGGGDGGGGGCGGGGGCGGGGGGG 89 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 960 GAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 G G GGG G G G GGG GGG G Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGGGGG 88 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G G G G G GG G G GGG Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGGGG 87 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG GGGGG G GGGG Sbjct: 63 GGGDGGGDGGGGGCGGGGGCGGGG 86 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 919 GXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 G GG GGG G GGGGGGG Sbjct: 61 GDGGGDGGGDGGGGGCGGGGGCGGGGGGG 89 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GG GGG G G GGGGG G G Sbjct: 59 GGGDGGGDGGGDG-GGGGCGGGGGCGGGGGGG 89 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 216 GXXXGXXGGGGGXXGGXXXGGG 151 G G GGGGG GG GGG Sbjct: 64 GGDGGGDGGGGGCGGGGGCGGG 85 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 910 GGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG GGG G GGG GGG G Sbjct: 60 GGDGGGDGGGDGGGGGCGGGGGCGGGGG 87 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP PP P P Sbjct: 495 PPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPP-PPCP 534 Score = 35.5 bits (78), Expect = 0.057 Identities = 43/182 (23%), Positives = 45/182 (24%), Gaps = 5/182 (2%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGG---XRPXX 608 PP P P PPPP P PPPP P P P V + P Sbjct: 504 PPPPYVYSSPPPPYVYSSPPPPPP----SPPPPCPESSPPPPVVYYAPVTQSPPPPSPVY 559 Query: 609 XXXXTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRP 788 T P P P P P P P Sbjct: 560 YPPVTQSPPPPSPVYYPPVTNSPPPP--SPVYYPPVTYSPPPPSPVYYPQVTPSP----P 613 Query: 789 XAGGXGXXPLXXXPXPPPPP--PPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXP 962 P+ P PP P PP P PP P P P P P Sbjct: 614 PPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYY-PPVTPSPPPPSPVYYPSETQSP 672 Query: 963 PP 968 PP Sbjct: 673 PP 674 Score = 35.1 bits (77), Expect = 0.076 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 3/50 (6%) Frame = +3 Query: 828 PXPPPP---PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPP PPP P P PP PP P PPP Sbjct: 457 PPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPP 506 Score = 35.1 bits (77), Expect = 0.076 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP P P PP PPP PPP Sbjct: 457 PPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPP 488 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPP-PXPPXXPXXXPPRAPRXAXXPPP 968 PPPPP RA P PP P PP P P PPP Sbjct: 441 PPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPP 486 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P P PPPP PPPPP P P V Sbjct: 466 PPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYV 509 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXP 217 PP P P P P P + PP P PPP P P Sbjct: 597 PPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYP 636 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXP 217 PP P P P P P + PP P PPP P P Sbjct: 612 PPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYP 651 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXP 217 PP P P P P P + PP P PPP P P Sbjct: 627 PPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYP 666 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 5/46 (10%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPP-----PPXPPXXPXP 560 PP P P PPPP PPP PP PP P P Sbjct: 486 PPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPP 531 Score = 32.7 bits (71), Expect = 0.40 Identities = 40/179 (22%), Positives = 43/179 (24%), Gaps = 3/179 (1%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXX 617 PP P P PPPP P PPPP P P V P Sbjct: 476 PPPYVYSSPPPPPYVYSSPPPP-PYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCP 534 Query: 618 XTXXXXXXXRAXGAXGAXGXPGP-XGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXA 794 + + P P P P P P Sbjct: 535 ESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVT 594 Query: 795 -GGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXP-PRAPRXAXXPP 965 P+ P PPPP P PPP P P P P P PP Sbjct: 595 YSPPPPSPVYYPQVTPSPPPPSPLYYPPVTP-SPPPPSPVYYPPVTPSPPPPSPVYYPP 652 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 5/34 (14%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPP-----XPXXGXAPPP 967 PPP PP PP P PPP P PPP Sbjct: 522 PPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPP 555 Score = 31.5 bits (68), Expect = 0.93 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = +1 Query: 826 PPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 PP PPP PPP P PP +P PPP Sbjct: 522 PPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPP 569 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P P PPPP PPPP P P V Sbjct: 457 PPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYV 500 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = +2 Query: 437 PPXXXGARXXPHPXXXGPXPPP----XPRXXXPXPPPXPXPXPXP 559 PP ++ P P PPP P PPP P P P P Sbjct: 424 PPPPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPPSPSPPP 468 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +2 Query: 101 PXPXPXXXFXXXP--LFXXPPPXWXPPXXPPPPPXXPXXXP 217 P P P P ++ PPP + PPPPP P P Sbjct: 494 PPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCP 534 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 PPP PP P PPP P PP Sbjct: 514 PPPYVYSSPPPPPPSPPPPCPESSPPPP 541 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP + PPP Sbjct: 475 PPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPP 526 Score = 30.3 bits (65), Expect = 2.2 Identities = 21/61 (34%), Positives = 22/61 (36%), Gaps = 8/61 (13%) Frame = +3 Query: 813 PLXXXPXPPP-----PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPP---RAPRXAXXPPP 968 P PPP PPPP P PPP P P PP AP PPP Sbjct: 498 PYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSP--PPPVVYYAPVTQSPPPP 555 Query: 969 A 971 + Sbjct: 556 S 556 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/42 (30%), Positives = 16/42 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P ++ PPP + PPPP P P Sbjct: 457 PPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPP 498 Score = 29.1 bits (62), Expect = 5.0 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPPP-----PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPP PPPP P P PP PP P PPP Sbjct: 484 PPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPP---SPPPP 532 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/54 (27%), Positives = 16/54 (29%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 P+ P P PPPP PP P PP PP A Sbjct: 647 PVYYPPVTPSPPPPSPVYYPSETQSPPPPTEYYYSPSQSPPPTKACKEGHPPQA 700 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 37.5 bits (83), Expect = 0.014 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGGGG G GGGG G G GG Sbjct: 46 GHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGG 86 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G GG G G GG GGG GGG Sbjct: 105 GGGGHYGGGGGGHGGGGHYGGGGGGYGGG 133 Score = 35.1 bits (77), Expect = 0.076 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G G G GG GGG G GGGGG G G Sbjct: 92 GGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 143 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG G G G GG GG G GGGGGG G Sbjct: 85 GGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYG 131 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G GG G G GGG G GG GGG G G Sbjct: 55 GGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGG 106 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG G GG G G GGG GGGG GG G G Sbjct: 76 GGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGG 126 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 GGG G G G GG GGG G GG GGGG Sbjct: 78 GGGHYGGGGGHYGGGGGHYGG-GGGHYGGGGGHYGGGGGGHGGGG 121 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -3 Query: 553 GXXGGXGGGG--GXXXXGXGGGGGPXXXGVXGXPXP 452 G GG GGGG G G GGGGG G G P Sbjct: 112 GGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHGLNEP 147 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G G GG GG G G G Sbjct: 44 GGGHGGHGGHGGGGGHG-HGGHNGGGGHGLDG 74 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 G G G GGGGG GG GGG G G G G Sbjct: 105 GGGGHYG--GGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 143 Score = 30.3 bits (65), Expect = 2.2 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXG--GXGGGXXXGXARXXXXXXGGGG--GGGXGXXXRG 812 GGG G GG G G G GG G GGGG GGG G G Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGG 99 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGG GG GGG G G GG Sbjct: 46 GHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGG 87 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -3 Query: 559 GXGXXGGXGGG-GGXXXXGXGGGG 491 G G GG GGG GG G GGGG Sbjct: 106 GGGHYGGGGGGHGGGGHYGGGGGG 129 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXX--XGGGXXXXGXXQXXKXGXGXG 100 G G G GGGGG GG GGG G G G G Sbjct: 74 GYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGG 116 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G GGG G G GG G G G GG Sbjct: 46 GHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGG 86 Score = 28.7 bits (61), Expect = 6.6 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGG--GGGXGXXXRG 812 GGG GG G GG GG GGGG GGG G G Sbjct: 67 GGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGG 120 Score = 28.3 bits (60), Expect = 8.7 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 4/56 (7%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGG--GXXXGXARXXXXXXGGGGG--GGXGXXXRG 812 GGG G GG G GG GG G G GGGGG GG G G Sbjct: 66 GGGGHGLDGYGGGG--GHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGG 119 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = -3 Query: 553 GXXGGX-GGGGGXXXXGXGGGGGPXXXGVXG 464 G GG GGGGG G GG GG G G Sbjct: 97 GGGGGHYGGGGGHYGGGGGGHGGGGHYGGGG 127 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 37.5 bits (83), Expect = 0.014 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGGGG G GGGG G G GG Sbjct: 46 GHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGG 86 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G GG G G GGG G GG GGG G G Sbjct: 55 GGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGG 106 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = -1 Query: 966 GGGAXPXXGXGG--GXGXGXXGGXGGGXGGGXRG 871 GGG G GG G G G GG GG GGG G Sbjct: 83 GGGGGHYGGGGGHYGGGGGGYGGGGGHHGGGGHG 116 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G G GG GG G G G Sbjct: 44 GGGHGGHGGHGGGGGHG-HGGHNGGGGHGLDG 74 Score = 30.3 bits (65), Expect = 2.2 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXG--GXGGGXXXGXARXXXXXXGGGG--GGGXGXXXRG 812 GGG G GG G G G GG G GGGG GGG G G Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGG 99 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GGGG GG GGG G G GG Sbjct: 46 GHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGG 87 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXX--XGGGXXXXGXXQXXKXGXGXG 100 G G G GGGGG GG GGG G G G G Sbjct: 74 GYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGGGGHHGGGGHG 116 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 GGG G GG G GG GGG G GG GGGG Sbjct: 66 GGGGHGLDGYGGGG--GHYGG-GGGHYGGGGGHYGGGGGGYGGGG 107 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G GGG G G GG G G G GG Sbjct: 46 GHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGG 86 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPPPPP A P PPP PP P P PPP Sbjct: 241 PTPPPPPPPPIPVKQSATP---PPPPPPKLKNNGPSPPP-----PPP 279 Score = 32.7 bits (71), Expect = 0.40 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPP 545 P PPPPP P PPP PP Sbjct: 241 PTPPPPPPPPIPVKQSATPPPPPP 264 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPP 545 PPPPP P PPP PP Sbjct: 261 PPPPPKLKNNGPSPPPPPP 279 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 467 PHPXXXGPXPPPXPRXXXPXPPPXPXP 547 P P P PPP P PPP P P Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPPPPPP 265 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +3 Query: 474 PXXXGPPPPPXP---XXXXPPPPPXPP 545 P PPPPP P PPPP PP Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPPPPPP 265 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 PP P PPPPP P PP PP Sbjct: 243 PPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPP 278 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPP 936 P PP PPPPP P PP PP Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/53 (32%), Positives = 21/53 (39%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P+ PPPPPPP + PPP PP + + PPPA Sbjct: 252 PVKQSATPPPPPPPKLKNNGPS-----PPPPPPL--KKTAALSSSASKKPPPA 297 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXP 908 P PPPPPP + PPP P Sbjct: 272 PSPPPPPPLKKTAALSSSASKKPPPAP 298 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 37.1 bits (82), Expect = 0.019 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXP 554 PPPPP P PPPP PP P Sbjct: 102 PPPPPQPLNLFSPPPPPPPPDP 123 Score = 31.9 bits (69), Expect = 0.71 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 875 RXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 R PPP PPP P PPP P PPP Sbjct: 96 RIPPPQPPPPPQPLNLFSPPPPP-----PPP 121 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 488 PXPPPXPRXXXPXPPPXPXPXPXP 559 P PPP P+ PP P P P P Sbjct: 100 PQPPPPPQPLNLFSPPPPPPPPDP 123 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXP 908 PP PPPP + P PPP P Sbjct: 99 PPQPPPPPQPLNLFSPPPPPPPPDP 123 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPP 937 P PPP P P P P PPP Sbjct: 99 PPQPPPPPQPLNLFSPPPPPPP 120 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXP 920 PPP PPP P PPP PP P Sbjct: 98 PPPQPPPPPQPLNLFSP---PPPPPPPDP 123 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 4/23 (17%) Frame = +3 Query: 489 PPPPPXP----XXXXPPPPPXPP 545 PP PP P PPPPP PP Sbjct: 99 PPQPPPPPQPLNLFSPPPPPPPP 121 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 37.1 bits (82), Expect = 0.019 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPP-PXPPXXPXXXPPRAPRXAXXPP 965 PL P PPPPP RA P PP P PP PR PP Sbjct: 21 PLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRPCSRPP 72 Score = 36.7 bits (81), Expect = 0.025 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 4/51 (7%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXP----PXXPXXXPPRAPRXAXXPPP 968 P PPPPPP R P PPP P P PP R A PPP Sbjct: 14 PLPPPPPP----LMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPP 60 Score = 36.3 bits (80), Expect = 0.033 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPR 938 PL PPPPPPP RA P PPP P P PP+ Sbjct: 36 PLMRRRAPPPPPPPLMRR--RAPPP--PPPPPLPRPCSRPPK 73 Score = 35.5 bits (78), Expect = 0.057 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PPPPP PPPP PP P P Sbjct: 44 PPPPPPLMRRRAPPPPPPPPLPRP 67 Score = 31.9 bits (69), Expect = 0.71 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXP 542 PPPPP PPPPP P Sbjct: 32 PPPPPLMRRRAPPPPPPP 49 Score = 31.5 bits (68), Expect = 0.93 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPP 545 PPPPP P PPP PP Sbjct: 30 PPPPPPPLMRRRAPPPPPP 48 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPP 545 PPPPP PPPP PP Sbjct: 31 PPPPPPLMRRRAPPPPPPP 49 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPP 545 PPPPP P PPP PP Sbjct: 17 PPPPPLMRRRAPLPPPPPP 35 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +2 Query: 875 RXPPPXPPPXPPXX-PXPXPPPXPXXGXAPPPR 970 R PPP PPP P P PPP + PP+ Sbjct: 41 RAPPPPPPPLMRRRAPPPPPPPPLPRPCSRPPK 73 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXP 217 PP P P P PPP PPPPP P P Sbjct: 30 PPPPPPPLMRRRAP--PPPPPPLMRRRAPPPPPPPPLPRP 67 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPP 196 P P P PL PPP PPPPP Sbjct: 16 PPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPP 47 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G GGG G G G GGG GGG Sbjct: 123 GGGGYSYGGGGGGYGGGGGGYGGGGDGGG 151 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGG 488 G GG GGGGG G GGGG Sbjct: 131 GGGGGYGGGGGGYGGGGDGGGG 152 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGG 491 G G G GGGGG G GGGG Sbjct: 130 GGGGGGYGGGGGGYGGGGDGGGG 152 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGGXRG 871 G GGG G GG GG GGG G Sbjct: 122 GGGGGYSYGGGGGGYGGGGGGYGG 145 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXG 881 A GGG G GG G GG GGG G Sbjct: 120 AYGGGGGYSYGGGGGGYGGGGGGYGGGGDGG 150 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 216 GXXXGXXGGGGGXXGGXXXGGG 151 G G GGGGG GG GGG Sbjct: 130 GGGGGGYGGGGGGYGGGGDGGG 151 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 216 GXXXGXXGGGGGXXGGXXXGGG 151 G G GGGGG GG GGG Sbjct: 131 GGGGGYGGGGGGYGGGGDGGGG 152 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 571 RTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 R G G GGGGG G G GGG G Sbjct: 119 RAYGGGGGYSYGGGGGGYGGGGGGYGGGGDGGG 151 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G G GGG G GG GGG G Sbjct: 124 GGGYSYGGGGGGYGGGGGGYGGGGDGGGG 152 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P+ PP PP PP PPP G APPP Sbjct: 243 PQRPPMGGPPPPPHIGGSAPPPPHMGGSAPPP 274 Score = 35.5 bits (78), Expect = 0.057 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 3/63 (4%) Frame = +3 Query: 423 GGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP---XPPXXPXPXXVRFXXXGGG 593 GG PP G P PPPP PPPP P P P GG Sbjct: 249 GGPPPPPHIGGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPPPYGAPPQNNMGG 308 Query: 594 XRP 602 RP Sbjct: 309 PRP 311 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 453 GXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 G P P GPPPPP PPPP P P Sbjct: 239 GGPPPQRPPMGGPPPPPHIGGSAPPPPHMGGSAPPP 274 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 426 GGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP 536 GG P G P P G PPP PPPP Sbjct: 239 GGPPPQRPPMGGPPPPPHIGGSAPPPPHMGGSAPPPP 275 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 6/61 (9%) Frame = +1 Query: 805 GXXPXXXPPXPPPPPPP------XXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPP 966 G P PP PPPPP P PP PP GGP PP Sbjct: 239 GGPPPQRPPMGGPPPPPHIGGSAPPPPHMGGSAPPPPHMGQNYGPP--PPNNMGGPRHPP 296 Query: 967 P 969 P Sbjct: 297 P 297 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -3 Query: 499 GGGGPXXXGVXGXPXPXXXGGXXPPPP 419 GG P + G P P GG PPPP Sbjct: 239 GGPPPQRPPMGGPPPPPHIGGSAPPPP 265 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 893 PPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P P PPP G APPP Sbjct: 241 PPPQRPPMGGPPPPPH-IGGSAPPP 264 Score = 29.1 bits (62), Expect = 5.0 Identities = 31/112 (27%), Positives = 32/112 (28%), Gaps = 4/112 (3%) Frame = -3 Query: 733 GPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXXXXXXGRXPPPXXXKRTXXGX 554 GPPPPP P G P P R PPP Sbjct: 250 GPPPPPHIGGSAPPPPHMGGSAPP--PPHMGQNYGPPPPNNMGGPRHPPPYGAPPQNNMG 307 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPPP----PPP 410 G GG GG P + G P P GG PPP PPP Sbjct: 308 GPRPPQNYGGTPPP---NYGGAPPANNMGGAPPPNYGGG--PPPQYGAVPPP 354 Score = 29.1 bits (62), Expect = 5.0 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +2 Query: 800 GGXXPPXXXXXXXXXXXXXXXXXXPRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 GG PP PR PPP P P PP G PPP Sbjct: 268 GGSAPPPPHMGQNYGPPPPNNMGGPRHPPPYGAPPQNNMGGPRPPQN--YGGTPPP 321 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP P PPPPP P P Sbjct: 241 PPPQRPPMGGPPPPPHIGGSAPPP 264 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP PPP P P PPP P PPP Sbjct: 27 PSLPPPVPPPPPSHQPYSYPPPPP-----PPP 53 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP PP PPPP P P P Sbjct: 9 PPLPQPPSQNSLAP--PPPPPSLPPPVPPPPPSHQPYSYPPP 48 Score = 36.3 bits (80), Expect = 0.033 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PP PP P P P P PPP Sbjct: 22 PPPPPPSLPPPVPPPPPSHQPYSYPPPPP 50 Score = 35.1 bits (77), Expect = 0.076 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXP---PPPPXPP 545 PP P P PP PP P P PPPP PP Sbjct: 14 PPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPP 52 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +3 Query: 828 PXPP-PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P PP P PP P PPP PP P P P PP A Sbjct: 7 PYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHA 55 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPP 545 P P PPPP PPPPP PP Sbjct: 27 PSLPPPVPPPPPSHQPYSYPPPPPPPP 53 Score = 32.3 bits (70), Expect = 0.53 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXP-----XXXPPPXPPXXPXXXPPRAPR 947 P PPPPPP P PPP PP P P PR Sbjct: 46 PPPPPPPPHAYYQQGPHYPQFNQLQAPPPPPPPSAPPPLVPDPPR 90 Score = 31.5 bits (68), Expect = 0.93 Identities = 21/70 (30%), Positives = 25/70 (35%), Gaps = 4/70 (5%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPR- 947 P +P + P PPP PPP + P PPP PP P P+ Sbjct: 9 PPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYP--PPPPPPPHAYYQQGPHYPQF 66 Query: 948 ---XAXXPPP 968 A PPP Sbjct: 67 NQLQAPPPPP 76 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPP 545 P P PPP P PP PP PP Sbjct: 12 PQPPSQNSLAPPPPPPSLPPPVPPPPP 38 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 6/47 (12%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP------XPPXXPXP 560 PP P PPPPP PPPPP PP P P Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPP 52 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXP 205 PP P P P PPP P PPPPP P Sbjct: 22 PPPPPPSLP----PPVPPPPPSHQPYSYPPPPPPPP 53 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 492 PPPPXPXXXXPPPPPXPPXXPXP 560 PPPP P PP P PP P Sbjct: 72 PPPPPPPSAPPPLVPDPPRHQGP 94 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 467 PHPXXXGPXPPPXPRXXXPXPPPXPXPXP 553 P P P PPP P PP P P P Sbjct: 25 PPPSLPPPVPPPPPSHQPYSYPPPPPPPP 53 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPP 934 PPP PPP P P PP Sbjct: 72 PPPPPPPSAPPPLVPDPP 89 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 PL P PPPPPP P P P P P PP + + PP Sbjct: 60 PLSLSPSSPPPPPPSSSPLSSLSPSLSPSP-PSSSPSSAPPSSLSPSSPPP 109 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPPP PPPPP P P Sbjct: 152 PPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPP 192 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P PP PP PP P PPP Sbjct: 141 PPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPP 192 Score = 35.9 bits (79), Expect = 0.043 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPPP P P PP PP P PPP Sbjct: 169 PPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 212 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 62 PPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPP 102 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 72 PPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPP 112 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 82 PPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 122 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 102 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 142 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 122 PPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPP 162 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 132 PPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPP 172 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 172 PPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 212 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 192 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 232 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 212 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 252 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 232 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 272 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 252 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 292 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 272 PPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPP 312 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 282 PPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPP 322 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 292 PPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPP 332 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 71 PPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 122 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 81 PPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 132 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 91 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 142 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 101 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPP 152 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 111 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPP 162 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 121 PPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPP 172 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 131 PPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPP 182 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 151 PPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPP 202 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 171 PPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 222 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 181 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 232 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 191 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 242 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 201 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 252 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 211 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 262 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 221 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 272 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 231 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 282 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 241 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 292 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 251 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPP 302 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 261 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPP 312 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 271 PPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPP 322 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 281 PPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPP 332 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 291 PPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPP 342 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 92 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 132 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 112 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPP 152 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 142 PPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPP 182 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 182 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 222 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 202 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 242 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 222 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 262 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 242 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 282 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 262 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPP 302 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 302 PPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPP 342 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 840 PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPP P P PP PP P PPP Sbjct: 70 PPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPP 112 Score = 32.3 bits (70), Expect = 0.53 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 162 PPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPP 202 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 3/50 (6%) Frame = +3 Query: 828 PXPPP---PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPP PPP P P PP PP P PPP Sbjct: 53 PSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPP 102 Score = 31.9 bits (69), Expect = 0.71 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 6/54 (11%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPR-XAXXPPPA 971 P PP PPPPP P P PP PP P + PPPA Sbjct: 301 PPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPA 354 Score = 31.9 bits (69), Expect = 0.71 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 6/52 (11%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXP-XXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P PP PPPPP P PP PP PP AP PP Sbjct: 311 PPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPAPYVYKPPP 362 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP 536 PP P P PPP P PPPPP Sbjct: 141 PPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPP 173 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 63 PPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYV 106 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 73 PPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYV 116 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 83 PPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 126 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 93 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 136 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 113 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYV 156 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 133 PPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYV 176 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 143 PPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYV 186 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 163 PPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYV 206 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 183 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 226 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 203 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 246 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 223 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 266 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 243 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 286 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 263 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYV 306 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 283 PPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYV 326 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 293 PPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYV 336 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 303 PPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYV 346 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 103 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 146 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 123 PPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYV 166 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 173 PPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 216 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 193 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 236 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 213 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 256 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 233 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 276 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 253 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 296 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 273 PPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYV 316 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P PPPPP PPPP P P Sbjct: 313 PPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPP 353 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 36.7 bits (81), Expect = 0.025 Identities = 20/55 (36%), Positives = 23/55 (41%), Gaps = 8/55 (14%) Frame = +3 Query: 828 PXPPPPP-PPXXXXXXRAXPXXXPPPXPP-------XXPXXXPPRAPRXAXXPPP 968 P PP PP PP P PPP PP P PP+ P+ + PPP Sbjct: 198 PLPPLPPLPPTTGLTLPHSPFPPPPPGPPPKEQDFVRPPLPPPPQLPQSSQPPPP 252 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 816 LXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPP 935 L P PPPPP P P PPP P PP Sbjct: 213 LPHSPFPPPPPGPPPKEQDFVRPPLPPPPQLPQSSQPPPP 252 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +3 Query: 441 PXXXGXGXPXTPXXXGPP-PPPXPXXXXPPPPPXPPXXP 554 P G P +P PP PPP PP P PP P Sbjct: 206 PPTTGLTLPHSPFPPPPPGPPPKEQDFVRPPLPPPPQLP 244 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXP 943 PR PP PPP PP P PP P Sbjct: 378 PR-PPYGPPPGPPPMMRPPLPPGP 400 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 486 GPPPPPXPXXXXPPPPPXPP 545 GPPP P P P PP PP Sbjct: 383 GPPPGPPPMMRPPLPPGPPP 402 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = +2 Query: 872 PRXPPPXPPP--XPPXXPXPXP 931 P PPP PPP PP P P P Sbjct: 381 PYGPPPGPPPMMRPPLPPGPPP 402 Score = 28.7 bits (61), Expect = 6.6 Identities = 19/53 (35%), Positives = 21/53 (39%), Gaps = 4/53 (7%) Frame = +3 Query: 828 PXPP----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 P PP PP P P PPP PP P PP P PPP++ Sbjct: 358 PPPPLDMHPPHPGMFVGHLIPRPPYGPPPGPP--PMMRPPLPP----GPPPSS 404 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 2/25 (8%) Frame = +2 Query: 899 PXPPXXPXPXPPP--XPXXGXAPPP 967 P PP P P PPP P PPP Sbjct: 378 PRPPYGPPPGPPPMMRPPLPPGPPP 402 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 5/66 (7%) Frame = +3 Query: 786 PXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXP---PP--XPPXXPXXXPPRAPRX 950 P G P P PP P PP P P PP PP P PP +P Sbjct: 115 PPPLGPPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFPPESPPP 174 Query: 951 AXXPPP 968 PPP Sbjct: 175 GIDPPP 180 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXP-PXXPXP 560 P P GPP P P PP P P P P P Sbjct: 112 PSDPPPLGPPQTPGPEFPVPPSPSPPMPDTPNP 144 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPP-PXPXXGXAPPP 967 P PPP PP P P PP P P P P Sbjct: 112 PSDPPPLGPPQTPGPEFPVPPSPSPPMPDTPNP 144 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 4/38 (10%) Frame = +3 Query: 459 GXPXTPXXXGP----PPPPXPXXXXPPPPPXPPXXPXP 560 G P TP P P PP P PP P PP P Sbjct: 119 GPPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPP 156 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +3 Query: 465 PXTPXXXGPP--PPPXPXXXXPPPPPXPPXXPXP 560 P TP PP PP P PP P P P P Sbjct: 147 PKTPPDVVPPIWEPPRPPDIFPPESPPPGIDPPP 180 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 872 PRXPPPXPP-PXPPXXPXPXPPPXPXXGXAPPPR 970 P P P PP P P P P PP PPR Sbjct: 129 PVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPR 162 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P PPP PP P P PPP P PPP Sbjct: 40 PCQPNPSPPP-PPSNPSP-PPPSPTTTACPPP 69 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPP-PXPPXXPXP 560 P P PPP P PPPP P P P Sbjct: 40 PCQPNPSPPPPPSNPSPPPPSPTTTACPPP 69 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/54 (29%), Positives = 20/54 (37%), Gaps = 5/54 (9%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXP-----XXXPPRAPRXAXXPPPAA 974 P P PPPPP P P PP PP + + PPP++ Sbjct: 43 PNPSPPPPPSNPSPPPPSPTTTACPPPPSSSGGGPYYYYPPASQSGSYRPPPSS 96 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPP 536 P P PPPP P PPPP Sbjct: 47 PPPPPSNPSPPPPSPTTTACPPPP 70 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/31 (35%), Positives = 11/31 (35%) Frame = +3 Query: 441 PXXXGXGXPXTPXXXGPPPPPXPXXXXPPPP 533 P P P PPPP PPPP Sbjct: 40 PCQPNPSPPPPPSNPSPPPPSPTTTACPPPP 70 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 P P PPPPPPP P PPP PP P+ P Sbjct: 4 PSKRRPPPPPPPPPRLL----VLPPLPPPPPPPPPQLPFGPKLP 43 Score = 35.5 bits (78), Expect = 0.057 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 5/34 (14%) Frame = +2 Query: 875 RXPPPXPPPXP-----PXXPXPXPPPXPXXGXAP 961 R PPP PPP P P P P PPP P P Sbjct: 7 RRPPPPPPPPPRLLVLPPLPPPPPPPPPQLPFGP 40 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PPPPP P PP P PP P P Sbjct: 11 PPPPPPPRLLVLPPLPPPPPPPPP 34 Score = 33.9 bits (74), Expect = 0.17 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 7/35 (20%) Frame = +3 Query: 471 TPXXXGPPPPPXP-------XXXXPPPPPXPPXXP 554 TP PPPPP P PPPPP PP P Sbjct: 3 TPSKRRPPPPPPPPPRLLVLPPLPPPPPPPPPQLP 37 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXPXXVRF 575 PPPPP P PP PP P P + F Sbjct: 10 PPPPPPPPRLLVLPPLPPPPPPPPPQLPF 38 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 473 PXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 P P PPP P PP P P P P Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPPPPP 32 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 6/36 (16%) Frame = +2 Query: 875 RXPPPXPPPX-----PPXXPX-PXPPPXPXXGXAPP 964 R PPP PPP PP P P PPP G P Sbjct: 8 RPPPPPPPPPRLLVLPPLPPPPPPPPPQLPFGPKLP 43 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PR PPP PP P P PPP P PPP Sbjct: 86 PRLPPPLLPP-PEEPPREPPPPPPPPEEPPPP 116 Score = 35.9 bits (79), Expect = 0.043 Identities = 21/54 (38%), Positives = 22/54 (40%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 P P P PPPP R P PPP P P PP P PPPA+ Sbjct: 71 PRFELPPPLFPPPP----LPRLPPPLLPPPEEP--PREPPPPPPPPEEPPPPAS 118 Score = 35.9 bits (79), Expect = 0.043 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPP P PPPPP PP P P Sbjct: 77 PPLFPPPPLPRLPPPLLPPPEEPPRE--PPPPPPPPEEPPP 115 Score = 35.5 bits (78), Expect = 0.057 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = +3 Query: 813 PLXXXPXPP--PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPP--RAPRXAXXPPP 968 P P P PP PP P PPP P P PP PR PPP Sbjct: 53 PRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPP 108 Score = 35.5 bits (78), Expect = 0.057 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXP---PPPPXXPXXXPXP 223 P P F PL PPP PP P PPPP P P P Sbjct: 71 PRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPP 115 Score = 35.5 bits (78), Expect = 0.057 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P PPP PP PPPPP P P P Sbjct: 76 PPPLFPPPPLPRLPPPLLPPPE-EPPREPPPPPPPPEEPPPP 116 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P PPP PP + P PPP P P PP PR PP Sbjct: 38 PLSPPPSPPPSP----SSPPRLPPPFPALFP-PEPPLPPRFELPPP 78 Score = 33.9 bits (74), Expect = 0.17 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P P PLF PP PP PPP P P P Sbjct: 65 PEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPP 106 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +3 Query: 465 PXTPXXXGP--PPPPXPXXXXPPPPPXPPXXPXP 560 P P P PPP P PPPPP P P P Sbjct: 83 PPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPPP 116 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 9/41 (21%) Frame = +2 Query: 872 PRXPPPXPPPXP---PXXPXPXP------PPXPXXGXAPPP 967 P PPP PPP P P P P P PP P PPP Sbjct: 38 PLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPP 78 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P PP P P PP PPP Sbjct: 82 PPPLPRLPPPLLPPPEEPPREPPPPPPPP 110 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P P P P PPP P PP Sbjct: 29 PPPLVFPLLPLSPPPSPPPSPSSPPRLPP 57 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +3 Query: 417 GGGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPX-PPXXPXP 560 G G PP P +P PP P P PP P PP P P Sbjct: 22 GTTGTCCPPPLVFPLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLP 70 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 429 GXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRF 575 G PP G P P P P P PP P PP P P F Sbjct: 17 GNLPPGTTGTCCP--PPLVFPLLPLSPPPSPPPSPSSPPRLPPPFPALF 63 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +3 Query: 474 PXXXGPP--PPPXPXXXXPPPPPXPPXXPXP 560 P PP PPP P PP PP PP P Sbjct: 47 PSPSSPPRLPPPFPA-LFPPEPPLPPRFELP 76 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +3 Query: 846 PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 PPP P PPP P P PP PP Sbjct: 29 PPPLVFPLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPP 68 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 36.7 bits (81), Expect = 0.025 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 441 PXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P P PPPPP PP PP P P P Sbjct: 110 PPPESTNSPPPPEVFEPPPPPADEDESPPAPPPPEQLPPP 149 Score = 35.5 bits (78), Expect = 0.057 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +3 Query: 465 PXTPXXXGPPPPPX--PXXXXPPPPPXPPXXP 554 P P PPPPP P PPPP PP P Sbjct: 69 PPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIP 100 Score = 35.1 bits (77), Expect = 0.076 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 P+ PP PP P PP PP PP P PPPA+ Sbjct: 98 PIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPPEQLPPPAS 151 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRF 575 P P PPPP P PP P PP P P + F Sbjct: 68 PPPPPLDSSPPPP-PDLTPPPSSPPPPDAPPPIPIVF 103 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPP P PPP P P P PPP Sbjct: 77 PPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPP 120 Score = 33.5 bits (73), Expect = 0.23 Identities = 23/69 (33%), Positives = 23/69 (33%), Gaps = 7/69 (10%) Frame = +3 Query: 786 PXAGGXGXXPLXXXPXPPP---PPP--PXXXXXXRAXPXXXPPP--XPPXXPXXXPPRAP 944 P PL P PPP PPP P P PPP PP PP Sbjct: 63 PTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPE 122 Query: 945 RXAXXPPPA 971 PPPA Sbjct: 123 VFEPPPPPA 131 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPP PP A P P P PP P + PPP Sbjct: 37 PPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPP 80 Score = 32.7 bits (71), Expect = 0.40 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 7/52 (13%) Frame = +3 Query: 834 PPP----PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRA---PRXAXXPPP 968 PPP PPPP P PPP P P PP P PPP Sbjct: 61 PPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPP 112 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPP---XPPXXPXP 560 P PPPP P PPPPP PP P P Sbjct: 62 PPTVSSPPPP-PLDSSPPPPPDLTPPPSSPPP 92 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXP 217 PPP PP PPPP P P Sbjct: 79 PPPDLTPPPSSPPPPDAPPPIP 100 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPR--APRXAXXPPPAA 974 PPP P P PP PP PP P + PPP A Sbjct: 47 PPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDA 95 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 10/39 (25%) Frame = +3 Query: 474 PXXXGPPP-----PPXPXXXXPPPPP-----XPPXXPXP 560 P PPP PP P PPPPP PP P P Sbjct: 105 PPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPP 143 Score = 29.1 bits (62), Expect = 5.0 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXP--PPXPPXXPXXXPPRAPRXAXXPPPA 971 P PP PPPP + P P P P PP AP PPA Sbjct: 130 PADEDESPPAPPPPEQLPPPASSPQGGPKKPKKHHPGPATSPP-APSAPATSPPA 183 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 2/43 (4%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP--XPPXXPXP 560 PP P P PPP P PPP P PP P Sbjct: 68 PPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSP 110 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P P P PPP PP P PP P P P Sbjct: 68 PPPPPLDSSPPPPPDLTPPPSSPPP--PDAPPPIPIVFPPP 106 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 36.7 bits (81), Expect = 0.025 Identities = 23/73 (31%), Positives = 23/73 (31%), Gaps = 1/73 (1%) Frame = -1 Query: 312 GPGAPPXXXPPXSXXXXFSXXKXXXXXPPXGXGXXXGXXGG-GGGXXGGXXXGGGXXXXG 136 GP P PP P G G G GG GGG GG GGG G Sbjct: 66 GPTTPTGGYPPLDGTTPTGGYPPLYGTTPPGGGDVGGGGGGYGGGTPGGGGGGGGDTGAG 125 Query: 135 XXQXXKXGXGXGG 97 G G G Sbjct: 126 AGGGGYGGGGDTG 138 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -3 Query: 586 PXXXKRTXXGXGXXGGXGGG-GGXXXXGXGGGGGPXXXGVXG 464 P T G G GG GGG GG G GGGGG G G Sbjct: 87 PPLYGTTPPGGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGG 128 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG P G GGG G G GG GGG G Sbjct: 108 GGGTPGGGGGGGGDTGAGAGGGGYGGGGDTG 138 Score = 34.3 bits (75), Expect = 0.13 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGG 491 G G GG GGGGG G GGGG Sbjct: 108 GGGTPGGGGGGGGDTGAGAGGGG 130 Score = 32.7 bits (71), Expect = 0.40 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG G GG G GG GGG A GGGG G G Sbjct: 96 GGGDVG--GGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAG 140 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 960 GAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 G G GGG G G GG GGG G G Sbjct: 96 GGGDVGGGGGGYGGGTPGGGGGGGGDTGAG 125 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG GGG G G G GGG G G Sbjct: 118 GGGDTGAGAGGGGYGGGGDTGAGGGVGSG 146 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -3 Query: 589 PPXXXKRTXXGXGXXGGX--GGGGGXXXXGXGGGGGPXXXG 473 PP G G GG GGGGG G G GGG G Sbjct: 94 PPGGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGG 134 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG G GG G GG GGG G GGG G G G Sbjct: 97 GGDVGGGGGGYGGGTPG--GGGGGGGDTGAGAGGGGYGGGGDTGAGGGVGSG 146 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXG--GXXXGGGXXXXGXXQXXKXGXGXG 100 G G G GGGGG G G GGG G G G G Sbjct: 104 GGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGGGVGSG 146 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 36.7 bits (81), Expect = 0.025 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P PP PP P PPP PPP Sbjct: 64 PPPPSPPPPACPPPPALPPPPPKKVSSYCPPP 95 Score = 35.5 bits (78), Expect = 0.057 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 P PP PPPP P PPP P PP P Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPPP 97 Score = 35.5 bits (78), Expect = 0.057 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P PPPP P PPPP PP P Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPP 85 Score = 35.1 bits (77), Expect = 0.076 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = +3 Query: 471 TPXXXGPPPPPXPXXXXPPPP--PXPPXXPXP 560 +P PPPP P PPPP P PP P P Sbjct: 52 SPSCIQNPPPPSPPPPSPPPPACPPPPALPPP 83 Score = 34.3 bits (75), Expect = 0.13 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 PP P P PP P P PP P PP + Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPPKK 87 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +2 Query: 152 PPPXWXPPXXPPPP--PXXPXXXPXP 223 PPP PP PPPP P P P P Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPP 84 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/45 (33%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = +3 Query: 465 PXTPXXXGPPPP---PXPXXXXPPPPPXPPXXPXPXXVRFXXXGG 590 P +P PPPP P P PPP P P F G Sbjct: 61 PPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPPPANFLYITG 105 Score = 29.1 bits (62), Expect = 5.0 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P PPPP P P PP PP P P + PPPA Sbjct: 61 PPSPPPPSP--------PPPACPP--PPALPPPPPKKVSSYCPPPPPA 98 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXP 217 PPP PP PPPP P P Sbjct: 64 PPPPSPPPPACPPPPALPPPPP 85 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXPXG 229 PP P P PPP PPPPP P G Sbjct: 65 PPPSPPPPACPPPPALPPPPPKKVSSYCPPPPPANFLYITGPPG 108 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP 536 PP P P PPPP PPPPP Sbjct: 66 PPSPPPPACPPPPALP-PPPPKKVSSYCPPPPP 97 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 36.3 bits (80), Expect = 0.033 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 4/55 (7%) Frame = +3 Query: 813 PLXXXPXPP----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P P PP PPPPP A PPP P P P P PP Sbjct: 102 PATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPP 156 Score = 34.7 bits (76), Expect = 0.10 Identities = 21/74 (28%), Positives = 24/74 (32%), Gaps = 8/74 (10%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXP--XXXPPP------XPPXXPXX 926 P+ P P+ P P PPP P PPP PP P Sbjct: 45 PQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPAT 104 Query: 927 XPPRAPRXAXXPPP 968 PP P+ PPP Sbjct: 105 TPPAPPQTVSPPPP 118 Score = 33.1 bits (72), Expect = 0.31 Identities = 38/182 (20%), Positives = 42/182 (23%), Gaps = 3/182 (1%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXX 617 PP P +P PP P PPP PP P P P Sbjct: 36 PPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSP-PVITSPPPTVASSPPPPVVI 94 Query: 618 XTXXXXXXXRAXGA--XGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPX 791 + A P P P P P P P Sbjct: 95 ASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPS 154 Query: 792 AGGXG-XXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPPP + P PP P PR A P Sbjct: 155 PPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDPSTLAPPPTPLPVVPREKPIAKPTGP 214 Query: 969 AA 974 A+ Sbjct: 215 AS 216 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PPP PP PP P PP +P PPP Sbjct: 32 PSAPPPVTPPPSPPQSPPPV-VSSSPPPPVVSSPPPSSSPPPSPPVITSPPP 82 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 P P PP PP P PPP PP Sbjct: 29 PTTPSAPPPVTPPPSPPQSPPPVVSSSPPPP 59 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PP PPP P P P +PPP Sbjct: 41 PPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPP 72 Score = 29.1 bits (62), Expect = 5.0 Identities = 17/49 (34%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +3 Query: 840 PPPPPXXXXXXRAXPXXXPPPXPPXXP----XXXPPRAPRXAXXPPPAA 974 PPP A P PPP PP P PP P PPP++ Sbjct: 22 PPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPP--PPVVSSPPPSS 68 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 36.3 bits (80), Expect = 0.033 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P PPPPP PPPPP P P P Sbjct: 85 PASPQPPPPPPIENLPPPPPPLPKFSPSP 113 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 P P P PPP P P PPP P +P R Sbjct: 85 PASPQPPPPPPIENLPPP-PPPLPKFSPSPIKR 116 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 137 PLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P PPP PPPPP P P P Sbjct: 85 PASPQPPPPPPIENLPPPPPPLPKFSPSP 113 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 36.3 bits (80), Expect = 0.033 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 6/52 (11%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPP----PPXPP--XXPXPXXVRF 575 PP P P PPPPP PPP PP PP P P V F Sbjct: 108 PPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLF 159 Score = 35.5 bits (78), Expect = 0.057 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPP----PPXPPXXPXP 560 PP P P PPPPP PPP PP PP P Sbjct: 45 PPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSP 89 Score = 35.5 bits (78), Expect = 0.057 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPP----PPXPPXXPXP 560 PP P P PPPPP PPP PP PP P Sbjct: 54 PPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSP 98 Score = 35.5 bits (78), Expect = 0.057 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Frame = +3 Query: 813 PLXXXPXPPP----PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P+ P PPP PPPP P PP PP PP P PPP Sbjct: 57 PVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPV--LLSPPPPPVNLSPPPP 110 Score = 35.5 bits (78), Expect = 0.057 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPP----PPXPPXXPXP 560 PP P P PPPPP PPP PP PP P Sbjct: 63 PPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSP 107 Score = 35.5 bits (78), Expect = 0.057 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Frame = +3 Query: 813 PLXXXPXPPP----PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P+ P PPP PPPP P PP PP PP P PPP Sbjct: 66 PVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPV--NLSPPPPPVNLSPPPP 119 Score = 35.5 bits (78), Expect = 0.057 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Frame = +3 Query: 813 PLXXXPXPPP----PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P+ P PPP PPPP P PP PP PP P PPP Sbjct: 75 PVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPV--NLSPPPPPVLLSPPPP 128 Score = 35.5 bits (78), Expect = 0.057 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPP----PPXPPXXPXP 560 PP P P PPPPP PPP PP PP P Sbjct: 81 PPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSP 125 Score = 35.5 bits (78), Expect = 0.057 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Frame = +3 Query: 813 PLXXXPXPPP----PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P+ P PPP PPPP P PP PP PP P PPP Sbjct: 84 PVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPV--LLSPPPPPVLLSPPPP 137 Score = 35.5 bits (78), Expect = 0.057 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Frame = +3 Query: 813 PLXXXPXPPP----PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P+ P PPP PPPP P PP PP PP P PPP Sbjct: 93 PVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPV--LLSPPPPPVNLSPPPP 146 Score = 35.5 bits (78), Expect = 0.057 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Frame = +3 Query: 813 PLXXXPXPPP----PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P+ P PPP PPPP P PP PP PP P PPP Sbjct: 102 PVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPV--NLSPPPPPVLLSPPPP 155 Score = 35.1 bits (77), Expect = 0.076 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPP----PPXPPXXPXP 560 PP P P PPPPP PPP PP PP P Sbjct: 72 PPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSP 116 Score = 35.1 bits (77), Expect = 0.076 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPP----PPXPPXXPXP 560 PP P P PPPPP PPP PP PP P Sbjct: 99 PPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSP 143 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 4/58 (6%) Frame = +3 Query: 813 PLXXXPXPPP----PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 P+ P PPP PPPP P PP P PP R P P A Sbjct: 129 PVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRPQA 186 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 6/47 (12%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPP------PPXPXXXXPPPPPXPPXXPXP 560 PP P P PPP PP P PPPPP P P Sbjct: 135 PPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPP 181 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPP----PPXPPXXPXP 560 PP P P PPPPP PPP PP PP P Sbjct: 90 PPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSP 134 Score = 33.9 bits (74), Expect = 0.17 Identities = 20/59 (33%), Positives = 22/59 (37%), Gaps = 7/59 (11%) Frame = +3 Query: 813 PLXXXPXPPP---PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXA----XXPPP 968 P+ P PPP PPP P PP PP PP P+ A PPP Sbjct: 138 PVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPP 196 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVR 572 PP P P PPPP P PPPPP P P R Sbjct: 126 PPPPVLLSPPPPPVNLSPPPP--PVLLSPPPPPVLFSPPPPTVTR 168 Score = 32.7 bits (71), Expect = 0.40 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 5/57 (8%) Frame = +3 Query: 813 PLXXXPXPPPP-----PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PL PPPP PPP P PP PP PP P PPP Sbjct: 38 PLVDLSPPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPV--NLSPPPPPVNLSPPPP 92 Score = 32.3 bits (70), Expect = 0.53 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = +3 Query: 813 PLXXXPXPPP----PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P+ PPP PPPP P PP PP PP P PPP Sbjct: 48 PVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPV--NLSPPPPPVLLSPPPP 101 Score = 32.3 bits (70), Expect = 0.53 Identities = 20/62 (32%), Positives = 21/62 (33%), Gaps = 10/62 (16%) Frame = +3 Query: 813 PLXXXPXPPP-----PPPPXXXXXXRAXPXXXPPP-----XPPXXPXXXPPRAPRXAXXP 962 P+ P PPP PPPP PPP PP P P P P Sbjct: 111 PVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPP 170 Query: 963 PP 968 PP Sbjct: 171 PP 172 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPP 545 PPPPP PPPP PP Sbjct: 194 PPPPPYKYGRVYPPPPPPP 212 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PP P PP P +PPP Sbjct: 54 PPPPVNLSPPPPPVNLSPPPPPVNLSPPP 82 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PP P PP P +PPP Sbjct: 63 PPPPVNLSPPPPPVNLSPPPPPVNLSPPP 91 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 7/39 (17%) Frame = +2 Query: 872 PRXPP----PXPPPX---PPXXPXPXPPPXPXXGXAPPP 967 P PP P PPP PP P PP P +PPP Sbjct: 80 PPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPP 118 Score = 29.9 bits (64), Expect = 2.8 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 5/56 (8%) Frame = +3 Query: 816 LXXXPXPPP-----PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 L P P P PPPP P PP PP PP P PPP Sbjct: 30 LTSAPEPAPLVDLSPPPPPVNISSPPPPVNLSPPPPPV--NLSPPPPPVNLSPPPP 83 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 7/39 (17%) Frame = +2 Query: 872 PRXPP----PXPPPX---PPXXPXPXPPPXPXXGXAPPP 967 P PP P PPP PP P PP P +PPP Sbjct: 107 PPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPP 145 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 7/39 (17%) Frame = +2 Query: 872 PRXPP----PXPPPX---PPXXPXPXPPPXPXXGXAPPP 967 P PP P PPP PP PPP P +PPP Sbjct: 143 PPPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPP 181 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 PPPPPPP + P PPP P P P Sbjct: 206 PPPPPPPQAARSYKRSP---PPPPPSKYGRVYSPPPP 239 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 10/57 (17%) Frame = +3 Query: 828 PXPPP-----PPPPXXXXXXRAXPXXXPPPXP-----PXXPXXXPPRAPRXAXXPPP 968 P PPP PPPP PPP P P P P P PPP Sbjct: 44 PPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPP 100 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 4/32 (12%) Frame = +2 Query: 881 PPPXP----PPXPPXXPXPXPPPXPXXGXAPP 964 PPP P PP PP P PPP PP Sbjct: 62 PPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPP 93 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +2 Query: 881 PPPXP----PPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P PP PP P PPP PPP Sbjct: 125 PPPPPVLLSPPPPPVNLSPPPPPV-LLSPPPPP 156 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP 536 PP P P PPPPP PPP P Sbjct: 152 PPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRP 184 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PP P PP P +PPP Sbjct: 99 PPPPVNLSPPPPPVNLSPPPPPVLLSPPP 127 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 7/39 (17%) Frame = +2 Query: 872 PRXPP----PXPPPX---PPXXPXPXPPPXPXXGXAPPP 967 P PP P PPP PP P PP P +PPP Sbjct: 116 PPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPP 154 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 460 PXPXXXGGXXPPPPPPP 410 P P G PPPPPPP Sbjct: 196 PPPYKYGRVYPPPPPPP 212 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 4/28 (14%) Frame = +3 Query: 489 PPPPPXPXXXXPPP----PPXPPXXPXP 560 PPPPP PPP PP PP P Sbjct: 44 PPPPPVNISSPPPPVNLSPPPPPVNLSP 71 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PP P PP P +PPP Sbjct: 135 PPPPVNLSPPPPPVLLSPPPPPVLFSPPP 163 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G GG GG GGG G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSG 119 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 A G G RGG G G GGG G GGGGGGG Sbjct: 82 AQSRGSGGGGGGRGGSGGGYRSGGGGGYSGGGG---GGYSGGGGGGG 125 Score = 32.7 bits (71), Expect = 0.40 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 G G G GGG G GG GG GGG Sbjct: 96 GSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGG 488 G GG GGGG G GGGGG Sbjct: 104 GGGGGYSGGGGGGYSGGGGGGG 125 Score = 31.9 bits (69), Expect = 0.71 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -3 Query: 946 RGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGG--GGGGXG 827 RG+ GG G GG GGG G GGG GGGG G Sbjct: 85 RGSGGGG--GGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 36.3 bits (80), Expect = 0.033 Identities = 36/151 (23%), Positives = 38/151 (25%), Gaps = 2/151 (1%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXXXXRAXGAXGA 668 PPPPP P PPP P P F + A Sbjct: 31 PPPPPCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPP 90 Query: 669 XGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXXXP--XPPP 842 P P P P P P P PL P PP Sbjct: 91 KPLPPPLSPPQTTPPP-----PPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPK 145 Query: 843 PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPP 935 P PP + P PPP P P PP Sbjct: 146 PLPPPL-----SPPQTTPPPPPAITPPLSPP 171 Score = 36.3 bits (80), Expect = 0.033 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPP-PXPP--XXPXXXPPRAPRXAXXPPPA 971 PPPPP P PP P PP P PP P PPPA Sbjct: 69 PPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPA 117 Score = 35.1 bits (77), Expect = 0.076 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 840 PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPP P P P PP P P AP PPP Sbjct: 31 PPPPPCICICNPGPPPPQPDPQPPTPPTFQP--APPANDQPPP 71 Score = 35.1 bits (77), Expect = 0.076 Identities = 22/68 (32%), Positives = 23/68 (33%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRX 950 P+ P L P PPP PP P PPP P P PP P Sbjct: 73 PQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPP--PPAITPPPPPAITPPLSPP--PPA 128 Query: 951 AXXPPPAA 974 PPP A Sbjct: 129 ITPPPPLA 136 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 P PPP P P PP P P P PPP+ Sbjct: 42 PGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQ 74 Score = 33.9 bits (74), Expect = 0.17 Identities = 22/74 (29%), Positives = 24/74 (32%), Gaps = 6/74 (8%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPP----XPPXXP--XXXP 932 P+ P P PPPPP P PPP PP P P Sbjct: 90 PKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPP 149 Query: 933 PRAPRXAXXPPPAA 974 P +P PPP A Sbjct: 150 PLSPPQTTPPPPPA 163 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +2 Query: 872 PRXPP-PXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PP P PPP P P PPP P PPP Sbjct: 86 PALPPKPLPPPLSP--PQTTPPPPPAITPPPPP 116 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPX--PPXXPXPXXV 569 P +P PPPPP PPPPP PP P P + Sbjct: 96 PLSPPQTTPPPPPA---ITPPPPPAITPPLSPPPPAI 129 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 4/57 (7%) Frame = +3 Query: 813 PLXXXPXPP----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P PP PPPPP P PP P P P P+ PPPA Sbjct: 56 PPTFQPAPPANDQPPPPPQSTSPP---PVATTPPALPPKPLPPPLSPPQTTPPPPPA 109 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 P PP PP PP P PP P PP Sbjct: 104 PPPPPAITPPPPPAITPPLSPPPPAITPPPP 134 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P P P PPP PPP Sbjct: 78 PPPVATTPPALPPKPLPPPLSPPQTTPPP 106 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPP-XPXXXXPPPPPXPPXXP 554 PP P P PPPPP PPPP P P Sbjct: 95 PPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPP 134 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPP P PPPP P P Sbjct: 131 PPPPLATTPPALPPKPLPPPLSPPQTTPPPPPAITPPLSPP 171 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P P PP A P PP PP P A P P Sbjct: 46 PPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKP 92 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 4/45 (8%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPP----PPXPPXXPXP 560 PP P P P PP P PPP PP P P P Sbjct: 104 PPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLP 148 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +3 Query: 828 PXPPPP---PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P PPPP P P + P P PP PP A PP Sbjct: 42 PGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPP 90 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/42 (30%), Positives = 13/42 (30%) Frame = +3 Query: 843 PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPP P P P P P P PPP Sbjct: 31 PPPPPCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQPPPP 72 Score = 28.7 bits (61), Expect = 6.6 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 11/65 (16%) Frame = +3 Query: 813 PLXXXPXPPP----PPP----PXXXXXXRAXPXXXPP---PXPPXXPXXXPPRAPRXAXX 959 P P PPP PPP P P PP P PP PP A Sbjct: 64 PANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLS 123 Query: 960 PPPAA 974 PPP A Sbjct: 124 PPPPA 128 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P P PPP P PPPP P P Sbjct: 86 PALPPKPLPPPLSPPQTTPPPPPAITPPPP 115 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +3 Query: 453 GXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 G P PPP P PPP PP P Sbjct: 250 GFSCPGPSPTISPPPLPPQTLKPPPPQTTPPPPP 283 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P PPP P PPPP P P P Sbjct: 89 PPKPLPPPL--SPPQTTPPPPPAITP--PPPPAITPPLSPPP 126 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXP 217 PP P P PPP P PPPP P Sbjct: 95 PPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPP 134 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +2 Query: 881 PPPXPPPX---PPXXPXPXPPPXPXXGXAPP 964 PPP PP PP P PPP +PP Sbjct: 262 PPPLPPQTLKPPPPQTTPPPPPAITPPLSPP 292 >At1g35617.1 68414.m04424 hypothetical protein Length = 121 Score = 36.3 bits (80), Expect = 0.033 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PPP P P PP PP PP P P Sbjct: 21 PPPAPPPESSSPPTPPEPPDPPDP 44 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +2 Query: 881 PPPXPPPX---PPXXPXPXPPPXP 943 PPP PPP PP P P PP P Sbjct: 21 PPPAPPPESSSPPTPPEPPDPPDP 44 >At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 473 Score = 29.1 bits (62), Expect(2) = 0.039 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 826 PPXPPPPPPP 855 PP PPPPPPP Sbjct: 282 PPPPPPPPPP 291 Score = 29.1 bits (62), Expect = 5.0 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 826 PPXPPPPPPP 855 PP PPPPPPP Sbjct: 329 PPPPPPPPPP 338 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 829 PXPPPPPPPXXP 864 P PPPPPPP P Sbjct: 280 PSPPPPPPPPPP 291 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 829 PXPPPPPPPXXP 864 P PPPPPPP P Sbjct: 282 PPPPPPPPPPLP 293 Score = 28.3 bits (60), Expect(2) = 0.11 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPP 934 PPP PPP PP PP Sbjct: 329 PPPPPPPPPPVEYYKSPP 346 Score = 25.8 bits (54), Expect(2) = 0.039 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 835 PPPPPPPXXP 864 PPPPPPP P Sbjct: 329 PPPPPPPPPP 338 Score = 25.0 bits (52), Expect(2) = 0.11 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 872 PRXPPPXPPPXP 907 P PPP PPP P Sbjct: 280 PSPPPPPPPPPP 291 Score = 24.2 bits (50), Expect(2) = 9.6 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 884 PPXPPPXPPXXPXP 925 P PPP PP P P Sbjct: 280 PSPPPPPPPPPPLP 293 Score = 22.2 bits (45), Expect(2) = 9.6 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +2 Query: 917 PXPXPPPXPXXGXAPPP 967 P P PPP P PP Sbjct: 330 PPPPPPPPPVEYYKSPP 346 >At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 244 Score = 35.9 bits (79), Expect = 0.043 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXP 803 G A GA GG G GG GG G + GGG GG G P Sbjct: 154 GASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASGGASGDKP 208 Score = 35.5 bits (78), Expect = 0.057 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 A GG GA GG G GG GG G + GGG GG Sbjct: 137 ASGGGDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGG 182 Score = 34.7 bits (76), Expect = 0.10 Identities = 23/62 (37%), Positives = 24/62 (38%), Gaps = 2/62 (3%) Frame = -3 Query: 973 AAGGGXX-AXRGARGGXXXGXXGG-XGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPX 800 A+GGG A GA GG G GG GG G GG GGG G G Sbjct: 147 ASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASGGASGD 206 Query: 799 PP 794 P Sbjct: 207 KP 208 Score = 32.3 bits (70), Expect = 0.53 Identities = 21/66 (31%), Positives = 24/66 (36%), Gaps = 3/66 (4%) Frame = -3 Query: 973 AAGGGXX---AXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXP 803 A+GGG A G GG G GG GG G + GG GG G P Sbjct: 137 ASGGGDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGP 196 Query: 802 XPPAXG 785 + G Sbjct: 197 GGASGG 202 Score = 31.5 bits (68), Expect = 0.93 Identities = 19/60 (31%), Positives = 21/60 (35%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPP 794 + G A GA GG G GG GG G + GG GG G G P Sbjct: 160 SGGASGGASGGASGGASGGGPGGASGGGPGGAS---GGGPGGASGGASGDKPEGAPGDKP 216 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/60 (28%), Positives = 19/60 (31%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPPAXG 785 GG GG G GG GG G + GG GG G P + G Sbjct: 135 GGASGGGDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGG 194 Score = 29.9 bits (64), Expect = 2.8 Identities = 20/65 (30%), Positives = 22/65 (33%), Gaps = 1/65 (1%) Frame = -3 Query: 973 AAGGGXX-AXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXP 797 A+GGG A G GG G GG GG GG GG G P Sbjct: 175 ASGGGPGGASGGGPGGASGGGPGGASGGASGDKPEGAPGDKPGGAWGGKPGKKPGHKPEG 234 Query: 796 PAXGR 782 G+ Sbjct: 235 ARGGK 239 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 35.9 bits (79), Expect = 0.043 Identities = 42/171 (24%), Positives = 46/171 (26%), Gaps = 4/171 (2%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXXXX 644 P TP G PP P P PP P P GG P T Sbjct: 440 PTTPSPGGSPPSPS---IVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTP------ 490 Query: 645 RAXGAXGAXGXPGPXGXPXXXX--PXGGGGGPXXXXXXXXXXXXPRXXR-PXAGGXGXXP 815 + P P G P P GG P P P + G P Sbjct: 491 -GGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSP 549 Query: 816 LXXXPXPP-PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P P P PP P PP P P P +P + PP Sbjct: 550 SSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGP--SPPSSPSPP 598 Score = 35.1 bits (77), Expect = 0.076 Identities = 44/189 (23%), Positives = 46/189 (24%), Gaps = 5/189 (2%) Frame = +3 Query: 411 GGGGGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGG 590 G G G P P TP G PP P P P PP P P Sbjct: 396 GSFGCGRSTRPPVVVPSPPTTPSPGGSPPSPSISPSPPITVPSPPTTPSP---------- 445 Query: 591 GXRPXXXXXXTXXXXXXXRAXGAXGAXGXPGPXGXP--XXXXPXGGGGGPXXXXXXXXXX 764 G P + P P G P P GG P Sbjct: 446 GGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGG 505 Query: 765 XXP-RXXRPXAGGXGXXPLXXXPXPP--PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPP 935 P P GG P P PP P PP + P P P P Sbjct: 506 SPPSSPTTPSPGGSPPSP-SISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTP 564 Query: 936 RAPRXAXXP 962 P P Sbjct: 565 STPPTPISP 573 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXP-XXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPP P PPP PP PP P PPP Sbjct: 758 PPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPP 803 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P PPP P PPPPP P P P Sbjct: 716 PPPPHYSLPPPTPTYHYISPPPPPTPIHSPPP 747 Score = 32.7 bits (71), Expect = 0.40 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXP---XXXPPPXPPXXPXXXPPRAPRXAXXPP 965 PPPPP P ++ P PPP P PP +P PP Sbjct: 735 PPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPP 781 Score = 32.3 bits (70), Expect = 0.53 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +3 Query: 465 PXTPXXXGPPP-PPXPXXXXPPPPPXPPXXPXPXXV 569 P +P PPP PP PPPPP P P V Sbjct: 771 PPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPV 806 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP 536 PP P PPPPP P PPP P Sbjct: 751 PPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSP 783 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 441 PXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P G P +P PP P P P P PP P P Sbjct: 584 PPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPPPSTPTP 623 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXP-----PPPPXPPXXPXPXXV 569 PP P +P PP P P P P PP PP P P V Sbjct: 561 PPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPPIV 609 Score = 30.3 bits (65), Expect = 2.2 Identities = 34/177 (19%), Positives = 38/177 (21%), Gaps = 3/177 (1%) Frame = +3 Query: 423 GGGXXPPXXXGXGXPXTPXXXGP---PPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGG 593 GG P TP P P P P P P P P GG Sbjct: 446 GGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGG 505 Query: 594 XRPXXXXXXTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXP 773 P + + P P P P Sbjct: 506 SPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPS 565 Query: 774 RXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 P + G P+ P P PP P PP P PP P Sbjct: 566 TPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPP-LPPVIPSPPIVGPTPSSPPPSTP 621 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 492 PPPPXPXXXXPPPPPXPPXXPXP 560 PPPP P P PP PP P Sbjct: 702 PPPPAPYYYSSPQPPPPPHYSLP 724 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPP P P P PP PP P A PP Sbjct: 736 PPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPP 780 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 492 PPPPXPXXXXPPPPPXPPXXPXP 560 PPPP PPPPP P P Sbjct: 758 PPPPPTVHYNPPPPPSPAHYSPP 780 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXG-PPPPPXPXXXXPPPPP--XPPXXPXP 560 PP P P PPPPP PPPPP P P P Sbjct: 783 PPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPPIP 826 Score = 29.9 bits (64), Expect = 2.8 Identities = 37/185 (20%), Positives = 44/185 (23%), Gaps = 5/185 (2%) Frame = +3 Query: 426 GGXXPPXXXGXGXPXTPXXXGPPPP----PXPXXXXPPPPPXPPXXPXPXXVRFXXXGGG 593 GG P P T G PP P P P P P P GG Sbjct: 446 GGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGG 505 Query: 594 XRPXXXXXXTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXP 773 P + + P P P P Sbjct: 506 SPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPS 565 Query: 774 RXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXP-PRAPRX 950 P + G P+ P P PP + P PP P P P P +P Sbjct: 566 TPPTPISPGQNSPPIIPSPPFTGPSPP-------SSPSPPLPPVIPSPPIVGPTPSSPPP 618 Query: 951 AXXPP 965 + P Sbjct: 619 STPTP 623 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/47 (31%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXX---GPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P +P PPPPP PPPP P P + Sbjct: 771 PPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPPI 817 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 893 PPPXPPXXPXPXPPPXPXXGXAPP 964 PPP P P PPP P PP Sbjct: 703 PPPAPYYYSSPQPPPPPHYSLPPP 726 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 4/34 (11%) Frame = +2 Query: 881 PPPXP----PPXPPXXPXPXPPPXPXXGXAPPPR 970 PPP P PP P PPP P +PPP+ Sbjct: 715 PPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQ 748 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = +2 Query: 872 PRXPPPX----PPPXPPXXPXPXPPPXPXXGXAPPP 967 P+ PP PPP P P PPP P +PPP Sbjct: 747 PQSHPPCIEYSPPPPPTVHYNPPPPPSPAH-YSPPP 781 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 5/29 (17%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPP-----XPPXXPXP 560 P PPP P PPP P PP P P Sbjct: 713 PQPPPPPHYSLPPPTPTYHYISPPPPPTP 741 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +2 Query: 872 PRXPPPXPPPXP-PXXPXPXPPPXPXXGXAPP 964 P PP P P P P PP P G +PP Sbjct: 419 PGGSPPSPSISPSPPITVPSPPTTPSPGGSPP 450 Score = 28.3 bits (60), Expect = 8.7 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 7/49 (14%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWX-PPXXP------PPPPXXPXXXPXP 223 PP P P P PPP + PP P PPPP P P P Sbjct: 702 PPPPAPYYYSSPQP---PPPPHYSLPPPTPTYHYISPPPPPTPIHSPPP 747 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 887 PXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP P P PP PPP Sbjct: 768 PPPPPSPAHYSPPPSPPVYYYNSPPPP 794 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 893 PPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P P PPP PPP Sbjct: 791 PPPPPAVHYSPPPPPVIHHSQPPPP 815 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 35.9 bits (79), Expect = 0.043 Identities = 41/178 (23%), Positives = 45/178 (25%), Gaps = 11/178 (6%) Frame = +3 Query: 465 PXTPXXXGPPPP-----PXPXXXXPPPP---PXPPXXPXPXXVRFXXXGGGXRPXXXXXX 620 P +P PPPP P P PPPP P PP P V P Sbjct: 639 PQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVH- 697 Query: 621 TXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGG 800 + P P P P P P Sbjct: 698 -SPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPV 756 Query: 801 XGXXPLXXXPXPPP---PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P P PPP PPPP P PP PP +P + PP Sbjct: 757 HSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPP 814 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P+ PPP PP P P P P P Sbjct: 742 PPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPP 783 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPP---XXPPPPPXXPXXXP 217 P P P P+F PPP PP PPPP P P Sbjct: 647 PPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPP 688 Score = 33.1 bits (72), Expect = 0.31 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = +3 Query: 813 PLXXXPXPP--PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PP PPPP P PPP P P PP AP + PPP Sbjct: 708 PPVHSPPPPVHSPPPPVHSP---PPPVQSPPPPPVFSP---PPPAPIYSPPPPP 755 Score = 32.7 bits (71), Expect = 0.40 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 7/51 (13%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPP----PPXPXXXXPPPP---PXPPXXPXPXXV 569 PP P P PPP PP P PPPP P PP P V Sbjct: 742 PPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPV 792 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPP---PXPXXXXPPPPPXPPXXP 554 PP P P PPPP P P PPPPP P Sbjct: 735 PPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPP 776 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/39 (33%), Positives = 15/39 (38%) Frame = +2 Query: 107 PXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P P+ PPP + PP PP P P P Sbjct: 656 PPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPP 694 Score = 31.5 bits (68), Expect = 0.93 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +2 Query: 107 PXPXXXFXXXPLFXXPPPXWXPPXXP--PPPPXXPXXXPXP 223 P P P+ PPP PP P PPP P P P Sbjct: 713 PPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPP 753 Score = 31.5 bits (68), Expect = 0.93 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +3 Query: 813 PLXXXPXPPP--PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PPP PPP P PP P P P +P PP Sbjct: 729 PPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPP 782 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 7/48 (14%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPP---PPXPXXXXPPP----PPXPPXXPXP 560 PP P P PPP PP P PPP PP P P P Sbjct: 647 PPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPP 694 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/39 (33%), Positives = 15/39 (38%) Frame = +2 Query: 107 PXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P P++ PPP PP P P P P P Sbjct: 663 PPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPP 701 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PP PP P P P P P +PPP Sbjct: 730 PVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPP 761 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPP---PPXPPXXPXP 560 P PPPP P PPP PP P P P Sbjct: 796 PPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLP 827 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/55 (30%), Positives = 19/55 (34%), Gaps = 3/55 (5%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXP---PXXPXXXPPRAPRXAXXPPP 968 P+ P P PPP PPP P P P P P + PPP Sbjct: 716 PVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPP 770 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 3/50 (6%) Frame = +3 Query: 834 PPPP---PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 PPPP PPP PP P P PP P PPP A Sbjct: 699 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPP--VFSPPPPA 746 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PPPPP P PPP P P P PPP Sbjct: 742 PPPPAPIYSPPPPPVHSPPP---PVHSPPPPPVHSPPPPVHSPPPPVHSPPP 790 Score = 29.9 bits (64), Expect = 2.8 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 6/58 (10%) Frame = +3 Query: 813 PLXXXPXPP---PPPP---PXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PP PPPP P P PPP P P P PPP Sbjct: 651 PPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPP 708 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +2 Query: 107 PXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P P+ PPP PP PP P P P Sbjct: 706 PPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPP 744 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 2/43 (4%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPP--XPXXXXPPPPPXPPXXPXP 560 PP P PPPPP P PPP P P P Sbjct: 734 PPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPP 776 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +3 Query: 813 PLXXXPXPP--PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PP PPPP PP P P PP P PPP Sbjct: 658 PPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPP--PPVHSPPPP 709 Score = 29.5 bits (63), Expect = 3.8 Identities = 22/61 (36%), Positives = 23/61 (37%), Gaps = 8/61 (13%) Frame = +3 Query: 813 PLXXXPXPP---PPPP---PXXXXXXRAXPXXXPPP--XPPXXPXXXPPRAPRXAXXPPP 968 P P PP PPPP P P PPP P P PP P + PPP Sbjct: 687 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFS-PPPP 745 Query: 969 A 971 A Sbjct: 746 A 746 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +2 Query: 107 PXPXXXFXXXPLFXXPPPXWXPPXXPP---PPPXXPXXXPXP 223 P P P+ PPP PP PP PPP P P P Sbjct: 774 PPPPVHSPPPPVHSPPPPVHSPP--PPVHSPPPPSPIYSPPP 813 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/50 (32%), Positives = 17/50 (34%), Gaps = 3/50 (6%) Frame = +3 Query: 828 PXPPP---PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPP PPP P P P + PPP Sbjct: 639 PQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPP 688 Score = 29.1 bits (62), Expect = 5.0 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = +3 Query: 813 PLXXXPXPP--PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P PP PPPP PP P P PP P PPP+ Sbjct: 754 PPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP--PPVHSPPPPS 806 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/59 (23%), Positives = 17/59 (28%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPR 947 P +P P P P P P P P P PP P +P+ Sbjct: 525 PEPPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPK 583 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +3 Query: 813 PLXXXPXPP--PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PP PPPP PP P P PP P PPP Sbjct: 665 PPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPP--PPVHSPPPP 716 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +3 Query: 813 PLXXXPXPP--PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PP PPPP PP P P PP P PPP Sbjct: 672 PPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP--PPVHSPPPP 723 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +3 Query: 813 PLXXXPXPPP--PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PPP PPP PP P P PP P PPP Sbjct: 679 PPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP--PPVHSPPPP 730 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXP 217 PP P P++ PPP P PPPP P P Sbjct: 734 PPPPPVFSPPPPAPIYSPPPP---PVHSPPPPVHSPPPPP 770 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 5/35 (14%) Frame = +3 Query: 465 PXTPXXXGPPP---PPXPXXXXPPPPP--XPPXXP 554 P P PPP PP P PPPP PP P Sbjct: 788 PPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKP 822 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/50 (34%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +3 Query: 834 PPPP---PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 PPPP PPP P PPP P PP A P P++ Sbjct: 795 PPPPVHSPPPPSPIYSPPPPVFSPPPKP---VTPLPPATSPMANAPTPSS 841 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 107 PXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXP 217 P P P+F PPP P PPPPP P Sbjct: 728 PPPVQSPPPPPVFSPPPP--APIYSPPPPPVHSPPPP 762 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +2 Query: 107 PXPXXXFXXXPLFXXPPPXW--XPPXXPPPPPXXPXXXPXP 223 P P P+ PPP PP PPPP P P Sbjct: 767 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSP 807 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 35.9 bits (79), Expect = 0.043 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PPPPP P PPPPP P P Sbjct: 231 PPPPPPPHQAQPPPPPPSGLFPPP 254 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 893 PPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PP PPP P G PPP Sbjct: 230 PPPPPPPPHQAQPPPPPPSGLFPPP 254 Score = 34.3 bits (75), Expect = 0.13 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 887 PXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP PP P PPP PPP Sbjct: 230 PPPPPPPPHQAQPPPPPPSGLFPPPPP 256 Score = 33.9 bits (74), Expect = 0.17 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 420 GGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP 536 G G PP P P PPPP P PPPPP Sbjct: 225 GANGLPPP-------PPPPPHQAQPPPPPPSGLFPPPPP 256 Score = 33.5 bits (73), Expect = 0.23 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PP PPP P P PPP PPP Sbjct: 230 PPPPPPPPHQAQPPPPPPSGLFPPPPPP 257 Score = 32.7 bits (71), Expect = 0.40 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 4/28 (14%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXP----PXXPXP 560 PPPPP P PPPP P P P P Sbjct: 230 PPPPPPPPHQAQPPPPPPSGLFPPPPPP 257 Score = 32.7 bits (71), Expect = 0.40 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 PPPPPPP +A P PPP P PP A PPA Sbjct: 231 PPPPPPP-----HQAQP--PPPPPSGLFPPPPPPMANNGFRPMPPA 269 Score = 31.9 bits (69), Expect = 0.71 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P P P P PPP PP PP P PPP Sbjct: 212 PTKPEPNKPQSAVGANGLP---PPPPPPPHQAQPPPPPPSGLFPPPP 255 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 453 GXGXPXTPXXXGPPPPPXPXXXXPPPPPXP 542 G P P PPP P PPPP P Sbjct: 228 GLPPPPPPPPHQAQPPPPPPSGLFPPPPPP 257 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 35.9 bits (79), Expect = 0.043 Identities = 21/62 (33%), Positives = 23/62 (37%), Gaps = 10/62 (16%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXP----------XXXPPPXPPXXPXXXPPRAPRXAXXP 962 PL PPPPPPP R+ P PPP PP P A + P Sbjct: 564 PLRILSRPPPPPPPPPISSLRSTPSPSSTSNSIATQGPPPPPPPPPLQSHRSALSSSPLP 623 Query: 963 PP 968 PP Sbjct: 624 PP 625 Score = 35.1 bits (77), Expect = 0.076 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPP--XXPXXXPPRAPRXAXXPPP 968 P PPPPPPP PPP PP PP P PPP Sbjct: 601 PPPPPPPPPLQSHRSALSSSPLPPPLPPKKLLATTNPPPPP-----PPP 644 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 35.9 bits (79), Expect = 0.043 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 GGG + GG G G GGG G + GGG GGG Sbjct: 33 GGGSGKGQWLHGGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGG 77 Score = 35.1 bits (77), Expect = 0.076 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G GG GG GGG G GGGGGGG G G Sbjct: 49 GGGGEGGGGEGGGGQKISKGGGGGGSGGG----QRSSSGGGGGGGEGDGGGG 96 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXR 874 GGG G GGG GG GGG GGG R Sbjct: 49 GGGGEGGGGEGGGGQKISKGGGGGGSGGGQR 79 Score = 31.9 bits (69), Expect = 0.71 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG G GGG GGGGG G GG Sbjct: 49 GGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGG 89 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 G G G GGG GG GGG G + K G G G Sbjct: 33 GGGSGKGQWLHGGGGEGGGGEGGGGEGGGGQKISKGGGGGG 73 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGGXRG 871 G GGG G G GGG GGG G Sbjct: 31 GNGGGSGKGQWLHGGGGEGGGGEG 54 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G GG GGG G GGGGG G Sbjct: 68 GGGGGGSGGGQRSSSGGGGGGGEGDGG 94 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGGPXXXGVXG 464 GG G GGG GGGGG G G Sbjct: 70 GGGGSGGGQRSSSGGGGGGGEGDGGGG 96 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 192 GGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 GGGG GG GGG G Q G G GG Sbjct: 44 GGGGEGGGGEGGGG--EGGGGQKISKGGGGGG 73 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 910 GGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG GGG G GGGG GG G G Sbjct: 30 GGNGGGSGKGQWLHGGGGEGGGGEGGGGEGGGG 62 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGGPXXXGVXG 464 GG GGGG G GGGG G G Sbjct: 45 GGGEGGGGEGGGGEGGGGQKISKGGGG 71 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 35.5 bits (78), Expect = 0.057 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 PPPPPPP A PPP P PP P Sbjct: 50 PPPPPPPPPQSHAAAYKRYSPPPPPSKYGRVYPPPPP 86 Score = 33.5 bits (73), Expect = 0.23 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 471 TPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 T PPPPP PPPP PP P Sbjct: 31 TSYKYSPPPPPVYSPPISPPPPPPPPPP 58 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = +3 Query: 840 PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 PPPPP + P PPP PP P R + PPP+ Sbjct: 37 PPPPPVY-----SPPISPPPPPPPPPPQSHAAAYKRYSPPPPPS 75 Score = 33.5 bits (73), Expect = 0.23 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXA 958 PPP P PP P P PPP P A Sbjct: 37 PPPPPVYSPPISPPPPPPPPPPQSHA 62 Score = 33.5 bits (73), Expect = 0.23 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXP 205 PPP + PP PPPPP P Sbjct: 39 PPPVYSPPISPPPPPPPP 56 Score = 30.7 bits (66), Expect = 1.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 814 PXXXPPXPPPPPPP 855 P PP PPPPPPP Sbjct: 45 PPISPPPPPPPPPP 58 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 P PP PPPPPP P P PP G PPP Sbjct: 41 PVYSPPISPPPPPPPPP-------PQSHAAAYKRYSPPPPPSKYGRVYPPPP 85 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 495 PPPXPXXXXPPPPPXPPXXPXP 560 PPP P P PP PP P P Sbjct: 37 PPPPPVYSPPISPPPPPPPPPP 58 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPP 937 P PP PP P P P PPP Sbjct: 37 PPPPPVYSPPISPPPPPPPPPP 58 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 5/38 (13%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXP-----XXXXPPPPP 536 PP P +P PPPPP PPPPP Sbjct: 37 PPPPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPP 74 >At4g29030.1 68417.m04151 glycine-rich protein glycine-rich protein - Onobrychis viciifolia,PID:g2565429 Length = 115 Score = 35.5 bits (78), Expect = 0.057 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G GG G G GG GGG GGG G Sbjct: 53 GGVGGGVSGPGGNLGYGGFGGAGGGLGGGLGG 84 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GG G GGG G G G GGG GGG Sbjct: 69 GGFGGAGGGLGGGLGGGAGSGLGGGLGGG 97 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG G G G GG GGG G GGG GGG G Sbjct: 53 GGVGGGVSGPGGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLGGGSG 99 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 G G G GGG G G GG GGG G G Sbjct: 73 GAGGGLGGGLGGGAGSGLGGGLGGGSGIG 101 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = -3 Query: 967 GGGXXAXRGARG-GXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG G G G G GG GGG G GGG G G G Sbjct: 56 GGGVSGPGGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLGGGSGIGAG 103 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GG GGG G G GGG G G Sbjct: 75 GGGLGGGLGGGAGSGLGGGLGGGSGIGAGTSG 106 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G G G G G G G G GG G Sbjct: 79 GGGLGGGAGSGLGGGLGGGSGIGAGTSGGSTG 110 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGGA G G G G G G GG GG Sbjct: 83 GGGAGSGLGGGLGGGSGIGAGTSGGSTGG 111 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGGPXXXGVXG 464 GG GG GG G GGG G G G Sbjct: 69 GGFGGAGGGLGGGLGGGAGSGLGGGLG 95 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 943 GARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 G GG G G G G G GGG G G G G Sbjct: 53 GGVGGGVSGPGGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLGG 96 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 35.5 bits (78), Expect = 0.057 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = +3 Query: 813 PLXXXPXPP-PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRA-PRXAXXPPPA 971 P+ P P PPPP P PP P P PP A P PPPA Sbjct: 60 PVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPA 114 Score = 32.7 bits (71), Expect = 0.40 Identities = 20/65 (30%), Positives = 21/65 (32%), Gaps = 2/65 (3%) Frame = +3 Query: 786 PXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXX--PPPXPPXXPXXXPPRAPRXAXX 959 P A P P PPP + P PPP P P PP A Sbjct: 27 PTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPAT 86 Query: 960 PPPAA 974 PPP A Sbjct: 87 PPPVA 91 Score = 32.3 bits (70), Expect = 0.53 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P+ P PPP A P PPP P PP P PPP Sbjct: 47 PVSAPPPVTTSPPPVTTAPPPANP---PPPVSSPPPASPPPATPPPVASPPP 95 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRA--PRXAXXPPPAA 974 PPP A P PPP P PP A P A PPP A Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVA 98 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPP--PPXPXXXXPPPPPXPPXXPXP 560 PP P +P PPP P P PPP PP P Sbjct: 70 PPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPP 112 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +3 Query: 465 PXTPXXXGPPPPP--XPXXXXPPPPPXPPXXP 554 P TP PPPP P PPP PP P Sbjct: 84 PATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/66 (28%), Positives = 20/66 (30%), Gaps = 5/66 (7%) Frame = +3 Query: 792 AGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPP-----XPPXXPXXXPPRAPRXAX 956 AG G P P PP P P PP PP P P Sbjct: 16 AGVTGQAPTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVS 75 Query: 957 XPPPAA 974 PPPA+ Sbjct: 76 SPPPAS 81 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPP--PXPPXXPXP 560 PP +P PPP P PPPP PP P P Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPP 107 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 3/44 (6%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPP---PPXPPXXPXP 560 PP P PPP P PPP PP P P P Sbjct: 59 PPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPP 102 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PP P PP P P P APPP Sbjct: 26 PPTATPAPPTPTTPPPAATPPPVSAPPP 53 Score = 29.5 bits (63), Expect = 3.8 Identities = 26/101 (25%), Positives = 27/101 (26%), Gaps = 4/101 (3%) Frame = +3 Query: 678 PGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXXXPXPPPP---P 848 P P P P P P P P P PPP P Sbjct: 34 PTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASP 93 Query: 849 PPXXXXXXRAXPXXXPPPXPPXXPXXXPP-RAPRXAXXPPP 968 PP A P P PP P PP + P A P Sbjct: 94 PPPVASPPPATP--PPVATPPPAPLASPPAQVPAPAPTTKP 132 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXW--XPPXXPPPPPXXPXXXPXP 223 PP P P+ PPP PP PPPP P P Sbjct: 40 PPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPP 83 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P P PPP P PP P PP AP + PPA Sbjct: 72 PPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLAS---PPA 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP P PP P P P P P Sbjct: 84 PATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 29.1 bits (62), Expect = 5.0 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +3 Query: 438 PPXXXGXGXPXT--PXXXGPPPP-PXPXXXXPPPPPXPPXXPXPXXV 569 PP P T P PPPP P PPP PP P V Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPV 97 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXP 217 P P P+ PPP PP PPP P P Sbjct: 77 PPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 6/47 (12%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPP----PXPXXXXPPP--PPXPPXXPXP 560 PP TP PPP P P PPP PP P P P Sbjct: 33 PPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPP 79 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 2/44 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPP--PPXXPXXXPXP 223 PP P PPP PP PPP P P P P Sbjct: 59 PPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPP 102 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPP 193 PP P P PPP PP PPP Sbjct: 82 PPPATPPPVASPPPPVASPPPATPPPVATPPP 113 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 35.5 bits (78), Expect = 0.057 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = +3 Query: 813 PLXXXPXPP-PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRA-PRXAXXPPPA 971 P+ P P PPPP P PP P P PP A P PPPA Sbjct: 60 PVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPA 114 Score = 32.7 bits (71), Expect = 0.40 Identities = 20/65 (30%), Positives = 21/65 (32%), Gaps = 2/65 (3%) Frame = +3 Query: 786 PXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXX--PPPXPPXXPXXXPPRAPRXAXX 959 P A P P PPP + P PPP P P PP A Sbjct: 27 PTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPAT 86 Query: 960 PPPAA 974 PPP A Sbjct: 87 PPPVA 91 Score = 32.3 bits (70), Expect = 0.53 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P+ P PPP A P PPP P PP P PPP Sbjct: 47 PVSAPPPVTTSPPPVTTAPPPANP---PPPVSSPPPASPPPATPPPVASPPP 95 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRA--PRXAXXPPPAA 974 PPP A P PPP P PP A P A PPP A Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVA 98 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPP--PPXPXXXXPPPPPXPPXXPXP 560 PP P +P PPP P P PPP PP P Sbjct: 70 PPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPP 112 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +3 Query: 465 PXTPXXXGPPPPP--XPXXXXPPPPPXPPXXP 554 P TP PPPP P PPP PP P Sbjct: 84 PATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/66 (28%), Positives = 20/66 (30%), Gaps = 5/66 (7%) Frame = +3 Query: 792 AGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPP-----XPPXXPXXXPPRAPRXAX 956 AG G P P PP P P PP PP P P Sbjct: 16 AGVTGQAPTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVS 75 Query: 957 XPPPAA 974 PPPA+ Sbjct: 76 SPPPAS 81 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPP--PXPPXXPXP 560 PP +P PPP P PPPP PP P P Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPP 107 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 3/44 (6%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPP---PPXPPXXPXP 560 PP P PPP P PPP PP P P P Sbjct: 59 PPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPP 102 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PP P PP P P P APPP Sbjct: 26 PPTATPAPPTPTTPPPAATPPPVSAPPP 53 Score = 29.5 bits (63), Expect = 3.8 Identities = 26/101 (25%), Positives = 27/101 (26%), Gaps = 4/101 (3%) Frame = +3 Query: 678 PGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXXXPXPPPP---P 848 P P P P P P P P P PPP P Sbjct: 34 PTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASP 93 Query: 849 PPXXXXXXRAXPXXXPPPXPPXXPXXXPP-RAPRXAXXPPP 968 PP A P P PP P PP + P A P Sbjct: 94 PPPVASPPPATP--PPVATPPPAPLASPPAQVPAPAPTTKP 132 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXW--XPPXXPPPPPXXPXXXPXP 223 PP P P+ PPP PP PPPP P P Sbjct: 40 PPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPP 83 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P P PPP P PP P PP AP + PPA Sbjct: 72 PPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLAS---PPA 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP P PP P P P P P Sbjct: 84 PATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 29.1 bits (62), Expect = 5.0 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +3 Query: 438 PPXXXGXGXPXT--PXXXGPPPP-PXPXXXXPPPPPXPPXXPXPXXV 569 PP P T P PPPP P PPP PP P V Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPV 97 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXP 217 P P P+ PPP PP PPP P P Sbjct: 77 PPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 6/47 (12%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPP----PXPXXXXPPP--PPXPPXXPXP 560 PP TP PPP P P PPP PP P P P Sbjct: 33 PPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPP 79 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 2/44 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPP--PPXXPXXXPXP 223 PP P PPP PP PPP P P P P Sbjct: 59 PPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPP 102 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPP 193 PP P P PPP PP PPP Sbjct: 82 PPPATPPPVASPPPPVASPPPATPPPVATPPP 113 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 35.5 bits (78), Expect = 0.057 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PP PPPP +A P PP PP PP + PP Sbjct: 93 PPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPPPSTYIYMTGPP 137 Score = 33.9 bits (74), Expect = 0.17 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P PPP P P PPPP PP P Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPPSPP 118 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 6/35 (17%) Frame = +2 Query: 881 PPPXPPPXPP------XXPXPXPPPXPXXGXAPPP 967 PPP PPP P P P PP P PPP Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPP 126 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = +3 Query: 471 TPXXXGPPPPPXPXXXXPPPP---PXPPXXPXP 560 TP PPP P PPP P PP P P Sbjct: 85 TPCLQNIPPPSPPPPSPPPPSQACPPPPLPPSP 117 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 35.5 bits (78), Expect = 0.057 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +3 Query: 816 LXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXP 920 L P PPPPPPP + P PPP PP P Sbjct: 41 LPHPPPPPPPPPPPLYFSYFSLP---PPPPPPHLP 72 Score = 34.3 bits (75), Expect = 0.13 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPP 911 P PPPPPPP P PP PP Sbjct: 46 PPPPPPPPPLYFSYFSLPPPPPPPHLPP 73 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 4/28 (14%) Frame = +2 Query: 872 PRXPPPXPPPXPP----XXPXPXPPPXP 943 P PPP PPP PP P PPP P Sbjct: 42 PHPPPPPPPPPPPLYFSYFSLPPPPPPP 69 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXP-PPPPXPPXXP 554 P P PPPPP PPPP PP P Sbjct: 42 PHPPPPPPPPPPPLYFSYFSLPPPPPPPHLP 72 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPP 935 PPPPPPP PPP P P P Sbjct: 45 PPPPPPPPPPLYFSYFSLPPPPPPPHLPPTSVTP 78 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 35.5 bits (78), Expect = 0.057 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +3 Query: 411 GGGGGGGXXPPXXXGXGXPXTPXXXGPPPPP--XPXXXXPPPPPXPPXXPXP 560 GGGGGGG PP P PPP P PPP PP P Sbjct: 80 GGGGGGGKSPPVVRPPPVVVRPPPIIRPPPVVYPPPIVRPPPITRPPIIIPP 131 Score = 32.7 bits (71), Expect = 0.40 Identities = 23/67 (34%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = -3 Query: 601 GRXPPPXXXKRTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPP 422 G PPP + GG GGG G GGGGG V P PP Sbjct: 50 GSKPPPHHGGKGGGKPPPHGGKGGGP-PHHGGGGGGGGKSPPVVRPPPVVVRPPPIIRPP 108 Query: 421 P---PPP 410 P PPP Sbjct: 109 PVVYPPP 115 Score = 31.9 bits (69), Expect = 0.71 Identities = 27/98 (27%), Positives = 28/98 (28%) Frame = +3 Query: 672 GXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXXXPXPPPPPP 851 G P P G P GGGG P RP P+ P PPP Sbjct: 63 GKPPPHGGKGGGPPHHGGGGGGGGKSPPVVRPPPVVVRPP-------PIIRPPPVVYPPP 115 Query: 852 PXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P PP PP P PP PP Sbjct: 116 IVRPPPITRPPIIIPPIQPP--PVTTPPGLLPPITTPP 151 Score = 31.5 bits (68), Expect = 0.93 Identities = 18/54 (33%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +3 Query: 414 GGGGGGXXPPXXXGXGXPXTPXXXGPPPPPX--PXXXXPPPPPXPPXXPXPXXV 569 GG GGG G G +P PPP P PPP PP P + Sbjct: 69 GGKGGGPPHHGGGGGGGGKSPPVVRPPPVVVRPPPIIRPPPVVYPPPIVRPPPI 122 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = -3 Query: 544 GGXGGGGGXXXX---GXGGGGGPXXXGVXGXPXPXXXGGXXPPPPPP 413 GG GGGG G GGG P G G P GG PP Sbjct: 44 GGGGGGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGGGGKSPP 90 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 410 GGGGGGGXXPPXXXGARXXPHPXXXG 487 GGGGGGG PP G + P G Sbjct: 44 GGGGGGGSKPPPHHGGKGGGKPPPHG 69 Score = 29.9 bits (64), Expect = 2.8 Identities = 24/72 (33%), Positives = 25/72 (34%), Gaps = 19/72 (26%) Frame = +3 Query: 411 GGGGGGGXXPPXXXGXGXPXTP----XXXGPP------------PP---PXPXXXXPPPP 533 GGGGGG PP G G P GPP PP P P PPP Sbjct: 45 GGGGGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGGGGKSPPVVRPPPVVVRPPPI 104 Query: 534 PXPPXXPXPXXV 569 PP P + Sbjct: 105 IRPPPVVYPPPI 116 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXG 886 +GGG P G G G G GG GGG G Sbjct: 60 KGGGKPPPHG-GKGGGPPHHGGGGGGGG 86 Score = 28.7 bits (61), Expect = 6.6 Identities = 25/88 (28%), Positives = 26/88 (29%), Gaps = 5/88 (5%) Frame = +3 Query: 717 GGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXP 896 GG GG P GG P+ P PPP R P P Sbjct: 58 GGKGGGKPPPHGGKGGGPPHHGGGGGGGGKSPPVVRPPPVVVRPPP----IIRPPPVVYP 113 Query: 897 PP--XPP---XXPXXXPPRAPRXAXXPP 965 PP PP P PP P PP Sbjct: 114 PPIVRPPPITRPPIIIPPIQPPPVTTPP 141 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 35.5 bits (78), Expect = 0.057 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPP--RAPRXAXXPPP 968 P PPPP P + P P P PP PP P PPP Sbjct: 532 PLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPP 580 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/53 (33%), Positives = 20/53 (37%), Gaps = 5/53 (9%) Frame = +3 Query: 828 PXPPPPP-----PPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P PPPPP PP PPP P P PP + PPP+ Sbjct: 501 PPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPS 553 Score = 33.5 bits (73), Expect = 0.23 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P P PP PP P PPPP P P Sbjct: 529 PPPPLSPPPPSPPPPYIYSSPPPPSPSPPP 558 Score = 33.1 bits (72), Expect = 0.31 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 896 PPXPPXXPXPXPPPXPXXGXAPPP 967 PP PP P P PP P +PPP Sbjct: 528 PPPPPLSPPPPSPPPPYIYSSPPP 551 Score = 32.7 bits (71), Expect = 0.40 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 9/56 (16%) Frame = +3 Query: 828 PXPPP-----PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPP----RAPRXAXXPPP 968 P PPP PPPP PPP P P PP P + PPP Sbjct: 503 PPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPP 558 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P PPP P P PPP P P P Sbjct: 528 PPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPP 559 Score = 31.5 bits (68), Expect = 0.93 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRA---PRXAXXPPP 968 PPPP +A P PPP P P PP + P PPP Sbjct: 486 PPPPSSKMSPSVKAYPP--PPPPPEYEPSPPPPSSEMSPSVRAYPPP 530 Score = 31.5 bits (68), Expect = 0.93 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 893 PPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P P P PPP PPP Sbjct: 528 PPPPPLSPPPPSPPPPYIYSSPPPP 552 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPP---RAPRXAXXPPP 968 PPPPPP ++ P P PP PP P PPP Sbjct: 618 PPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPP 664 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P P PPP P +PPP Sbjct: 487 PPPSSKMSPSVKAYPPPPPPPEYEPSPPP 515 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 6/36 (16%) Frame = +3 Query: 471 TPXXXGPPPPPX---PXXXXPPPPP---XPPXXPXP 560 TP PPPPP P PPPPP PP P Sbjct: 655 TPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSP 690 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXP 554 PPPPP P PPPP P Sbjct: 501 PPPPPPPEYEPSPPPPSSEMSP 522 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 3/54 (5%) Frame = +3 Query: 813 PLXXXPXPPPPPP---PXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P P PPPP P P PPP PP P P + PP Sbjct: 506 PPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPP 559 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PP PPP P P P P PPP Sbjct: 528 PPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPP 559 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P P PPP PP PPPP P P Sbjct: 511 PSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPP 552 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 458 RXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 R P P P PP P PP P P P P Sbjct: 525 RAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPP 558 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPP--XXPPPPP 196 PP P P P PPP + PP PPPPP Sbjct: 619 PPPPPPTYYAVQSP--PPPPPVYYPPVTASPPPPP 651 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRA---PRXAXXPPPA 971 PPPPPP P P PP PP P PPP+ Sbjct: 675 PPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPS 722 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXP 554 PPPPP PPPP P P Sbjct: 620 PPPPPTYYAVQSPPPPPPVYYP 641 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/47 (31%), Positives = 18/47 (38%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 PPPP P ++ P P PP PP P PPA+ Sbjct: 718 PPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTP--VEYHPPAS 762 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PPPPP PPP PP P Sbjct: 619 PPPPPPTYYAVQSPPPPPPVYYPP 642 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 11/52 (21%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPP-----------PPXPPXXPXP 560 PP P PPPPP PPP PP PP P P Sbjct: 486 PPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPP 537 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PPPPP P PP PP P Sbjct: 618 PPPPPPPTYYAVQSPPPPPPVYYP 641 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 3/24 (12%) Frame = +3 Query: 474 PXXXGPPPPPX---PXXXXPPPPP 536 P PPPPP P PPPPP Sbjct: 642 PVTASPPPPPVYYTPVIQSPPPPP 665 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/47 (31%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXP---PPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPP ++ P P PP P P P PPP Sbjct: 704 PPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPP 750 Score = 28.7 bits (61), Expect = 6.6 Identities = 20/59 (33%), Positives = 23/59 (38%), Gaps = 7/59 (11%) Frame = +3 Query: 813 PLXXXPXPPPPP--PPXXXXXXRAXPXXXPP----PXPPXXPXXX-PPRAPRXAXXPPP 968 P+ P PP P PP P PP P PP P PP +P + PPP Sbjct: 713 PVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPASPNQS--PPP 769 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXP 542 PPPP PPPPP P Sbjct: 607 PPPPTYYATQSPPPPPPP 624 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 492 PPPPXPXXXXPPPPPXPP 545 PPPP PPPP PP Sbjct: 607 PPPPTYYATQSPPPPPPP 624 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 35.5 bits (78), Expect = 0.057 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = +2 Query: 872 PRXPPPX--PPPXP--PXXPXPXPPPXPXXGXAPPP 967 P PPP PPP P P P P PPP PPP Sbjct: 149 PESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPP 184 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP 536 PP P +P P PPP PPPPP Sbjct: 153 PPESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/58 (27%), Positives = 17/58 (29%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 P R G + P PP PPP P P PP PP P Sbjct: 127 PPHHRRTTAAAGTTTIAGQPPPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPP 184 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +3 Query: 471 TPXXXGPPPPPX--PXXXXPPPPPXPPXXPXP 560 T G PPPP P PPP P P P P Sbjct: 139 TTTIAGQPPPPESPPPESLPPPSPESPSPPSP 170 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P P P P PPP PPP Sbjct: 158 PPPSPESPSPPSPEP-PPPSSLEPPPPPP 185 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXP-PPXPXXGXAPPP 967 PPP P P P P P P P PPP Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEPPPP 175 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPP 545 P +P PP P P PPP PP Sbjct: 159 PPSPESPSPPSPEPPPPSSLEPPPPPP 185 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 35.5 bits (78), Expect = 0.057 Identities = 20/58 (34%), Positives = 22/58 (37%), Gaps = 7/58 (12%) Frame = +3 Query: 813 PLXXXPXP---PPPP----PPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P+ P P PPPP PP P PPP P P PP P + PP Sbjct: 548 PIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPP 605 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPP----XPPXXPXXXPPRAPRXAXXPPP 968 PPPP PP P PPP PP P PP P PPP Sbjct: 582 PPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPP--PPSHSPPPP 628 Score = 34.3 bits (75), Expect = 0.13 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 875 RXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 R PPP PP P P P P P PPP Sbjct: 532 RVPPPQPPMPSPSPPSPIYSPPPPVHSPPPP 562 Score = 33.9 bits (74), Expect = 0.17 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P PP P P P P +PPP Sbjct: 576 PPPVASPPPPSPPPPVHSPPPPPVFSPPP 604 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 4/36 (11%) Frame = +3 Query: 465 PXTPXXXGPPPP----PXPXXXXPPPPPXPPXXPXP 560 P P PPPP P P PPPP PP P Sbjct: 559 PPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSP 594 Score = 32.7 bits (71), Expect = 0.40 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPP 536 P P PPP P P PPPPP Sbjct: 575 PPPPVASPPPPSPPPPVHSPPPPP 598 Score = 32.3 bits (70), Expect = 0.53 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +2 Query: 881 PPPX--PPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PP P P P PP P PPP Sbjct: 568 PPPHVYSPPPPVASPPPPSPPPPVHSPPPPP 598 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 3/44 (6%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPX---PXXXXPPPPPXPPXXPXP 560 PP P PPPPP P PPPP P P P Sbjct: 577 PPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPP 620 Score = 32.3 bits (70), Expect = 0.53 Identities = 17/56 (30%), Positives = 19/56 (33%), Gaps = 4/56 (7%) Frame = +3 Query: 813 PLXXXPXPPPPPP----PXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P+ P P PPPP P P PPP P P +P PP Sbjct: 578 PVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPP 633 Score = 32.3 bits (70), Expect = 0.53 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 3/50 (6%) Frame = +3 Query: 828 PXPPPP---PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPPP PPP PPP P P P PPP Sbjct: 585 PSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPP 634 Score = 31.9 bits (69), Expect = 0.71 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 7/59 (11%) Frame = +3 Query: 813 PLXXXPXPP----PPPPPXXXXXXRAXPXXXPPPXPP---XXPXXXPPRAPRXAXXPPP 968 P+ P PP PPPP P PP PP P P P PPP Sbjct: 562 PVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPP 620 Score = 31.5 bits (68), Expect = 0.93 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPP---PXXPXXXPXP 223 P P P P+F PPP + PP PP P P P P P Sbjct: 585 PSPPPPVHSPPPPPVFSPPPPVFSPP--PPSPVYSPPPPSHSPPP 627 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPP-XPPXXPXXXPPRAPRXAXXPPPAA 974 PPP PP + PPP P P P P PPP A Sbjct: 534 PPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVA 580 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P +P PPP P PPPP P P P Sbjct: 575 PPPPVASPPPPSPPPPVHSPPPPPV-FSPPPPVFSPPPPSP 614 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 6/38 (15%) Frame = +3 Query: 465 PXTPXXXGPPPP---PXPXXXXPP---PPPXPPXXPXP 560 P P PPPP P P PP PPP P P P Sbjct: 567 PPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPP 604 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 7/39 (17%) Frame = +3 Query: 465 PXTPXXXGPPP---PPXPXXXXPPPP----PXPPXXPXP 560 P +P PPP PP P PPPP P PP P Sbjct: 545 PPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPP 583 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = +3 Query: 492 PPPPXPXXXXPPP---PPXPPXXPXP 560 PPPP P PPP PP P P P Sbjct: 609 PPPPSPVYSPPPPSHSPPPPVYSPPP 634 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/50 (34%), Positives = 19/50 (38%), Gaps = 8/50 (16%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPP----XXPPPP----PXXPXXXPXP 223 PP P P++ PPP PP PPPP P P P P Sbjct: 535 PPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPP 584 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXP--PPPPXXPXXXPXP 223 PP P P+ PPP P P PPP P P P Sbjct: 577 PPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPP 620 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 3/55 (5%) Frame = +3 Query: 813 PLXXXPXPPP---PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PPP PPPP + PPP P P P + PPP Sbjct: 589 PPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFS--PPP 641 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPP---PPXPXXXXPPPPPXPP 545 PP P +P PPP PP P PPP PP Sbjct: 602 PPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPP 640 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +2 Query: 107 PXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P + P PPP PP PPP P P Sbjct: 567 PPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPP 605 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +2 Query: 107 PXPXXXFXXXPLFXXPPPXWXPPXXPPPP---PXXPXXXPXP 223 P P P+F PPP P PPPP P P P P Sbjct: 595 PPPPVFSPPPPVFSPPPP--SPVYSPPPPSHSPPPPVYSPPP 634 >At1g29030.1 68414.m03553 apoptosis inhibitory 5 (API5) family protein contains Pfam profile PF05918: Apoptosis inhibitory protein 5 (API5) Length = 556 Score = 35.5 bits (78), Expect = 0.057 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G G G G G G GGG G G RG Sbjct: 523 GGGRGSHRGRGRGQGQGRHSGGGGGRGRGRRG 554 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 35.5 bits (78), Expect = 0.057 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 PP PP PP P P P P PPP+ Sbjct: 143 PPTNPPPPPESPPSLPAPDPPSNPLPPPK 171 Score = 35.1 bits (77), Expect = 0.076 Identities = 38/176 (21%), Positives = 40/176 (22%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXX 617 PP G P T PPP P PPPP P P P P Sbjct: 77 PPSPSLTGPPPTTIPVSPPPEP------SPPPPLPTEAPPPANPVSSPPPESSPP--PPP 128 Query: 618 XTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAG 797 T + P P P P PR Sbjct: 129 PTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPA 188 Query: 798 GXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P P PP P P PP P PP + R PP Sbjct: 189 SEIPPPPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRREQPPPPGSKRPTPSPP 244 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PPP P P PPP PP P P P PPP Sbjct: 120 PESSPPPPPPTEAPPTTPITSPSPPTNPPP-PPESPPSLPAPDPPSNPLPPP 170 Score = 33.9 bits (74), Expect = 0.17 Identities = 22/72 (30%), Positives = 23/72 (31%), Gaps = 7/72 (9%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXP---PP----XPPXXPXXX 929 P P G P PPP P P A P P PP PP P Sbjct: 73 PEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEA 132 Query: 930 PPRAPRXAXXPP 965 PP P + PP Sbjct: 133 PPTTPITSPSPP 144 Score = 33.9 bits (74), Expect = 0.17 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P P PPP PPP P P P +P PPP Sbjct: 98 PSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPP 149 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/57 (31%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPP---XPPXXPXXXPPRAPRXAXXPPPAA 974 PL P P PP P PPP PP P PP A + PP ++ Sbjct: 67 PLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESS 123 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 3/55 (5%) Frame = +3 Query: 813 PLXXXPXPP---PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PP PPPP A PP P PP P+ PPP Sbjct: 179 PPRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRREQPPP 233 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/52 (36%), Positives = 22/52 (42%), Gaps = 3/52 (5%) Frame = +3 Query: 828 PXPP--PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPP-RAPRXAXXPPPAA 974 P PP PPPPP + P PP P P PP +P PPA+ Sbjct: 141 PSPPTNPPPPPESPP---SLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPAS 189 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 P PP P P PP P P PP +PP Sbjct: 151 PESPPSLPAPDPPSNPLP-PPKLVPPSHSPP 180 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P P P P PPP P APPP Sbjct: 85 PPPTTIPVSPP-PEPSPPP-PLPTEAPPP 111 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 5/37 (13%) Frame = +3 Query: 465 PXTPXXXGP--PPPPXPXXXXPPP---PPXPPXXPXP 560 P TP P P PP P PPP P PP P P Sbjct: 64 PETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSP 100 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXP---PXXPPPPPXXPXXXPXP 223 PP P P P PPP P P P PPP P P P Sbjct: 72 PPEPSPPS-----PSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPP 111 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPP---PXPXXGXAPPP 967 P P PPP P P P P P P PPP Sbjct: 94 PPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPP 128 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 PP P P P+ PP PPPPP P P P Sbjct: 124 PPPPPPTEAPPTTPITSPSPPT-----NPPPPPESPPSLPAP 160 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/58 (31%), Positives = 21/58 (36%), Gaps = 6/58 (10%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPP---XXPXXXPPR---APRXAXXPPP 968 P+ P PPPP P P PP P PPR +P + PPP Sbjct: 137 PITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPP 194 Score = 29.1 bits (62), Expect = 5.0 Identities = 22/96 (22%), Positives = 24/96 (25%) Frame = +3 Query: 684 PXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXXXPXPPPPPPPXXX 863 P P P G P P P P+ P PPPP Sbjct: 71 PPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPT 130 Query: 864 XXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P P P P P P PP+ Sbjct: 131 EAPPTTPITSPSP--PTNPPPPPESPPSLPAPDPPS 164 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAPP 964 PP PP P P P P P +PP Sbjct: 257 PPSPPEETLPPPKPSPDPLPSNSSSPP 283 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P PPP P P P P PP P A PPPA Sbjct: 62 PPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEA--PPPA 112 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 35.1 bits (77), Expect = 0.076 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXP-XXXPPPXPPXXPXXXPPRAPR 947 P PPPPPPP P PP PP P P A R Sbjct: 22 PLPPPPPPPMRRSAPSPPPMSGRVPPPPPPPPMFDPKGAGR 62 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 887 PXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP PP P P P G PPP Sbjct: 22 PLPPPPPPPMRRSAPSPPPMSGRVPPP 48 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 875 RXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 R P P PPP P P PPP PPP Sbjct: 20 RVPLPPPPPPPMRRSAPSPPPMSGRVPPPPP 50 Score = 33.1 bits (72), Expect = 0.31 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPP 536 PPPPP P PPPPP Sbjct: 151 PPPPPMPRRSPPPPPP 166 Score = 32.7 bits (71), Expect = 0.40 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 475 GVXGXPXPXXXGGXXPPPPPPP 410 G P P GG PPPPPPP Sbjct: 636 GSPSPPPPSMSGGAPPPPPPPP 657 Score = 31.9 bits (69), Expect = 0.71 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPP 545 P P P PP PPPPP PP Sbjct: 27 PPPPMRRSAPSPPPMSGRVPPPPPPPP 53 Score = 31.9 bits (69), Expect = 0.71 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 492 PPPPXPXXXXPPPPPXPP 545 PPPP PPPPP PP Sbjct: 640 PPPPSMSGGAPPPPPPPP 657 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 488 PXPPPXPRXXXPXPPPXPX--PXPXPXXXXFXXXGGG 592 P PPP R P PPP P P P F G G Sbjct: 25 PPPPPPMRRSAPSPPPMSGRVPPPPPPPPMFDPKGAG 61 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXP 554 P PPP PPPPP P P Sbjct: 36 PSPPPMSGRVPPPPPPPPMFDP 57 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 460 PXPXXXGGXXPPPPPPP 410 P P G PPPPPPP Sbjct: 36 PSPPPMSGRVPPPPPPP 52 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 492 PPPPXPXXXXPPPPPXP 542 PPPP P PPPP P Sbjct: 150 PPPPPPMPRRSPPPPPP 166 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPP 536 PPPPP PPPPP Sbjct: 150 PPPPPPMPRRSPPPPP 165 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -1 Query: 453 PXXXGGXXPPPPPPP 409 P GG PPPPPPP Sbjct: 643 PSMSGGAPPPPPPPP 657 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPP 934 PP PPP P P P PP Sbjct: 150 PPPPPPMPRRSPPPPPP 166 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXP 542 PPPP PPPPP P Sbjct: 640 PPPPSMSGGAPPPPPPPP 657 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 5/29 (17%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPP-----XPPXXPXP 560 PPPPP P P PP PP P P Sbjct: 24 PPPPPPPMRRSAPSPPPMSGRVPPPPPPP 52 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPP 545 P PPP PPPP PP Sbjct: 638 PSPPPPSMSGGAPPPPPPP 656 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 887 PXPPPXPPXXPXPXPPPXP 943 P PPP PP PPP P Sbjct: 148 PLPPPPPPMPRRSPPPPPP 166 >At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At3g25690, At5g61090 [Arabidopsis thaliana] Length = 681 Score = 35.1 bits (77), Expect = 0.076 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPP 545 PPPPP P P PPP PP Sbjct: 326 PPPPPSPEHKAPAPPPPPP 344 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 875 RXPPPXPPPXPPXXPXPXPPPXP 943 R PP PPP P PPP P Sbjct: 322 RSQPPPPPPSPEHKAPAPPPPPP 344 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 887 PXPPPXPPXXPXPXPPPXPXXGXA 958 P PPP P P PPP P A Sbjct: 325 PPPPPPSPEHKAPAPPPPPPMSKA 348 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 35.1 bits (77), Expect = 0.076 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 P PP PPPP PP P P PP P P PPP Sbjct: 69 PSPSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPP---PPPPPP 117 Score = 32.3 bits (70), Expect = 0.53 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPP 937 PP P P PP P P PPP Sbjct: 68 PPSPSPPPPPPPRPPPPP 85 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPP 545 P PPPPP P PPPPP P Sbjct: 68 PPSPSPPPPPPP---RPPPPPLSP 88 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 816 LXXXPXPPPPPPPXXXXXXRAXPXXXPPP 902 L P PPPPPPP P PPP Sbjct: 104 LPPPPPPPPPPPPPSSTWDFWDPFIPPPP 132 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 492 PPPPXPXXXXPPPPPXPPXXP 554 PP P P PP PP PP P Sbjct: 68 PPSPSPPPPPPPRPPPPPLSP 88 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPP 545 PPPPP PPPPP PP Sbjct: 105 PPPPP------PPPPPPPP 117 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 12/44 (27%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXX------------PPPPPXPPXXPXP 560 P P PPPP P PPPPP PP P P Sbjct: 74 PPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPPP 117 Score = 27.9 bits (59), Expect(2) = 1.2 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXP 205 PPP PP PPPPP P Sbjct: 73 PPPP--PPPRPPPPPLSP 88 Score = 25.0 bits (52), Expect(2) = 7.3 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +2 Query: 140 LFXXPPPXWXPPXXPPPPPXXP 205 L PP PP PP PP P Sbjct: 64 LHHNPPSPSPPPPPPPRPPPPP 85 Score = 21.8 bits (44), Expect(2) = 1.2 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 182 PPPPPXXPXXXP 217 PPPPP P P Sbjct: 105 PPPPPPPPPPPP 116 Score = 21.8 bits (44), Expect(2) = 7.3 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 182 PPPPPXXPXXXP 217 PPPPP P P Sbjct: 106 PPPPPPPPPPPP 117 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 35.1 bits (77), Expect = 0.076 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G GGG G G GG GG G G RG Sbjct: 100 GGFGGGGGRGGGRGGGSYGGGYGGRGSGGRG 130 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGG 836 + GGG RG GG G GG GGG G GGGGG Sbjct: 90 SGGGGSSGGRGGFGG-GGGRGGGRGGGSYGGGYGGRGSGGRGGGGG 134 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/48 (41%), Positives = 22/48 (45%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 +GGG + G RGG G GG GGG G G GG GG G Sbjct: 90 SGGGGSS--GGRGGFGGG--GGRGGGRGGGSYGGGYGGRGSGGRGGGG 133 Score = 32.3 bits (70), Expect = 0.53 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G GG G G GG G Sbjct: 103 GGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGG 134 Score = 31.9 bits (69), Expect = 0.71 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -1 Query: 960 GAXPXXGXGGGXGXGXXGGXGGGXG-GGXRG 871 GA GGG G GG GGG G GG RG Sbjct: 83 GAPVQGNSGGGGSSGGRGGFGGGGGRGGGRG 113 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 G + GG G G GG GGG GGG G Sbjct: 88 GNSGGGGSSGGRGGFGGGGGRGGGRGGGSYG 118 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -3 Query: 589 PPXXXKRTXXGXGXXGGXGGGGGXXXXGXGGGGG 488 P + G G G GGGG G GGGGG Sbjct: 144 PGHMARECSQGGGGYSGGGGGGRYGSGGGGGGGG 177 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGGPXXXGV 470 GG GGGG G GGGGG G+ Sbjct: 156 GGYSGGGGGGRYGSGGGGGGGGGGL 180 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G G GGG G GGG G G G GG Sbjct: 92 GGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGG 133 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGG 892 +GGG G GG G G GG GGG Sbjct: 153 QGGGGYSGGGGGGRYGSGGGGGGGGG 178 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGG 880 G GG G G G GGG GGG Sbjct: 157 GYSGGGGGGRYGSGGGGGGGG 177 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG GGG G GGGGG Sbjct: 155 GGGYSGGGGGGRYGSGGGGGGGGG 178 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 934 GGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG G GG GGG G R GG GGG G G Sbjct: 92 GGGSSGGRGGFGGGGGRGGGRG-----GGSYGGGYGGRGSG 127 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 204 GXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G GGGG G GGG G G G GG Sbjct: 88 GNSGGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGG 123 Score = 29.1 bits (62), Expect = 5.0 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 6/40 (15%) Frame = -3 Query: 559 GXGXXGGXGGG------GGXXXXGXGGGGGPXXXGVXGXP 458 G G GG GGG GG G GGGGG G P Sbjct: 105 GGGRGGGRGGGSYGGGYGGRGSGGRGGGGGDNSCFKCGEP 144 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG + G GGG G GGGGGGG G Sbjct: 133 GGDNSCFKCGEPGHMARECSQGGGGYSGGGGGGRYGSGGGGGGGGGG 179 >At1g49270.1 68414.m05524 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 699 Score = 35.1 bits (77), Expect = 0.076 Identities = 20/63 (31%), Positives = 21/63 (33%), Gaps = 8/63 (12%) Frame = +3 Query: 804 GXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPP--------PXPPXXPXXXPPRAPRXAXX 959 G P P PPPP PP PP P PP P PP + Sbjct: 4 GQSPENSPPAPPPPSPPSPPSSNDQQTTSPPPSDNQETTSPPPPSSPDIAPPPQQQQESP 63 Query: 960 PPP 968 PPP Sbjct: 64 PPP 66 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 35.1 bits (77), Expect = 0.076 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 R GG G GGG G G GG G G G G G Sbjct: 184 RYGGGGGSFGGGGGGGAGSYGGGGAGAGSGGGG 216 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = -3 Query: 946 RGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 +G +G G G GGG G G G GGG G Sbjct: 178 QGRQGSRYGGGGGSFGGGGGGGAGSYGGGGAGAGSGGGGG 217 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 571 RTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 R G G GG GGGG G G G G G Sbjct: 184 RYGGGGGSFGGGGGGGAGSYGGGGAGAGSGGGG 216 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -3 Query: 559 GXGXXGGXGG-GGGXXXXGXGGGGG 488 G G GG G GGG G GGGGG Sbjct: 193 GGGGGGGAGSYGGGGAGAGSGGGGG 217 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -1 Query: 231 PPXGXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 P G GGGGG GG GG G G G G Sbjct: 174 PSFDQGRQGSRYGGGGGSFGGGGGGGAGSYGGGGAGAGSGGGGG 217 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GGGGG GGGG G G Sbjct: 187 GGGGSFGGGGGGGAGSYGGGGAGAGSGGGG 216 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXP 943 P PPP PP PP P PPP P Sbjct: 169 PSIPPPSPPYFPPEPPSIPPPPPP 192 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPP 545 P P P PP P PPPPP PP Sbjct: 169 PSIPPPSPPYFPPEPPSIPPPPPPSPP 195 Score = 32.3 bits (70), Expect = 0.53 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +3 Query: 840 PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 PPP P + P PP PP P PP P PP AA Sbjct: 158 PPPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPPP----SPPSAA 198 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P +P P PP P PPP PP P Sbjct: 166 PFSPSIPPPSPPYFPPEPPSIPPPPPPSPP 195 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P P PPP P P PP PP P Sbjct: 162 PDFPPFSPSIPPPSPPYFPPEPPSIPPPPP 191 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXA 953 P P P PP P PP PP P PP P A Sbjct: 158 PPPSPDFPPFSPSIPPPSPPYF-PPEPPSIPPPPPPSPPSAA 198 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 494 PPPXPRXXXPXPPPXPXPXPXPXXXXFXXXGGG 592 PPP P P PP P P P G G Sbjct: 172 PPPSPPYFPPEPPSIPPPPPPSPPSAASGRGSG 204 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXP-PXXPXXXPPRAPRXAXXPPPA 971 P P P P PP P P P P P P P AP A P PA Sbjct: 72 PPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPA 125 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +2 Query: 440 PXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXPXPXXXXFXXXGGGG 595 P + P P P P P P P P P P P P P GG Sbjct: 81 PTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKPAPGG 132 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 872 PRXPPPXPPPXP-PXXPXPXPPPXPXXGXAPPPR 970 P PP P P P P P P P P P AP P+ Sbjct: 90 PAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPK 123 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/48 (35%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXP-PPXPPXXPXXXPPRAPRXAXXPPP 968 P PP P P + P P PP P P PP+ P+ A P P Sbjct: 26 PKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPK-PKPAPAPTP 72 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/48 (35%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXP-PPXPPXXPXXXPPRAPRXAXXPPP 968 P PP P P + P P PP P P PP+ P+ A P P Sbjct: 37 PTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPK-PKPAPAPTP 83 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/48 (35%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXP-PPXPPXXPXXXPPR-APRXAXXPP 965 P PP P P + P P PP P P PP+ P+ A PP Sbjct: 48 PTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPP 95 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/48 (35%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXP-PPXPPXXPXXXPPRAPRXAXXPPP 968 P PP P P + P P PP P P PP+ P+ A P P Sbjct: 70 PTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPK-PKPAPAPAP 116 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXP-PPXPPXXPXXXPPRAPRXAXXPPPA 971 P PP P P P P PP P P P AP+ P PA Sbjct: 81 PTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKPA 129 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +2 Query: 440 PXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 P + P P P P P P P P P P P P P Sbjct: 79 PAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTP 118 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P PP P P P P PP P P+ P PA Sbjct: 68 PAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPA 115 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P+ P PP P P P P P P AP P Sbjct: 97 PKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKP 128 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAP 961 P PP P P P P P P P P AP Sbjct: 101 PAPTPPKPKPAPAPAPTPAPKPKPAPKPAP 130 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXP-PPXPPXXPXXXPPR-APRXAXXPP 965 P PP P P + P P PP P P PP P A PP Sbjct: 59 PTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPP 106 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/47 (29%), Positives = 15/47 (31%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PP P P P P PP P P+ P P Sbjct: 24 PAPKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAP 70 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPP-PXPXXGXAPP 964 P+ P PP P P P PP P P PP Sbjct: 31 PKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPP 62 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/47 (29%), Positives = 15/47 (31%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PP P P P P PP P P+ P P Sbjct: 35 PAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAP 81 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPP-PXPXXGXAPP 964 P+ P PP P P P PP P P PP Sbjct: 42 PKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPP 73 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/47 (29%), Positives = 15/47 (31%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PP P P P P PP P P+ P P Sbjct: 46 PAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAP 92 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +2 Query: 440 PXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXP 553 P + P P P P P P P P P P P P Sbjct: 46 PAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTP 83 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPP-PXPXXGXAPP 964 P+ P PP P P P PP P P PP Sbjct: 53 PKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPP 84 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/52 (28%), Positives = 16/52 (30%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P P P P P P P P P P P+ A P P Sbjct: 79 PAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKPAP 130 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXG 952 P P P P P P P P P P P G Sbjct: 105 PPKPKPAPAPAPTPAPKPKPAPKPAPG 131 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +2 Query: 440 PXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXP 553 P + P P P P P P P P P P P P Sbjct: 24 PAPKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTP 61 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +2 Query: 440 PXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXP 553 P + P P P P P P P P P P P P Sbjct: 35 PAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTP 72 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +2 Query: 440 PXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXP 553 P + P P P P P P P P P P P P Sbjct: 57 PAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTP 94 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +2 Query: 440 PXXXGARXXPHPXXXGPXPPPXPRXXXPXPPPXPXPXP 553 P + P P P P P P P P P P P P Sbjct: 68 PAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTP 105 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PP P P P P PP P P P P Sbjct: 57 PAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAP 103 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +2 Query: 440 PXXXGARXXPHPXXXGPXPPPXPRXXXPXP---PPXPXPXPXP 559 P + P P P P P P P P PP P P P P Sbjct: 50 PPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAP 92 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 P PP P P P P P P TPP P P PP Sbjct: 24 PAPKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAP--TPPKPKPAPAPTPP 73 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P P PP P P PP P P P Sbjct: 28 PPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAP 59 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P P PP P P PP P P P Sbjct: 39 PPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAP 70 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P P PP P P PP P P P Sbjct: 50 PPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAP 81 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P P PP P P PP P P P Sbjct: 72 PPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAP 103 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 6/38 (15%) Frame = +2 Query: 872 PRXPPPXPPPXP-PXXPXPXP-----PPXPXXGXAPPP 967 P PP P P P P P P P PP P AP P Sbjct: 24 PAPKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTP 61 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 6/38 (15%) Frame = +2 Query: 872 PRXPPPXPPPXP-PXXPXPXP-----PPXPXXGXAPPP 967 P PP P P P P P P P PP P AP P Sbjct: 57 PAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTP 94 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -3 Query: 919 GXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXP 803 G GG GGG + GGGGGGG G G P Sbjct: 103 GKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGPP 141 Score = 33.9 bits (74), Expect = 0.17 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 919 GXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXP 803 G GG GGG GGGGGGG G G P Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGP 140 Score = 32.3 bits (70), Expect = 0.53 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG P G G GG GGG GGG G Sbjct: 108 GGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGGP 485 GG GGGGG G GGGGGP Sbjct: 123 GGGGGGGG--GGGGGGGGGP 140 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G G GG GGG GGG G Sbjct: 107 GGGGGGPANNNKGQKIGGGGGGGGGGGGGGGG 138 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 541 GXGGGGGXXXXGXGGGGGP 485 G GGGGG G GGGG P Sbjct: 123 GGGGGGGGGGGGGGGGGPP 141 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 6/38 (15%) Frame = -3 Query: 553 GXXGGXGGGG------GXXXXGXGGGGGPXXXGVXGXP 458 G GG GGGG G G GGGGG G G P Sbjct: 103 GKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGP 140 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 934 GGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG G GG G GGGGGGG G Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 +GGG G GG GGG GGG G Sbjct: 104 KGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGG 136 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -2 Query: 851 GGGGGGXGGXXXGXXPXPPR 792 GGGGGG GG G PP+ Sbjct: 123 GGGGGGGGGGGGGGGGGPPK 142 Score = 28.3 bits (60), Expect = 8.7 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 8/40 (20%) Frame = -3 Query: 553 GXXGGXGGGGGXXXX--------GXGGGGGPXXXGVXGXP 458 G GG GGGGG G GGGGG G G P Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGPP 141 >At5g04970.1 68418.m00526 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 624 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPP-RAPRXAXXPPPA 971 PP PP + P PP PP P PP P PPP+ Sbjct: 27 PPSQPPSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPPPS 73 Score = 31.9 bits (69), Expect = 0.71 Identities = 18/64 (28%), Positives = 21/64 (32%) Frame = +3 Query: 783 RPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXP 962 RP + P+ PP PP P PP PP P P P + P Sbjct: 26 RPPSQPPSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSPSQP--SPLP 83 Query: 963 PPAA 974 P A Sbjct: 84 PNIA 87 >At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1 predicted transmembrane domain; Length = 175 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G GGG G G G GGG GGG G Sbjct: 144 GGGSHGHGCGGGGGGGGGGLGGGGCGGGGCG 174 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG GGGGG G GGGG Sbjct: 149 GHGCGGGGGGGGGGLGGGGCGGGG 172 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGG 883 GG G GGG G G GG G G GG Sbjct: 145 GGSHGHGCGGGGGGGGGGLGGGGCGGGG 172 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGG 151 G G G GGGGG GG GGG Sbjct: 149 GHGCGGGGGGGGGGLGGGGCGGGG 172 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG+ GGG G G G GG GGG G Sbjct: 144 GGGSHGHGCGGGGGGGGGGLGGGGCGGGGCGG 175 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -3 Query: 559 GXGXXG-GXGGGGGXXXXGXGGGG 491 G G G G GGGGG G GGGG Sbjct: 144 GGGSHGHGCGGGGGGGGGGLGGGG 167 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -1 Query: 960 GAXPXXGXGGGXGXGXXGGXGGGXGG 883 G+ GG G G GG GGG GG Sbjct: 137 GSASSCSGGGSHGHGCGGGGGGGGGG 162 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G GGGGG GG GGG G Sbjct: 144 GGGSHGHGCGGGGGGGGGGLGGGGCGGGG 172 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 863 GXXGGGGGGGXGGXXXG 813 G GGGGGGG GG G Sbjct: 153 GGGGGGGGGGLGGGGCG 169 >At2g28670.1 68415.m03485 disease resistance-responsive family protein / fibroin-related contains similarity to silk fibroin heavy chain [Bombyx mori] gi|765323|gb|AAB31861; contains disease resistance response protien domain Pfam:FP03018 Length = 447 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G G G G G G G GP G G P GG Sbjct: 158 GAGPALGGGAGAGSALGGGGAGAGPALGGGGAGAGPALGGG 198 Score = 33.9 bits (74), Expect = 0.17 Identities = 23/70 (32%), Positives = 23/70 (32%), Gaps = 2/70 (2%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXX--GGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPX 800 A GGG A GG G GG G G G GGGG G G Sbjct: 132 ALGGGPGAGSALGGGAGAGPALGGGAGAGPALGGGAGAGSALGGGGAGAGPALGGGGAGA 191 Query: 799 PPAXGRXXRG 770 PA G G Sbjct: 192 GPALGGGVAG 201 Score = 31.9 bits (69), Expect = 0.71 Identities = 18/62 (29%), Positives = 19/62 (30%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPPA 791 AG G + G G GG G G G GGG G G G P Sbjct: 125 AGAGTGSALGGGPGAGSALGGGAGAGPALGGGAGAGPALGGGAGAGSALGGGGAGAGPAL 184 Query: 790 XG 785 G Sbjct: 185 GG 186 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G G G G G G G G GP G P GG Sbjct: 158 GAGPALGGGAGAGSALGGGGAGAGPALGGGGAGAGPALGGG 198 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = -1 Query: 585 PXXXNXXXXGXGXGXGXGGGXGXXXR-GXGGGXGPXXXGXGXXRAPXXXGG 436 P + G G G GGG G G G G G G G P GG Sbjct: 137 PGAGSALGGGAGAGPALGGGAGAGPALGGGAGAGSALGGGGAGAGPALGGG 187 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -1 Query: 585 PXXXNXXXXGXGXGXGXGGGXGXXXR-GXGGGXGPXXXGXGXXRAPXXXGG 436 P + G G G GGG G G G G GP G G P GG Sbjct: 117 PTTGSATGAGAGTGSALGGGPGAGSALGGGAGAGP-ALGGGAGAGPALGGG 166 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 G G+ P G G G G GGG G G Sbjct: 112 GSGSLPTTGSATGAGAGTGSALGGGPGAG 140 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = -3 Query: 586 PXXXKRTXXGXGXXGGXGGG-GGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 P T G G GGG G G G G GP G G P GG Sbjct: 117 PTTGSATGAGAGTGSALGGGPGAGSALGGGAGAGPALGGGAG-AGPALGGG 166 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPP 422 GG G G G G G G GP G GG P Sbjct: 174 GGGGAGAGPALGGGGAGAGPALGGGVAGSGSALGGGASAGP 214 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXR-GXGGGXGPXXXGXGXXRAPXXXGGXXPPP 421 G G G GGG G G G G GP G + GG P Sbjct: 136 GPGAGSALGGGAGAGPALGGGAGAGPALGGGAGAGSALGGGGAGAGP 182 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PP P P P P P +PPP Sbjct: 113 PPPVSPPPAPTSPPPTPASPPPAPASPPP 141 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +2 Query: 872 PRXPPPXP--PPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP P PP P P P P P +PPP Sbjct: 122 PTSPPPTPASPPPAPASPPPAPASPPPAPVSPPP 155 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P PP P + P PPP P P P P PPPA Sbjct: 96 PPPQPPQSPPASAPTVSPPPVSPPP-APTSPPPTPASPPPAPASPPPA 142 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +2 Query: 872 PRXPPPXP--PPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP P PP P P P P P +PPP Sbjct: 115 PVSPPPAPTSPPPTPASPPPAPASPPPAPASPPP 148 Score = 32.7 bits (71), Expect = 0.40 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +3 Query: 813 PLXXXPXPPPPPP-PXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 P+ P P PPP P A P P PP P +AP PP A Sbjct: 115 PVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAPA 169 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXP---PPXPPXXPXXXPPRAPRXAXXPPPA 971 PPP P + P P PP PP P P PPPA Sbjct: 73 PPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPA 121 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPP--PPXPPXXPXP 560 PP P +P PPP P P P PP P P P Sbjct: 113 PPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPP 155 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPP--PPXPXXXXPPPPPXPPXXP 554 PP P + PPP PP PP P PP P Sbjct: 96 PPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAP 136 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/42 (33%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = +3 Query: 438 PPXXXGXGXPX-TPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P +P PPP P P PP P P P Sbjct: 100 PPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPP 141 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P TP P PP PPP PP P Sbjct: 93 PATPPPQPPQSPPASAPTVSPPPVSPPPAP 122 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 P PPP P P PP P P P V Sbjct: 120 PAPTSPPPTPASPPPAPASPPPAPASPPPAPV 151 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/47 (31%), Positives = 17/47 (36%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P P P + P PP P P PP +P PPP Sbjct: 133 PPPSSPSPNVGPTNPESPPLQSPPAPPASDPTNSPPASPLDPTNPPP 179 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PL P PP P P PPP P P PP P P P Sbjct: 151 PLQSPPAPPASDPTNSPPASPLDPTN-PPPIQPSGPATSPPANPNAPPSPFP 201 Score = 29.1 bits (62), Expect = 5.0 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +3 Query: 804 GXXPLXXXPXPPP---PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 G P P PP PPP P PP PP PP + PPP Sbjct: 5 GESPSSSPPAPPADTAPPPETPSENSALPPVDSSPPSPPADSSSTPPLS--EPSTPPP 60 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/46 (28%), Positives = 16/46 (34%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 P PPPP PP PP P + PPP++ Sbjct: 92 PSPPPPTSNESPSPPEDSETPPAPPNESNDNNPPPSQDLQSPPPSS 137 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/42 (33%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPP-PPPXPXXXXPPPPPXPPXXPXP 560 P G P +P PP PP PP P P P P Sbjct: 138 PSPNVGPTNPESPPLQSPPAPPASDPTNSPPASPLDPTNPPP 179 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PP P PPP P +P P Sbjct: 78 PPPPSDSSPPVDSTPSPPP-PTSNESPSP 105 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P PP A PP P P PP P PPA Sbjct: 144 PTNPESPPLQSPPAPPASDPTNSPPASPLDPTNPPPIQPSGPATSPPA 191 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = +3 Query: 816 LXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 L P PPP PPP P PP PP PP +P PPP Sbjct: 45 LQNQPPPPPSPPP-----PSCTPSPPPPSPPPPKKSSCPP-SPLPPPPPPP 89 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P PP PP P PP P PP P P Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPP 89 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRP 602 PP TP P PPP PP P PP P P F G P Sbjct: 50 PPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPPNYVFTYPPGDLYP 104 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPP 935 P PP PPPP + PPP PP PP Sbjct: 64 PPPPSPPPPKKSSCPPSPLPPPPPPPPPNYVFTYPP 99 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 813 PLXXXPXPPPP-PPPXXXXXXRAXPXXXPPPXPP 911 P P PPPP PPP P PPP PP Sbjct: 57 PPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPP 90 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 5/57 (8%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPP-----XPPXXPXXXPPRAPRXAXXPPP 968 P PPPP PP P PPP P P PP P PP Sbjct: 43 PCLQNQPPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPPNYVFTYPP 99 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 896 PPXPPXXPXPXPPPXPXXGXAPPPR 970 PP PP P P P P PPP+ Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPK 73 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 34.3 bits (75), Expect = 0.13 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +3 Query: 489 PPP--PPXPXXXXPPPPPXPPXXPXP 560 PPP P P PPPPP PP P P Sbjct: 367 PPPRRSPPPLQTPPPPPPPPPLAPPP 392 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 PPP P PP P PPP P PPP+ Sbjct: 367 PPPRRSP-PPLQTPPPPPPPPPLAPPPPPQ 395 Score = 33.9 bits (74), Expect = 0.17 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPP 536 P PPPPP P PPPPP Sbjct: 374 PPLQTPPPPPPPPPLAPPPPP 394 Score = 33.5 bits (73), Expect = 0.23 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXP 217 PPP PP PPPPP P P Sbjct: 373 PPPLQTPPPPPPPPPLAPPPPP 394 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 107 PXPXXXFXXXPLFXXPPPXWXPPXXPPPPP 196 P P PL PPP PP PPPPP Sbjct: 365 PVPPPRRSPPPLQTPPPPPPPPPLAPPPPP 394 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P P PPP P PPPP PP P Sbjct: 365 PVPPPRRSPPPLQTPPPPPPPPPLAPPPPP 394 Score = 32.7 bits (71), Expect = 0.40 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 875 RXPPPXPPPXPPXXPXPXPPPXP 943 R PPP P PP P P PP P Sbjct: 371 RSPPPLQTPPPPPPPPPLAPPPP 393 Score = 32.7 bits (71), Expect = 0.40 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXP 943 P PP PPP PP P P P P Sbjct: 375 PLQTPPPPPPPPPLAPPPPPQKRP 398 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 875 RXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 + P P P PP P PPP P PPP Sbjct: 363 KSPVPPPRRSPPPLQTPPPPPPPPPLAPPPP 393 Score = 32.3 bits (70), Expect = 0.53 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPP 545 P PPPPP P PPPP P Sbjct: 375 PLQTPPPPPPPPPLAPPPPPQKRP 398 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPR 947 P PPP + P PPP PP P P + PR Sbjct: 365 PVPPPRRSPPPLQTPPP--PPPPPPLAPPPPPQKRPR 399 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +2 Query: 152 PPPXWXPPXX---PPPPPXXPXXXPXP 223 PPP PP PPPPP P P P Sbjct: 367 PPPRRSPPPLQTPPPPPPPPPLAPPPP 393 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P P PPPPPPP P Sbjct: 374 PPLQTPPPPPPPPPLAP 390 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 PPPPP PPP P PP P PPP A Sbjct: 347 PPPPPNRAAFQAITQEKSPVPPPRRSPPPLQTPPPPP----PPPPLA 389 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 458 RXXPHPXXXGPXPPPXPRXXXPXPPPXPXP 547 R P P P PPP P P PPP P Sbjct: 370 RRSPPPLQTPPPPPPPP-PLAPPPPPQKRP 398 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 34.3 bits (75), Expect = 0.13 Identities = 34/122 (27%), Positives = 36/122 (29%), Gaps = 14/122 (11%) Frame = +3 Query: 645 RAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXA--------GG 800 RA G G P P P G GGP P+ RP G Sbjct: 111 RAAGR-GVPTGPLVQAQPGLSGPVRGIGGPAPGMMQPQISRPPQIIRPPGQMPPQPPFAG 169 Query: 801 XGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPP------XPPXXPXXXPPRAPRXAXXP 962 G P PP P PP + P PPP PP PP P P Sbjct: 170 QGGPPPPYGMRPPYPGPPPPQYGGQQRPMMIPPPGGMMRGPPPPHGMQGPP--PSRPGMP 227 Query: 963 PP 968 PP Sbjct: 228 PP 229 Score = 31.5 bits (68), Expect = 0.93 Identities = 29/108 (26%), Positives = 31/108 (28%), Gaps = 5/108 (4%) Frame = +3 Query: 414 GGGGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPP-PXPPXXPXPXXVRFXXXGG 590 GG G P P PP PP PPPP P P P ++ GG Sbjct: 137 GGPAPGMMQPQISRPPQIIRPPGQMPPQPPFAGQGGPPPPYGMRPPYPGPPPPQY---GG 193 Query: 591 GXRPXXXXXXTXXXXXXXRAXGAXG----AXGXPGPXGXPXXXXPXGG 722 RP G G G P P G P P G Sbjct: 194 QQRPMMIPPPGGMMRGPPPPHGMQGPPPSRPGMPPPGGAPMFAPPHPG 241 Score = 31.5 bits (68), Expect = 0.93 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 420 GGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 GG PP G P P G PPP PP P PP P Sbjct: 204 GGMMRGPPPPHGMQGPP-PSRPGMPPPGGAPMFAPPHPGMPPAPP 247 Score = 28.3 bits (60), Expect = 8.7 Identities = 19/79 (24%), Positives = 20/79 (25%) Frame = +2 Query: 728 GXXAXPXXXXRXXXXPGXXPXRGGGGXXPPXXXXXXXXXXXXXXXXXXPRXPPPXPPPXP 907 G P PG P + GG P PP P P Sbjct: 169 GQGGPPPPYGMRPPYPGPPPPQYGGQQRPMMIPPPGGMMRGPPPPHGMQGPPPSRPGMPP 228 Query: 908 PXXPXPXPPPXPXXGXAPP 964 P PP P APP Sbjct: 229 PGGAPMFAPPHPGMPPAPP 247 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG P GGG G GG GGG GG G Sbjct: 336 GGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGG 367 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 RGGG G GGG G G GG GG G Sbjct: 370 RGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYG 402 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG G GG G G GGG G GG GGGG G Sbjct: 371 GGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGGSG 416 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = -3 Query: 964 GGXXAXRGARG-GXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 G G+ G G G GG GGG G GGGG GG G G Sbjct: 343 GSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGG 394 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G G G GG G G GGG GG G RG Sbjct: 320 GGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRG 371 Score = 32.7 bits (71), Expect = 0.40 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXP 797 GGG RG G GG GGG G GGG GGG G G P Sbjct: 281 GGGVGPYRGEPALGYSGRYGGGGGGYNRG---GYSMGGGGGYGGGPGDMYGGSYGEP 334 Score = 32.3 bits (70), Expect = 0.53 Identities = 43/186 (23%), Positives = 45/186 (24%), Gaps = 9/186 (4%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGX---GGGXGGGXRGXXXXXXXXXXXXXXXXXXGGXXP-- 802 GGG G G G G G GG GGG GGG G GG P Sbjct: 229 GGGYGDGYGGGHGGGYGGPGGPYKSGGGYGGGRSGGYGGYGGEFGGYGGGGYGGGVGPYR 288 Query: 801 --PPPRXGXXPGXXXXRXXXXGXAXXPRXXXXXXXXXGXPGAXARPXPRXRXXXGXXXXX 628 P G G + G+ P G Sbjct: 289 GEPALGYSGRYGGGGGGYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGG 348 Query: 627 CXXXXXXXXGXPPPPXXXNXXXXGXGXGXGX--GGGXGXXXRGXGGGXGPXXXGXGXXRA 454 G G G G GGG G G GG G G G R Sbjct: 349 YGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRG 408 Query: 453 PXXXGG 436 GG Sbjct: 409 GYGGGG 414 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 G G RG G G GG GG G GGGGG G G Sbjct: 363 GAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGG 414 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGX-GGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G GG G GG GGG G GGGG G G Sbjct: 258 GGGRSGGYGGYGGEFGGYGGGGYGGGVGPYRGEPALGYSGRYGGGGGGYNRGG 310 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GG GG GG GGG G G G GG Sbjct: 353 GIGGYGGGMGGAGG--GGYRGGGGYDMGGVGGGGAGGYGAGG 392 Score = 30.7 bits (66), Expect = 1.6 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGG---GGGGGXGXXXRG 812 G G G RGG GG GGG G GG GGGGG G G Sbjct: 360 GMGGAGGGGYRGGGGYDM-GGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGG 413 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -3 Query: 559 GXGXXGGXGGG-GGXXXXGXGGGGGPXXXGVXG 464 G GG GGG GG G GGGG GV G Sbjct: 350 GSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGG 382 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXG--XGGGGGPXXXGVXG 464 G G GG G GGG G GGGGG G G Sbjct: 381 GGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGG 414 Score = 29.9 bits (64), Expect = 2.8 Identities = 46/181 (25%), Positives = 48/181 (26%), Gaps = 4/181 (2%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXG--GGGGGGXGXXXRGXXPXPP 794 GGG G GG GG GGG G G GGG GG RG P Sbjct: 237 GGGHGGGYGGPGGPYKSG-GGYGGGRSGGYGGYGGEFGGYGGGGYGGGVGPYRG-EPALG 294 Query: 793 AXGRXXRGXXXXXXXXXXXXGPP--PPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXV 620 GR G G G G PG + + Sbjct: 295 YSGRYGGGGGGYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGI 354 Query: 619 XXXXXXGRXPPPXXXKRTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXG 440 G R G G GGG G G GG GG G G G Sbjct: 355 -GGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGG 413 Query: 439 G 437 G Sbjct: 414 G 414 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G G GGGG GG GGG G Sbjct: 381 GGGGAGGYGAGGGGNGGGSFYGGGGGRGG 409 Score = 28.7 bits (61), Expect = 6.6 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 8/53 (15%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGX--------ARXXXXXXGGGGGG 836 +GGG R G G GG GGG G A GGGGGG Sbjct: 253 SGGGYGGGRSGGYGGYGGEFGGYGGGGYGGGVGPYRGEPALGYSGRYGGGGGG 305 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXP 452 G G GG GG G GGG G G G P Sbjct: 387 GYGAGGGGNGGGSFYGGGGGRGGYGGGGSGRYHP 420 Score = 28.3 bits (60), Expect = 8.7 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 6/51 (11%) Frame = -1 Query: 231 PPXGXGXXXGXXGGG------GGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 P G G G GGG GG GG GG G G G GG Sbjct: 334 PGGGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGG 384 >At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibrillarin 2 GI:9965655 from [Arabidopsis thaliana] Length = 320 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GG G GG GG GGG RG Sbjct: 9 GGGFSGGRGRGGYSGGRGDGGFSGGRGGGGRG 40 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGG-GXGPXXXGXGXXRAPXXXGG 436 G G G GGG G RG G G GP G R P GG Sbjct: 32 GGRGGGGRGGGRGFSDRGGRGRGRGPPRGGARGGRGPAGRGG 73 Score = 29.5 bits (63), Expect = 3.8 Identities = 28/71 (39%), Positives = 29/71 (40%), Gaps = 4/71 (5%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG---XXXRGXXPX 800 +GGG RG RGG GG G G G GGG GGG G RG Sbjct: 8 SGGGFSGGRG-RGGYS----GGRGDGGFSGGR------GGGGRGGGRGFSDRGGRGRGRG 56 Query: 799 PPAXG-RXXRG 770 PP G R RG Sbjct: 57 PPRGGARGGRG 67 >At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / heat shock transcription factor 7 (HSTF7) identical to heat shock factor protein 7 (HSF7) SP:Q9T0D3 from [Arabidopsis thaliana] Length = 377 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGGA G GG GG GGG GGG G Sbjct: 17 GGGAGCSAGNSGGSSGCGAGGGGGGSGGGGGG 48 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXR 874 G + G G G G G GG GGG G R Sbjct: 25 GNSGGSSGCGAGGGGGGSGGGGGGGGDSQR 54 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGG 488 G G G GGG G GGGGG Sbjct: 28 GGSSGCGAGGGGGGSGGGGGGG 49 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 943 GARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 G GG G GG G GGGGGGG Sbjct: 14 GVGGGGAGCSAGNSGGSSGCGAGGGGGGSGGGGGGGG 50 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGG 488 G G GGGG G GGGGG Sbjct: 29 GSSGCGAGGGGGGSGGGGGGGG 50 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -3 Query: 910 GGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG G G G + GGGGGG G G Sbjct: 16 GGGGAGCSAGNSGGSSGCGAGGGGGGSGGGGGG 48 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 4/55 (7%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXG----GXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG R GG G G G GGG G R GGG GGG G G Sbjct: 102 GGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 156 Score = 32.7 bits (71), Expect = 0.40 Identities = 18/47 (38%), Positives = 20/47 (42%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 + GGG + RG GG G GGG G G GGGGG Sbjct: 115 SGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEG---GGYGGSGGGGG 158 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGX--GGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 A G G RGG G GG GGG G GGGG G G G Sbjct: 84 AQSRGSGGGGGHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGG 139 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG + G G G GGG G GG GG G G Sbjct: 110 GGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 156 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G GGGG GG GGG G G GG Sbjct: 117 GGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 158 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGG 488 GG GGG G G GGGGG Sbjct: 140 GGYGGGEGGGYGGSGGGGG 158 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = -1 Query: 222 GXGXXXGXXGGGG-GXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 G G G GGG G GG GGG G G G G Sbjct: 88 GSGGGGGHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 129 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 541 GXGGGGGXXXXGXGGGGGPXXXGVXG 464 G GGGGG G GGGG G G Sbjct: 88 GSGGGGGHRGGGSYGGGGGRREGGGG 113 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/52 (34%), Positives = 21/52 (40%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PL PP PPP +A P P PP P PP +P + PP Sbjct: 862 PLQPQSQPPEPPPEMMPPPPQALPPPLPHSHPPLVP--PPPFSPLLSPRLPP 911 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G GG G GG GGG G GG GGGG G G Sbjct: 115 GGGGYGPGGGGGGVVIG--GGFGGGAGYGSG-GGLGWDGGNGGGGPGYGSGG 163 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXG 100 G G G GGGGG GG GGG G G G G Sbjct: 158 GYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGG 198 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 G G GG G GG GGG G GGGGG G G Sbjct: 151 GNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHG 202 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG G GG G GG G G GGG GGG G Sbjct: 125 GGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGG 171 Score = 32.7 bits (71), Expect = 0.40 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG G GG G G GGG G GGGGGG G G Sbjct: 143 GGGLGWDGGNGGGGPGYGSG-GGGIGGGGGIGGGVIIGGGGGGCGGSCSGG 192 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G GGG G GG GGG G G G Sbjct: 173 GGGVIIGGGGGGCGGSCSGGGGGGGGYGHGG 203 Score = 32.3 bits (70), Expect = 0.53 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 GGG G G G GG GGG + GGG GGG Sbjct: 131 GGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGG 175 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGP 485 G G G G GGG G GGGGP Sbjct: 133 GFGGGAGYGSGGGLGWDGGNGGGGP 157 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG G+ GG G G GG G GGGGGG G G Sbjct: 153 GGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHGG 203 Score = 31.5 bits (68), Expect = 0.93 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGX---GGGXGGG 880 GG P G GGG G G GG GGG GGG Sbjct: 108 GGGGPGYG-GGGYGPGGGGGGVVIGGGFGGG 137 Score = 31.5 bits (68), Expect = 0.93 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -3 Query: 559 GXGXXG-GXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXP 428 G G G G GGGGG G G GGG G GG P Sbjct: 113 GYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGP 157 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGG 436 G G G G GGG G GGG G G G GG Sbjct: 135 GGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGG 175 Score = 31.5 bits (68), Expect = 0.93 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG G GGG G GGG G G G GG Sbjct: 163 GGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHGG 203 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/54 (35%), Positives = 21/54 (38%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 + GGG G GG G GG GG G GGGG G G +G Sbjct: 161 SGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGG------GGGGGYGHGGVSTKG 208 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 568 TXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 T G G GG G GGG G GGGG G G GG Sbjct: 103 TAGGYGG-GGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGG 145 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -1 Query: 231 PPXGXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 P G G GGGG GG GG G G G GG Sbjct: 112 PGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGG 156 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G GG GGG G G G Sbjct: 115 GGGGYGPGGGGGGVVIG--GGFGGGAGYGSGG 144 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGGG G GGGG G+ G GG Sbjct: 145 GLGWDGGNGGGG--PGYGSGGGGIGGGGGIGGGVIIGGGGG 183 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXG 466 G G G G G G G G GG GP G Sbjct: 133 GFGGGAGYGSGGGLGWDGGNGGGGPGYGSGG 163 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP +P PPP Sbjct: 321 PPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPP 372 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 42 PPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPP 82 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 62 PPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPP 102 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 82 PPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPP 122 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 102 PPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPP 142 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 122 PPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPP 162 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 142 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 182 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 162 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 202 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 182 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 222 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 202 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 242 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 222 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 262 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 242 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 282 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 262 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 302 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 282 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 322 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 302 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPP 342 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 322 PPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPP 362 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P +P PPPP PPPPP P P Sbjct: 352 PPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 392 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 382 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 422 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 402 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 442 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 61 PPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPP 112 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 81 PPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPP 132 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 91 PPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPP 142 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 101 PPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPP 152 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 121 PPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 172 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 131 PPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 182 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 141 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 192 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 151 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 202 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 161 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 212 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 171 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 222 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 181 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 232 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 191 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 242 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 201 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 252 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 211 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 262 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 221 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 272 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 231 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 282 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 241 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 292 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 251 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 302 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 261 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 312 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 271 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 322 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 281 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 332 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 291 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPP 342 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 301 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPP 352 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 5/53 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P PP PPPPP P P PP PP P PPP+ Sbjct: 311 PPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPS 363 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 341 PPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 392 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 371 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 422 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 381 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 432 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 391 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 442 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 840 PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPP P P PP PP P PPP Sbjct: 50 PPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPP 92 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 51 PPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPP 102 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 71 PPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPP 122 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 92 PPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPP 132 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P PPP Sbjct: 111 PPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPP 162 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 112 PPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPP 152 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 132 PPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 172 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 152 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 192 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 172 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 212 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 192 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 232 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 212 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 252 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 232 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 272 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 252 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 292 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 272 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 312 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 292 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 332 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 312 PPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPP 352 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 840 PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPP P P PP PP P PPP Sbjct: 370 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 412 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 372 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 412 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 392 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 432 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 412 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSP 452 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 52 PPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPP 92 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPPP P P Sbjct: 72 PPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPP 112 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P PPPP PPPPP P P Sbjct: 371 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 402 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 P T PPPPP PPPP P P V Sbjct: 42 PPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYV 76 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 53 PPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYV 96 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 73 PPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYV 116 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 93 PPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 136 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 113 PPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYV 156 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 133 PPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 176 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 153 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 196 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 173 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 216 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 193 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 236 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 213 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 256 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 233 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 276 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 253 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 296 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 273 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 316 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 293 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 336 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 313 PPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYV 356 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 353 PPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 396 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 373 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 416 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 393 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 436 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPP PPPPP P P Sbjct: 342 PPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPP 382 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP P PPP P P Sbjct: 422 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPP 462 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 123 PPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYV 166 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 143 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 186 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 163 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 206 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 183 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 226 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 203 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 246 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 223 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 266 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 243 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 286 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 263 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 306 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 283 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 326 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P P PP P PPP Sbjct: 331 PPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPP 382 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPP P P P PP PP P PPP Sbjct: 351 PPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 402 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 383 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 426 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PP P P P Sbjct: 401 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSP 452 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 403 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 446 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP P P PPP Sbjct: 411 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPP 462 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 83 PPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYV 126 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 103 PPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYV 146 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 PP P PPPPP PPPP P P V Sbjct: 303 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYV 346 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPP P P P Sbjct: 332 PPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPP 372 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +2 Query: 881 PPPX----PPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PPP P P PPP PPP Sbjct: 432 PPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPP 464 Score = 29.1 bits (62), Expect = 5.0 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 8/55 (14%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXA---XXPPP 968 P PP PPPPP P P PP PP P + PPP Sbjct: 421 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPPSYSYSYSSPPP 475 >At1g12810.1 68414.m01488 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 129 Score = 34.3 bits (75), Expect = 0.13 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 P PPP P PP PPP P G PP Sbjct: 26 PSAPPPPGYPSPPSHHEGYPPPQPYGGYPPP 56 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXP 458 G G GG GGGG G GG GG G+ G P Sbjct: 75 GLGGGGGGLGGGGGGLLGGGGFGGGAGGGLGGLP 108 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G GG GGG GGG G Sbjct: 77 GGGGGGLGGGGGGLLGG--GGFGGGAGGGLGG 106 Score = 32.7 bits (71), Expect = 0.40 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG G G G GG GG G GGG GGG G Sbjct: 60 GGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAGGGLG 105 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGGA G G G G G G G G GGG G Sbjct: 54 GGGAG-LGGLGIGAGIGAGAGLGLGGGGGGLG 84 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 216 GXXXGXXGGGGGXXGGXXXGGG 151 G G GGGGG GG GGG Sbjct: 78 GGGGGLGGGGGGLLGGGGFGGG 99 Score = 28.7 bits (61), Expect = 6.6 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXG-GXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G G G G G G G G GG GGGG G G Sbjct: 42 GGGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGG 94 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXG 472 G G G G G G G G GGG G G Sbjct: 61 GLGIGAGIGAGAGLGLGGGGGGLGGGGGG 89 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXG 487 G G G G GGG G G G G G Sbjct: 46 GDGLGLGLGGGAGLGGLGIGAGIG 69 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G G G G G G GGG G G+ G Sbjct: 61 GLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLG 92 >At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein similar to beta-glucan-elicitor receptor GI:1752734 from [Glycine max] Length = 745 Score = 33.9 bits (74), Expect = 0.17 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPP 937 P+ PP PPP P P P PPP Sbjct: 20 PKNRPPSPPPPLPLPPSPSPPP 41 >At3g11402.1 68416.m01388 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 708 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 826 PPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 PP PPPPPPP P PP P P PPP Sbjct: 32 PPPPPPPPPPVLPHIRSRKKMDIKEVHLPLPRHYPPPPP---PLPPPP 76 Score = 29.1 bits (62), Expect(2) = 0.53 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 501 PXPXXXXPPPPPXPPXXP 554 P P PPPPP PP P Sbjct: 60 PLPRHYPPPPPPLPPPPP 77 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXP 919 PR PP PPP PP P Sbjct: 62 PRHYPPPPPPLPPPPP 77 Score = 25.4 bits (53), Expect(2) = 4.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 522 PPPPPXPPXXP 554 PPPPP PP P Sbjct: 34 PPPPPPPPVLP 44 Score = 22.2 bits (45), Expect(2) = 4.3 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 Query: 528 PPPXPPXXPXP 560 PPP PP P P Sbjct: 66 PPPPPPLPPPP 76 Score = 21.8 bits (44), Expect(2) = 0.53 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +3 Query: 489 PPPPPXPXXXXP 524 PPPPP P P Sbjct: 33 PPPPPPPPPVLP 44 >At3g05920.1 68416.m00668 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 126 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 441 PXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 P G P P PP PP P PPP P PP Sbjct: 65 PVIISVGPPPKPPE--PPKPPEPEKPKPPPAPEPP 97 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PP P P P P P P P P PP Sbjct: 73 PPKPPEPPKPPEPEKPKPPPAPEPPKHVCKPP 104 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Frame = +2 Query: 881 PPPXPP--PXPPXXPXPXPPPXP 943 PPP PP P PP P PPP P Sbjct: 72 PPPKPPEPPKPPEPEKPKPPPAP 94 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = +3 Query: 486 GPPP-PPXPXXXXPPPPPXPPXXPXP 560 GPPP PP P P P PP P P Sbjct: 71 GPPPKPPEPPKPPEPEKPKPPPAPEP 96 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 893 PPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PP P P P P AP P Sbjct: 72 PPPKPPEPPKPPEPEKPKPPPAPEP 96 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 473 PXXXGPXPPPXPRXXXPXPPPXPXP 547 P P PP P P PPP P P Sbjct: 72 PPPKPPEPPKPPEPEKPKPPPAPEP 96 >At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 33.9 bits (74), Expect = 0.17 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 P P P P P P P P P P APP Sbjct: 307 PAPAPSPAPASAPVPAPAPTPAPAPAPP 334 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P P P P P P P P AP P Sbjct: 293 PAPTPAPAPAPAPAPAPAPSPAPASAPVP 321 Score = 31.9 bits (69), Expect = 0.71 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P P P P P P P P P P Sbjct: 295 PTPAPAPAPAPAPAPAPSPAPASAPVPAP 323 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P P P P P P P AP P Sbjct: 299 PAPAPAPAPAPAPSPAPASAPVPAPAPTP 327 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P P P P P P P AP P Sbjct: 305 PAPAPAPSPAPASAPVPAPAPTPAPAPAP 333 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P P P P P P P P A P Sbjct: 291 PLPAPTPAPAPAPAPAPAPAPSPAPASAP 319 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P P P P P P P AP P Sbjct: 297 PAPAPAPAPAPAPAPSPAPASAPVPAPAP 325 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P P P P P P P AP P Sbjct: 303 PAPAPAPAPSPAPASAPVPAPAPTPAPAP 331 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P P P P P P P P P Sbjct: 301 PAPAPAPAPAPSPAPASAPVPAPAPTPAP 329 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +2 Query: 488 PXPPPXPRXXX-PXPPPXPXPXPXPXXXXFXXXGGGG 595 P P P P P P P P P P P G GG Sbjct: 309 PAPSPAPASAPVPAPAPTPAPAPAPPNKVEALGGNGG 345 >At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 33.9 bits (74), Expect = 0.17 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 P P P P P P P P P P APP Sbjct: 307 PAPAPSPAPASAPVPAPAPTPAPAPAPP 334 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P P P P P P P P AP P Sbjct: 293 PAPTPAPAPAPAPAPAPAPSPAPASAPVP 321 Score = 31.9 bits (69), Expect = 0.71 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P P P P P P P P P P Sbjct: 295 PTPAPAPAPAPAPAPAPSPAPASAPVPAP 323 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P P P P P P P AP P Sbjct: 299 PAPAPAPAPAPAPSPAPASAPVPAPAPTP 327 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P P P P P P P AP P Sbjct: 305 PAPAPAPSPAPASAPVPAPAPTPAPAPAP 333 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P P P P P P P P A P Sbjct: 291 PLPAPTPAPAPAPAPAPAPAPSPAPASAP 319 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P P P P P P P AP P Sbjct: 297 PAPAPAPAPAPAPAPSPAPASAPVPAPAP 325 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P P P P P P P AP P Sbjct: 303 PAPAPAPAPSPAPASAPVPAPAPTPAPAP 331 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P P P P P P P P P Sbjct: 301 PAPAPAPAPAPSPAPASAPVPAPAPTPAP 329 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +2 Query: 488 PXPPPXPRXXX-PXPPPXPXPXPXPXXXXFXXXGGGG 595 P P P P P P P P P P P G GG Sbjct: 309 PAPSPAPASAPVPAPAPTPAPAPAPPNKVEALGGNGG 345 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G G GG G GGG G GGGGG Sbjct: 398 GCGGGGGGGDGGGGQGTGIGGGGG 421 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GG GGGG G GGGGG GV G Sbjct: 400 GGGGGGGDGGGGQGTGIG-GGGGGEQGTGVGG 430 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G G GG GG G G G Sbjct: 400 GGGGGGGDG-GGGQGTGIGGGGGGEQGTGVGG 430 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G G G G G G G G GGG Sbjct: 403 GGGGDGGGGQGTGIGGGGGGEQGTGVGGG 431 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = +3 Query: 417 GGGG-----GXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 GGGG G PP G G P P G PPP P P PP Sbjct: 128 GGGGEPAIPGAPPPKRGGGGEPVIP---GAPPPKRGGGGEPVIPGAPP 172 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = +3 Query: 417 GGGG-----GXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 GGGG G PP G G P P G PPP P P PP Sbjct: 144 GGGGEPVIPGAPPPKRGGGGEPVIP---GAPPPKRGGGGEPVIPGAPP 188 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = +3 Query: 417 GGGG-----GXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 GGGG G PP G G P P G PPP P P PP Sbjct: 160 GGGGEPVIPGAPPPKRGGGGEPVIP---GAPPPKRGGGGEPVIPGAPP 204 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = +3 Query: 417 GGGG-----GXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 GGGG G PP G G P P G PPP P P PP Sbjct: 176 GGGGEPVIPGAPPPKRGGGGEPVIP---GAPPPKRGGGGEPVIPGAPP 220 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 4/33 (12%) Frame = -1 Query: 966 GGGAXPXXGXGGGXG----XGXXGGXGGGXGGG 880 GGG P GGG G G GG G G GGG Sbjct: 441 GGGGAPLTMIGGGGGEQGVTGSDGGGGRGRGGG 473 Score = 29.1 bits (62), Expect = 5.0 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPPPPPP 410 G GG G GGGG P + G P P GG P PP Sbjct: 80 GGENHASGGMGGTSATRGGGGEPV---IPGAPPPNRGGGETVIPGAPP 124 Score = 29.1 bits (62), Expect = 5.0 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 7/59 (11%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXG-------GXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG A G G G G GGG G GGGGGGG G +G Sbjct: 356 GGGSGAATQVMQGCGGGDAGAITQVMQGWGGGGA-GAVTQVMQGCGGGGGGGDGGGGQG 413 Score = 29.1 bits (62), Expect = 5.0 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGG-XGPXXXGXGXXRAPXXXGGXXPP 424 G G G GGG G G GGG G G G GG P Sbjct: 401 GGGGGGDGGGGQGTGIGGGGGGEQGTGVGGGGDTCTQVTHGGGGAP 446 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 429 GXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 G PP G G P P G PPP P P PP Sbjct: 121 GAPPPIRGGGGEPAIP---GAPPPKRGGGGEPVIPGAPP 156 Score = 28.3 bits (60), Expect = 8.7 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 6/58 (10%) Frame = -3 Query: 967 GGGXXAXRGARGGXXX------GXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG +G GG G GG GGG G GGGG G +G Sbjct: 312 GGGRTGNKGGNGGSIKIGVGTNGITGGTGGG-EAGAGMQVMQGWGGGGSGAATQVMQG 368 Score = 28.3 bits (60), Expect = 8.7 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG A G G GG GGG GGGGGG G G Sbjct: 386 GGGAGAVTQVMQGCGGGGGGGDGGGGQG-------TGIGGGGGGEQGTGVGG 430 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 33.9 bits (74), Expect = 0.17 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G G G G G GG GG GGG G Sbjct: 57 GGGGGISGGGGFGAGGGWIGGSVGGFGGGIGG 88 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GG G GG GGG GGG G Sbjct: 65 GGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFG 96 Score = 31.9 bits (69), Expect = 0.71 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GG G GGG G G GG G G GG Sbjct: 87 GGGFGGGGFGGGAGKGVDGGFGKGVDGG 114 Score = 31.5 bits (68), Expect = 0.93 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 + GGG A G GG G GG GGG G G GGG G G Sbjct: 63 SGGGGFGAGGGWIGGSVGGFGGGIGGGFGGG---------GFGGGAGKG 102 Score = 31.5 bits (68), Expect = 0.93 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 G G G GG G G GG GGG GG G Sbjct: 69 GAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAG 100 Score = 31.5 bits (68), Expect = 0.93 Identities = 21/54 (38%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXA-RXXXXXXGGGGGGGXGXXXRG 812 AGGG G+ GG G GG GGG G A + G G GG G G Sbjct: 70 AGGGWIG--GSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGAGKGVDG 121 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -3 Query: 943 GARGGXXXGXXGGXGGGXXXGXARXXXXXXGGG-GGGGXG 827 G GG G G GGG G GGG GGGG G Sbjct: 57 GGGGGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFG 96 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = -3 Query: 946 RGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 +G GG G GG G G G + GG GGG G G Sbjct: 149 KGFEGGIGKGIEGGVGKGFDGGAGKGVDGGAIGGIGGGAGKEIGG 193 Score = 29.1 bits (62), Expect = 5.0 Identities = 36/148 (24%), Positives = 40/148 (27%) Frame = -3 Query: 931 GXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPPAXGRXXRGXXXXXX 752 G G GG G G G GGG GGG G G G +G Sbjct: 57 GGGGGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGAG 116 Query: 751 XXXXXXGPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXXXXXXGRXPPPXXXK 572 G G G G G + + G+ K Sbjct: 117 KGVDG-GAGKGFDGGVGKGVDGGAGKGF--DGGVGKGFEGGIGKGIEGGVGKGFDGGAGK 173 Query: 571 RTXXGXGXXGGXGGGGGXXXXGXGGGGG 488 G GG GGG G G GGGG Sbjct: 174 GVDGGA--IGGIGGGAGKEIGGGIGGGG 199 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G G G GG GG G GGG GGG G G Sbjct: 57 GGGGGISGGGGFGAGGGWIGGSVGGFGGGIG---GGFGGGGFGGGAGKGVDG 105 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGGA G GG G G GG G G GG Sbjct: 96 GGGAGK--GVDGGFGKGVDGGAGKGVDGG 122 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = -3 Query: 553 GXXGGXGG--GGGXXXXGXGGGGGPXXXGVXG 464 G GG GG GGG G GGG G G G Sbjct: 77 GSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFG 108 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 204 GXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G GGGGG GG G G G G G GG Sbjct: 54 GDLGGGGGISGGGGFGAGGGWIG-GSVGGFGGGIGG 88 >At1g02460.1 68414.m00195 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to polygalacturonase PG1 GI:5669846, PG2 GI:5669848 from (Glycine max); contains PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 491 Score = 33.9 bits (74), Expect = 0.17 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXP 943 PP PPP PP P P PP P Sbjct: 58 PPTPPPGPPDSPAPSLPPSP 77 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 P PP P PPP PP P P Sbjct: 48 PKPPSSSISQPPTPPPGPPDSPAP 71 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGG 883 GGG GGG G G GG GGG GG Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGGAGG 149 Score = 32.7 bits (71), Expect = 0.40 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPPAX 788 GGG G G G GG GG G GG GGG G G A Sbjct: 126 GGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAG 185 Query: 787 G 785 G Sbjct: 186 G 186 Score = 31.9 bits (69), Expect = 0.71 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 571 RTXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 RT G GG GGGGG G GGG G G Sbjct: 119 RTSGGGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSG 154 Score = 31.9 bits (69), Expect = 0.71 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG G GG G GG GG G GG G GG G G Sbjct: 144 GGGAGGYGGSGGYGGGA-GGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATG 193 Score = 31.9 bits (69), Expect = 0.71 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGG-GGGGGXG 827 AGG G GG G GG G G G A GG G GG G Sbjct: 160 AGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGGGYGSSGGFG 208 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG GGG G GGG G G G GG Sbjct: 149 GYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGG 189 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 943 GARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 G GG G GG GG G GG GGG G Sbjct: 124 GFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGG 162 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGG 836 GGG G GG G G GG G GG GGG Sbjct: 157 GGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGGG 200 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 +GGG GG G GG GGG GG GG G G Sbjct: 121 SGGGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGG 173 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G G GG GGG G G GGG G Sbjct: 136 GYGGSGGYGGGAGGYGGSGGYGGGAGGYG 164 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = -3 Query: 946 RGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 R + GG G GG GGG G G GG GG G G Sbjct: 119 RTSGGGFGGGGYGG-GGGGYGGSGGYGGGAGGYGGSGGYGGGAGG 162 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G G GGGGG G GGG G G Sbjct: 124 GFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGG 155 Score = 28.7 bits (61), Expect = 6.6 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXG-GGXXXGXARXXXXXXGG---GGGGGXGXXXRG 812 GGG G GG G G G GG G GG GG GG G G Sbjct: 133 GGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYG 188 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -3 Query: 559 GXGXXGGXGGG-GGXXXXGXGGGGGPXXXGVXG 464 G G GG GGG GG G G GG G G Sbjct: 126 GGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGG 158 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G G GG GG G GGG G G G GG Sbjct: 136 GYGGSGGYGGGAGGYGGSGGYGGGAGGYG----GNSGGGYGG 173 >At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ZF-HD homeobox protein-related predicted proteins, Arabidopsis thaliana Length = 334 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = +3 Query: 843 PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 PPPP + PPP PP PPR+P A PP Sbjct: 118 PPPPSTAVEYQPHHRHHPPPPPP----PPPPRSPNSASPPP 154 Score = 31.9 bits (69), Expect = 0.71 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPP 937 PPP PPP PP P PP Sbjct: 135 PPPPPPPPPPRSPNSASPP 153 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 826 PPXPPPPPPPXXP 864 PP PPPPPPP P Sbjct: 135 PPPPPPPPPPRSP 147 >At5g21160.1 68418.m02528 La domain-containing protein / proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965, PF05383: La domain Length = 826 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 420 GGGGXXPPXXXGXGXPXTPXXX----GPPPPPXPXXXXP-PPPPXPPXXPXP 560 GGG P G P GPPPPP P PPP PP P P Sbjct: 94 GGGKANPGHKNPSGRHSKPGPRSNQNGPPPPPYLVHAVPYHPPPFPPMVPLP 145 >At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family protein similar to SP|P42925 22 kDa peroxisomal membrane protein {Mus musculus}; contains Pfam profile PF04117: Mpv17 / PMP22 family Length = 288 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 957 AXPXXGXGGGXGXGXXGGXGGGXGGG 880 A P GG G G GG GGG GGG Sbjct: 75 AVPGGNSGGSGGLGGSGGGGGGSGGG 100 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G G GG GGGGG G GGGGG G Sbjct: 83 GSGGLGGSGGGGG----GSGGGGGDGSDG 107 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG + G GG G G G GGG G +G Sbjct: 78 GGNSGGSGGLGGSGGGGGGSGGGGGDGSDGKG 109 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 228 PXGXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 P G G GG GG GG GGG G Sbjct: 77 PGGNSGGSGGLGGSGGGGGGSGGGGGDGSDG 107 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/52 (30%), Positives = 19/52 (36%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P+ P P PPPP P P PP P P+ + PPP Sbjct: 80 PIPSTPSTPSPPPPAPKKSP-PPPTPKKSPSPPSLTPFVPHPTPKKSPSPPP 130 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +3 Query: 465 PXTPXXXGP--PPPPXPXXXXPPPPPXPPXXPXP 560 P TP P P PP P PPPP P P P Sbjct: 77 PSTPIPSTPSTPSPPPPAPKKSPPPPTPKKSPSP 110 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/67 (26%), Positives = 20/67 (29%), Gaps = 1/67 (1%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXP-PPXPPXXPXXXPPRAPR 947 P P P P P PP P P PP P P P ++P Sbjct: 85 PSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSPS 144 Query: 948 XAXXPPP 968 PPP Sbjct: 145 TPSLPPP 151 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXP---PRAPRXAXXPPPA 971 P PPPP P PP P P P P P PPPA Sbjct: 88 PSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPA 138 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPX--PPPXPXXGXAPPP 967 P P PPP P P PPP P PPP Sbjct: 128 PPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPPP 161 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAPP 964 P P P PP PPP P +PP Sbjct: 85 PSTPSPPPPAPKKSPPPPTPKKSPSPP 111 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 6/37 (16%) Frame = +2 Query: 872 PRXPPPXP------PPXPPXXPXPXPPPXPXXGXAPP 964 P PPP P P PP P PPP P + P Sbjct: 132 PSLPPPAPKKSPSTPSLPPPTPKKSPPPPPSHHSSSP 168 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +3 Query: 828 PXPPPPP--PPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P PPP P PP + P PPP P P P PP Sbjct: 126 PSPPPTPSLPPPAPKKSPSTPSL-PPPTPKKSPPPPPSHHSSSPSNPP 172 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = +2 Query: 107 PXPXXXFXXXPLFXXPPPXWXPP----XXPPPPPXXPXXXPXPXGG 232 P P F PLF PPP P PPPPP P P G Sbjct: 42 PPPPQVFVPEPLFSEPPPPPKAPVNVSLSPPPPPRSPSTSTPPRLG 87 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 33.5 bits (73), Expect = 0.23 Identities = 26/101 (25%), Positives = 28/101 (27%), Gaps = 2/101 (1%) Frame = +3 Query: 678 PGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLXXXPXPPPPPPPX 857 P P P P G P P P P P P PPP Sbjct: 68 PNPNPNPNPNPPVLGSSPPSPTDSSSSTSISPNPPAPIVN-----PNPPPPSTPNPPPEF 122 Query: 858 XXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXP--PPAA 974 PPP P PP AP A P PP++ Sbjct: 123 SPPPPDLDTTTAPPPPSTDIPIPPPPPAPVSASPPLTPPSS 163 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 4/36 (11%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPP----PXPPXXPXP 560 P P PPPP PPPP P PP P P Sbjct: 116 PNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPPAP 151 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 492 PPPPXPXXXXPPPPPXPPXXPXP 560 PPPP PPPPP P P Sbjct: 135 PPPPSTDIPIPPPPPAPVSASPP 157 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXPXXXPXP 223 P P P P F PPP PPPP P P Sbjct: 108 PNPPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPP 148 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/48 (33%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXX--PXXXPPRAPRXAXXPPPA 971 PP PP P PPP P P PP +P + PPP+ Sbjct: 48 PPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPS 95 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +2 Query: 872 PRXPP-PXPPPXPPXXPXP--XPPPXPXXGXAPP 964 P PP PPP PP P P PPP P PP Sbjct: 70 PNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPP 103 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 6/53 (11%) Frame = +3 Query: 420 GGGGXXPPXXXGXGXPXTPXXXGPPPPPX---PXXXXPP---PPPXPPXXPXP 560 GG P P +P PPP P PP PPP PP P P Sbjct: 36 GGSETTQPPATSPPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPP 88 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PP P P PP P PPP Sbjct: 68 PPPNQPPN--TTPPPTPPSSPPPSITPPP 94 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPP-PPXPXXXXPPPPPXPPXXPXP 560 PP P P PPP PP PPP PP P Sbjct: 61 PPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPP 102 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P T PP P P PP PP P P Sbjct: 74 PNTTPPPTPPSSPPPSITPPPSPPQPQPPP 103 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/43 (30%), Positives = 13/43 (30%) Frame = +3 Query: 426 GGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 GG G P PP PP P PPP P Sbjct: 27 GGFTDQKIIGGSETTQPPATSPPSPPSPDTQTSPPPATAAQPP 69 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 33.1 bits (72), Expect = 0.31 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXP 554 PP P P PPPPP PP P Sbjct: 262 PPNRPPPPSSPPPPPPPPPTPP 283 Score = 31.5 bits (68), Expect = 0.93 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPP 934 P PPP P PP P P PP Sbjct: 263 PNRPPPPSSPPPPPPPPPTPP 283 Score = 31.5 bits (68), Expect = 0.93 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXP 205 PPP PP PPPPP P Sbjct: 266 PPPPSSPPPPPPPPPTPP 283 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXP 943 PP PPP P P PPP P Sbjct: 262 PPNRPPPPSSPPPPPPPPPTP 282 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P P PPPPPPP P Sbjct: 267 PPPSSPPPPPPPPPTPP 283 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXP 217 PP PP PPPPP P P Sbjct: 262 PPNRPPPPSSPPPPPPPPPTPP 283 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 875 RXPPPXPPPXPPXXPXPXPPP 937 R PPP PP PP P P PP Sbjct: 265 RPPPPSSPPPPP--PPPPTPP 283 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 893 PPPXPPXXPXPXPPPXPXXGXAPP 964 PPP PP P P PPP P PP Sbjct: 296 PPPSPPPPP-PPPPPQPLIAATPP 318 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 P PP PP P P PPP P P R Sbjct: 241 PSSPPQQPPATPPPPPPPPPVEVPQKPRR 269 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 826 PPXPPPPPPPXXP 864 PP PPPPPPP P Sbjct: 297 PPSPPPPPPPPPP 309 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 826 PPXPPPPPPPXXP 864 PP PPPPPPP P Sbjct: 382 PPSPPPPPPPPPP 394 Score = 30.7 bits (66), Expect = 1.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 814 PXXXPPXPPPPPPP 855 P PP PPPPPPP Sbjct: 296 PPPSPPPPPPPPPP 309 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPP 937 P+ PPP PP P P PPP Sbjct: 374 PQYQSLIPPPSPPPPPPPPPPP 395 Score = 30.7 bits (66), Expect = 1.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 814 PXXXPPXPPPPPPP 855 P PP PPPPPPP Sbjct: 381 PPPSPPPPPPPPPP 394 Score = 30.7 bits (66), Expect = 1.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 814 PXXXPPXPPPPPPP 855 P PP PPPPPPP Sbjct: 382 PPSPPPPPPPPPPP 395 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXPXXVR 572 P PP PPPPP PP P R Sbjct: 241 PSSPPQQPPATPPPPPPPPPVEVPQKPR 268 Score = 29.9 bits (64), Expect = 2.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 495 PPPXPXXXXPPPPPXP 542 PPP P PPPPP P Sbjct: 296 PPPSPPPPPPPPPPQP 311 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPP 937 P PP PP PP P P PPP Sbjct: 241 PSSPPQQPPATPP--PPPPPPP 260 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P PP PPPPPP P Sbjct: 244 PPQQPPATPPPPPPPPP 260 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPP 937 P PPP PPP PP PP Sbjct: 297 PPSPPPPPPPPPPQPLIAATPP 318 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXP 931 P+ PP PPP PP P P Sbjct: 245 PQQPPATPPPPPPPPPVEVP 264 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P PP PPPPPP P Sbjct: 248 PPATPPPPPPPPPVEVP 264 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 152 PPPXWXPPXXPPPPP 196 PPP PP PPPPP Sbjct: 381 PPPSPPPPPPPPPPP 395 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXP 223 PPP PP PPPPP P P Sbjct: 296 PPPS--PPPPPPPPPPQPLIAATP 317 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 498 PPXPXXXXPPPPPXPPXXPXPXXVR 572 PP PPP P PP P P +R Sbjct: 373 PPQYQSLIPPPSPPPPPPPPPPPLR 397 Score = 26.6 bits (56), Expect(2) = 1.2 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 813 PLXXXPXPPPPPPP 854 P P PPPPPPP Sbjct: 382 PPSPPPPPPPPPPP 395 Score = 23.8 bits (49), Expect(2) = 9.4 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPP 503 PP P +P PPPPP Sbjct: 373 PPQYQSLIPPPSPPPPPPPPPP 394 Score = 23.0 bits (47), Expect(2) = 1.2 Identities = 9/26 (34%), Positives = 10/26 (38%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPP 911 PPPPPP + P PP Sbjct: 424 PPPPPPRYTQFDPQTPPRRVKSGRPP 449 Score = 22.6 bits (46), Expect(2) = 9.4 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPP 536 PPPPP P PP Sbjct: 425 PPPPPRYTQFDPQTPP 440 >At5g56140.1 68418.m07003 KH domain-containing protein Length = 315 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGG 488 GG GGGGG G GGGGG Sbjct: 8 GGGGGGGGGSGGGIGGGGG 26 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGG 883 G GGG G G GG GGG GG Sbjct: 8 GGGGGGGGGSGGGIGGGGGG 27 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -1 Query: 936 GGGXGXGXXGGXGGGXGGGXRG 871 GGG G G GG GGG GGG G Sbjct: 8 GGGGGGG--GGSGGGIGGGGGG 27 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGG 491 GG GGGG G GGGG Sbjct: 10 GGGGGGGSGGGIGGGGGG 27 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = +2 Query: 872 PRXPPPXP----PPXPPXXPXPXPPPXPXXGXAPPP 967 P+ PPP P PP P PPP P +PPP Sbjct: 32 PQSPPPQPYVYSPPLPSPYVYKSPPPSPYLYSSPPP 67 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPPP P P PP PP PPP Sbjct: 75 PPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTYIYNSPPP 118 Score = 32.7 bits (71), Expect = 0.40 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 828 PXPP-----PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP PPPPP P P PP PR P PPP Sbjct: 177 PPPPYVYNSPPPPPYVYESVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSPPP 228 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 840 PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPP P P PP PR P PPP Sbjct: 206 PPPPPYVYNSAPRIPFIYSSPPPPPYVYNSAPRVPFIYSSPPP 248 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPPP R PP PP PP PPP Sbjct: 75 PPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTYIYNSPPPP 119 Score = 31.9 bits (69), Expect = 0.71 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 840 PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPP P P PP PR P PPP Sbjct: 226 PPPPPYVYNSAPRVPFIYSSPPPPPYVYKSVPRIPFIYSSPPP 268 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +3 Query: 840 PPPPPXXXXXXRAXP-XXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPP P P PP PP PPR P PPP Sbjct: 55 PPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPP 98 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PP P PPPPP P P Sbjct: 68 PPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPP 108 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPP 536 P +P PPPP PPPPP Sbjct: 56 PPSPYLYSSPPPPPYVYNSPPPPP 79 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 4/26 (15%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPP----XPPXXP 554 PPPPP PPPPP PP P Sbjct: 65 PPPPPYVYNSPPPPPPYIYNSPPRPP 90 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPP 536 P P PPPP PPPPP Sbjct: 97 PPPPFVYSSPPPPTYIYNSPPPPP 120 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 843 PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPP P P PP PR P PPP Sbjct: 287 PPPPYVYNSAPRVPFIYSSPPPPPYVYNSAPRIPFIYSSPPP 328 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P P PPPP PPPP P P Sbjct: 78 PPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTYIYNSPPP 118 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPP R PP PP PR P PPP Sbjct: 116 PPPPPYVYKSVPRITFIYSSPPPPPYV-YNSAPRIPFIYSSPPP 158 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +3 Query: 840 PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP-RXAXXPPP 968 PPPPP P P PP PR P + PPP Sbjct: 246 PPPPPYVYKSVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSLPPP 289 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 893 PPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P P PPP PPP Sbjct: 55 PPPSPYLYSSPPPPPYVYNSPPPPP 79 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 840 PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPP P P PP PR PPP Sbjct: 136 PPPPPYVYNSAPRIPFIYSSPPPPPYVYNSAPRVLFIYSSPPP 178 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 840 PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PPPPP P PP PR P PPP Sbjct: 266 PPPPPYVYNSAPRIPFIYSSLPPPPYVYNSAPRVPFIYSSPPP 308 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP 536 PP P PPPP PPPPP Sbjct: 158 PPPYVYNSAPRVLFIYSSPPPPPYVYNSPPPPP 190 >At3g46740.1 68416.m05074 chloroplast outer envelope protein, putative similar to chloroplastic outer envelope membrane protein (OEP75) [Pisum sativum] GI:633607; contains Pfam profile PF01103: outer membrane protein, OMP85 family Length = 818 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 936 GGGXGXGXXGGXGGGXGGG 880 GGG G G GG GGG GGG Sbjct: 103 GGGGGDGNFGGFGGGGGGG 121 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 P P P PP P R+ P P PP P PR P PP+ Sbjct: 80 PSPSAPITPSPPSPTTPSNPRSPPS--PNQGPPNTPSGSTPRTPSNTKPSPPS 130 Score = 32.7 bits (71), Expect = 0.40 Identities = 19/65 (29%), Positives = 21/65 (32%), Gaps = 5/65 (7%) Frame = +3 Query: 792 AGGXGXXPLXXXPXPPP-----PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAX 956 A G P P PP PPP PPP P PP +P Sbjct: 4 APSPGTTPSPSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPS 63 Query: 957 XPPPA 971 PPP+ Sbjct: 64 LPPPS 68 Score = 32.3 bits (70), Expect = 0.53 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +3 Query: 441 PXXXGXGXPXTPXXXGPPPPPXPXXXXPPPP-PXPPXXPXP 560 P P T PPP P PPP P PP P P Sbjct: 27 PPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPP 67 Score = 32.3 bits (70), Expect = 0.53 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPP 937 PP PP PP P P PPP Sbjct: 217 PPPKPPSPPRKPPPPPPP 234 Score = 32.3 bits (70), Expect = 0.53 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXP 542 PP PP P PPPPP P Sbjct: 218 PPKPPSPPRKPPPPPPPP 235 Score = 31.9 bits (69), Expect = 0.71 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPP 545 PPP P PPPPP PP Sbjct: 217 PPPKPPSPPRKPPPPPPPP 235 Score = 31.5 bits (68), Expect = 0.93 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPP 937 PPP PP P P P PPP Sbjct: 217 PPPKPPSPPRKPPPPPPPP 235 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/66 (25%), Positives = 18/66 (27%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRX 950 P P P PPP P + PPP P P PP P Sbjct: 13 PSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGS 72 Query: 951 AXXPPP 968 P P Sbjct: 73 LTPPLP 78 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/65 (27%), Positives = 18/65 (27%) Frame = +3 Query: 771 PRXXRPXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRX 950 P P P P PP PPP P P P P P P P Sbjct: 40 PSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSL-TPPLPQPSPSAPITPSPPSPTTPSN 98 Query: 951 AXXPP 965 PP Sbjct: 99 PRSPP 103 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/46 (28%), Positives = 16/46 (34%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 P PP P P P P P PP + PPP++ Sbjct: 13 PSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSS 58 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 893 PPPXPPXXPXPXPPPXP 943 PPP PP P PPP P Sbjct: 217 PPPKPPSPPRKPPPPPP 233 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P +P PPP PPP PP P Sbjct: 35 PPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTP 75 >At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 202 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 RGGG G G G G GG GG GGG Sbjct: 6 RGGGGFRGRGGRDGGGGGRFGGGGGRFGGG 35 Score = 30.7 bits (66), Expect = 1.6 Identities = 21/59 (35%), Positives = 22/59 (37%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXPXPPA 791 GGG RG R G G GG GG G GG GGG G PP+ Sbjct: 7 GGGGFRGRGGRDGGGGGRFGGGGGRFGGG---------GGRFGGGGGRFGGFRDEGPPS 56 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXG--GGXR 874 R GG G GGG G G GGG G GG R Sbjct: 17 RDGGGGGRFGGGGGRFGGGGGRFGGGGGRFGGFR 50 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P P PPP P PPP P P PP P PP Sbjct: 445 PTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPP 495 Score = 32.7 bits (71), Expect = 0.40 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 5/59 (8%) Frame = +3 Query: 804 GXXPLXXXPXPP---PP--PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 G P P PP PP PPP + P PP P P PP P PP Sbjct: 50 GAPPSYTTPPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPP 108 Score = 32.7 bits (71), Expect = 0.40 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P P PPP P PPP P P PP P PP Sbjct: 311 PTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPP 361 Score = 32.7 bits (71), Expect = 0.40 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P P PPP P PPP P P PP P PP Sbjct: 495 PTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPP 545 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPP--PPXXPXXXPXPXGG 232 PP P P+ P P + PP PPP P P P GG Sbjct: 697 PPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSPPQGG 743 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPP-XPPXXPXXXPPRAPRXAXXPP 965 PP PPP P PPP P P PP P PP Sbjct: 468 PPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPP 512 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPX-PPXXPXXXPPRAPRXAXXPP 965 PP PPP P PPP P P PP P PP Sbjct: 518 PPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPP 562 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPX-PPXXPXXXPPRAPRXAXXPP 965 PP PPP P PPP P P PP P PP Sbjct: 334 PPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPP 378 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 5/57 (8%) Frame = +1 Query: 814 PXXXPPXP---PP--PPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 P PP P PP PPP P P TP P GG PPP Sbjct: 693 PVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSPPQGGYGTPPP 749 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/41 (34%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPP-PPXXPXXXP 217 PP P P+ P P + PP PPP P P P Sbjct: 444 PPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSP 484 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPP--PPXXPXXXP 217 PP P P+ P P + PP PPP P P P Sbjct: 544 PPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSP 585 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPP--PPXXPXXXP 217 PP P P+ P P + PP PPP P P P Sbjct: 191 PPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSP 232 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPP--PPXXPXXXP 217 PP P P+ P P + PP PPP P P P Sbjct: 208 PPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSP 249 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXP 205 PP P P+ P P + PP PPP P Sbjct: 242 PPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPP 277 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/41 (34%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPP-PPXXPXXXP 217 PP P P+ P P + PP PPP P P P Sbjct: 310 PPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSP 350 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/41 (34%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPP-PPXXPXXXP 217 PP P P+ P P + PP PPP P P P Sbjct: 494 PPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSP 534 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPP--PPXXPXXXP 217 PP P P+ P P + PP PPP P P P Sbjct: 527 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSP 568 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPP--PPXXPXXXP 217 PP P P+ P P + PP PPP P P P Sbjct: 561 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSP 602 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPP--PPXXPXXXP 217 PP P P+ P P + PP PPP P P P Sbjct: 578 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSP 619 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPP--PPXXPXXXP 217 PP P P+ P P + PP PPP P P P Sbjct: 595 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSP 636 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPP--PPXXPXXXP 217 PP P P+ P P + PP PPP P P P Sbjct: 612 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSP 653 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXP 205 PP P P+ P P + PP PPP P Sbjct: 629 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPP 664 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PP PP P P P P G PP Sbjct: 717 PTYSPPIKPPPVQVPPTPTTPSPPQGGYGTPP 748 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPP--PPXXPXXXP 217 PP P P+ P P + PP PPP P P P Sbjct: 90 PPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSP 131 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPP--PPXXPXXXP 217 PP P P+ P P + PP PPP P P P Sbjct: 107 PPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSP 148 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXP 205 PP P P+ P P + PP PPP P Sbjct: 124 PPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPP 159 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P P PPP P PP P P PP P PP Sbjct: 159 PTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPP 209 Score = 29.1 bits (62), Expect = 5.0 Identities = 17/53 (32%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +3 Query: 813 PLXXXPXPPPP--PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P+ P PPP PP + P PP P P PP P PP Sbjct: 194 PIYSPPIKPPPVHKPPTPIY---SPPIKPPPVHKPPTPTYSPPVKPPPVHKPP 243 Score = 29.1 bits (62), Expect = 5.0 Identities = 17/53 (32%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +3 Query: 813 PLXXXPXPPPP--PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P+ P PPP PP + P PP P P PP P PP Sbjct: 211 PIYSPPIKPPPVHKPPTPTY---SPPVKPPPVHKPPTPIYSPPIKPPPVHKPP 260 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPP--PPXXPXXXP 217 PP P P+ P P + PP PPP P P P Sbjct: 225 PPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSP 266 Score = 29.1 bits (62), Expect = 5.0 Identities = 17/53 (32%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +3 Query: 813 PLXXXPXPPPP--PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P+ P PPP PP + P PP P P PP P PP Sbjct: 245 PIYSPPIKPPPVHKPPTPIY---SPPVKPPPVQTPPTPIYSPPVKPPPVHKPP 294 Score = 29.1 bits (62), Expect = 5.0 Identities = 17/53 (32%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +3 Query: 813 PLXXXPXPPPP--PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P+ P PPP PP + P PP P P PP P PP Sbjct: 279 PIYSPPVKPPPVHKPPTPTY---SPPVKSPPVQKPPTPTYSPPIKPPPVQKPP 328 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPP--PPXXPXXXP 217 PP P P+ P P + PP PPP P P P Sbjct: 343 PPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSP 384 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPP--PPXXPXXXP 217 PP P P+ P P + PP PPP P P P Sbjct: 360 PPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSP 401 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPP--PPXXPXXXP 217 PP P P+ P P + PP PPP P P P Sbjct: 427 PPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSP 468 Score = 29.1 bits (62), Expect = 5.0 Identities = 39/181 (21%), Positives = 42/181 (23%), Gaps = 5/181 (2%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVR-FXXXGGGXRPXXXX 614 PP P TP PP P P P P PP P P +P Sbjct: 468 PPIKPPPVKPPTPTY-SPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVK 526 Query: 615 XXTXXXXXXXRAXGAXG--AXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRP 788 T + P P P P P P Sbjct: 527 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPP 586 Query: 789 XAGGXGXXPLXXXPXPPPPPPPXXXXXXR--AXPXXXPPPXPPXXPXXXPPRAPRXAXXP 962 P PP PPP + P PP P P PP P P Sbjct: 587 IKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKP 646 Query: 963 P 965 P Sbjct: 647 P 647 Score = 29.1 bits (62), Expect = 5.0 Identities = 37/172 (21%), Positives = 39/172 (22%), Gaps = 5/172 (2%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRPXXXXXXTXXXXXXX 644 P TP PP P P P P PP P P +P Sbjct: 494 PPTPTY-SPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPP 552 Query: 645 RAXGAXGAXGXPG---PXGXPXXXXPXGGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXP 815 P P P P P P P P Sbjct: 553 IKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKP 612 Query: 816 LXXXPXPPPPPPPXXXXXXR--AXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 PP PPP + P PP P P PP P PP Sbjct: 613 PTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPP 664 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P PPP + P PP P P PP P PP Sbjct: 232 PPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPP 277 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/53 (32%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +3 Query: 813 PLXXXPXPPPP--PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P+ P PPP PP + P PP P P PP P PP Sbjct: 346 PIYSPPVKPPPVHKPPTPIY---SPPVKPPPVHKPPTPIYSPPVKPPPIQKPP 395 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPP--PPXXPXXXP 217 PP P P+ P P + PP PPP P P P Sbjct: 377 PPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSP 418 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 5/56 (8%) Frame = +3 Query: 813 PLXXXPXP---PP--PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P+ P P PP PPP P PP P P PP P PP Sbjct: 390 PIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPP 445 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/54 (31%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = +3 Query: 813 PLXXXPXPPPP--PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P+ P PPP PP + P PP P P PP P P P Sbjct: 430 PIYSPPVKPPPVHKPPTPIY---SPPVKPPPVHKPPTPTYSPPIKPPPVKPPTP 480 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXP 205 PP P P+ P P + PP PPP P Sbjct: 646 PPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPP 681 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P PPP + P PP P P PP P PP Sbjct: 670 PPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPP 715 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P PPP + P PP P P PP P PP Sbjct: 687 PPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPP 732 Score = 28.3 bits (60), Expect = 8.7 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 6/57 (10%) Frame = +3 Query: 813 PLXXXPXP---PP--PPPPXXXXXXRAXPXXXPPPXP-PXXPXXXPPRAPRXAXXPP 965 P+ P P PP PPP P PPP P P PP P PP Sbjct: 103 PIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPP 159 Score = 28.3 bits (60), Expect = 8.7 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 6/57 (10%) Frame = +3 Query: 813 PLXXXPXP---PP--PPPPXXXXXXRAXPXXXPPPXP-PXXPXXXPPRAPRXAXXPP 965 P+ P P PP PPP P PPP P P PP P PP Sbjct: 120 PIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPP 176 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPP--PPXXPXXXP 217 PP P P+ P P + PP PPP P P P Sbjct: 141 PPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSP 182 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P TP PP P P P P PP P P Sbjct: 182 PPIKPPVHKPPTPIY-SPPIKPPPVHKPPTPIYSPPIKPPP 221 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPP--PPXXPXXXP 217 PP P P+ P P + PP PPP P P P Sbjct: 259 PPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSP 300 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXP 205 PP P P+ P P + PP PPP P Sbjct: 293 PPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPP 328 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P TP PP P P P P PP P P Sbjct: 334 PPIKPPPVKPPTPIY-SPPVKPPPVHKPPTPIYSPPVKPPP 373 Score = 28.3 bits (60), Expect = 8.7 Identities = 17/53 (32%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +3 Query: 813 PLXXXPXPPPP--PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P+ P PPP PP + P PP P P PP P PP Sbjct: 363 PIYSPPVKPPPVHKPPTPIY---SPPVKPPPIQKPPTPTYSPPIKPPPLQKPP 412 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 PP P TP PP P P P P PP P P Sbjct: 418 PPIKLPPVKPPTPIY-SPPVKPPPVHKPPTPIYSPPVKPPP 457 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPP--PPXXPXXXP 217 PP P P+ P P + PP PPP P P P Sbjct: 477 PPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSP 518 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/47 (29%), Positives = 15/47 (31%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PPP + P PP P P PP P P P Sbjct: 484 PPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTP 530 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P PPP + P PP P P PP P PP Sbjct: 636 PPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPP 681 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/52 (30%), Positives = 16/52 (30%), Gaps = 1/52 (1%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXP-PXXPXXXPPRAPRXAXXPP 965 P P PPP P PPP P P PP P PP Sbjct: 647 PTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPP 698 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXP 205 PP P P+ P P + PP PPP P Sbjct: 663 PPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPP 698 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 P TP PP P P P P PP P P V Sbjct: 663 PPTPTY-SPPVKPPPVQLPPTPTYSPPVKPPPVQV 696 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPPXXP 205 PP P P+ P P + PP PPP P Sbjct: 680 PPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPP 715 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 P TP PP P P P P PP P P V Sbjct: 680 PPTPTY-SPPVKPPPVQVPPTPTYSPPVKPPPVQV 713 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 P TP PP P P P P PP P P V Sbjct: 697 PPTPTY-SPPVKPPPVQVPPTPTYSPPIKPPPVQV 730 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G GGG G G G GG GGG G Sbjct: 86 GGGGGHYGGGGGHGGGGHYGGGGHHGGGGHG 116 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = -3 Query: 559 GXGXXGGXG--GGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 G G GG G GGGG G GGGG G G GG Sbjct: 46 GHGGHGGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGG 88 Score = 32.3 bits (70), Expect = 0.53 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G GGG G GG G GGG G Sbjct: 68 GGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHG 99 Score = 31.5 bits (68), Expect = 0.93 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G GG G G GGG GGGG GG G G Sbjct: 57 GGGGHGHGGHNGGGGHGLDG-YGGGHGGHYGGGGGHYGGGGGHGGGGHYGGG 107 Score = 31.5 bits (68), Expect = 0.93 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGG---GGGXG 827 GGG G GG G GG GG G GGGG GGG G Sbjct: 68 GGGGHGLDGY-GGGHGGHYGGGGGHYGGGGGHGGGGHYGGGGHHGGGGHG 116 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G G G GGGGG G G GGG G Sbjct: 78 GGGHGGHYGGGGGHYGGGGGHGGGGHYGG 106 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXP 452 G G GGGGG G GGGG G G P Sbjct: 87 GGGGHYGGGGGHGGGGHYGGGGHHGGGGHGLNEP 120 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 228 PXGXGXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 P G G GGGG GG GG G G G GG Sbjct: 40 PEGYHGGHGGHGGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGG 83 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 216 GXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G GGGGG GG GGG G Sbjct: 86 GGGGGHYGGGGGHGGGGHYGGGGHHGG 112 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G GG GGGG G GGG G G G Sbjct: 59 GGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGG 90 >At1g61750.1 68414.m06964 expressed protein contains Pfam profile: PF01657 domain of unknown function Length = 352 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPP 545 PPPPP P PPPPP PP Sbjct: 247 PPPPPPP----PPPPPPPP 261 Score = 31.5 bits (68), Expect = 0.93 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 893 PPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP PP P P PPP G P Sbjct: 247 PPPPPPPPPPPPPPPQRLYGENDTP 271 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 826 PPXPPPPPPPXXP 864 PP PPPPPPP P Sbjct: 247 PPPPPPPPPPPPP 259 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 826 PPXPPPPPPPXXP 864 PP PPPPPPP P Sbjct: 248 PPPPPPPPPPPPP 260 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 826 PPXPPPPPPPXXP 864 PP PPPPPPP P Sbjct: 249 PPPPPPPPPPPPP 261 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 143 FXXPPPXWXPPXXPPPPP 196 F PPP PP PPPPP Sbjct: 244 FLAPPPPPPPPPPPPPPP 261 Score = 30.7 bits (66), Expect = 1.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 814 PXXXPPXPPPPPPP 855 P PP PPPPPPP Sbjct: 247 PPPPPPPPPPPPPP 260 Score = 30.7 bits (66), Expect = 1.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 814 PXXXPPXPPPPPPP 855 P PP PPPPPPP Sbjct: 248 PPPPPPPPPPPPPP 261 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 522 PPPPPXPPXXPXPXXVR 572 PPPPP PP P P R Sbjct: 247 PPPPPPPPPPPPPPPQR 263 Score = 24.6 bits (51), Expect(2) = 2.1 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -1 Query: 456 APXXXGGXXPPPPPPP 409 AP PPPPPPP Sbjct: 246 APPPPPPPPPPPPPPP 261 Score = 24.2 bits (50), Expect(2) = 2.1 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 429 PPPPPPPXXXL 397 PPPPPPP L Sbjct: 254 PPPPPPPPQRL 264 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGGXRG 871 G GGG G GG GGG GG RG Sbjct: 116 GGGGGGGFARRGGYGGGRGGYARG 139 Score = 32.7 bits (71), Expect = 0.40 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXG-GGXGGGXRG 871 GGG G GGG G GG G GG GGG G Sbjct: 120 GGGFARRGGYGGGRGGYARGGFGRGGFGGGGYG 152 >At5g66960.1 68418.m08442 prolyl oligopeptidase family protein similar to OpdB [Treponema denticola] GI:13786054; contains Pfam profiles PF00326: prolyl oligopeptidase family, PF02897: Prolyl oligopeptidase, N-terminal beta-propeller domain Length = 792 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXP 943 PP PPP PP P PP P Sbjct: 26 PPKSPPPPPPPPALPKPPKKP 46 Score = 25.8 bits (54), Expect(2) = 0.31 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 826 PPXPPPPPPP 855 PP PPPPPP Sbjct: 26 PPKSPPPPPP 35 Score = 25.8 bits (54), Expect(2) = 0.31 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 835 PPPPPPPXXP 864 PPPPPPP P Sbjct: 31 PPPPPPPALP 40 >At5g64430.1 68418.m08093 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 513 Score = 32.7 bits (71), Expect = 0.40 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 396 TXXXXGGGGGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPP 533 T G G P G G P P P P P P PPPP Sbjct: 314 TTFWQGNHNPGVVFPTTTHGLGLPEQPVYMIPSPSPSPVYHAPPPP 359 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 32.7 bits (71), Expect = 0.40 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 4/31 (12%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXP----PPPPXPP 545 P +P PPPP P P PPPP PP Sbjct: 42 PCSPVQSSPPPPSPPPPSTPTTACPPPPSPP 72 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 5/66 (7%) Frame = +3 Query: 411 GGGGGGGXXPPXXXGXGXPXTPXXXGPP-----PPPXPXXXXPPPPPXPPXXPXPXXVRF 575 GGG PP G G P G PPP PPPP P P Sbjct: 75 GGGSSYYYPPPSQSGGGSKYPPPYGGGGQGYYYPPPYSGNYPTPPPPNPIVPYFPFYYHT 134 Query: 576 XXXGGG 593 G G Sbjct: 135 PPPGSG 140 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 5/34 (14%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXA-----PPP 967 PP PPP P P PP P G PPP Sbjct: 52 PPSPPPPSTPTTACPPPPSPPSSGGGSSYYYPPP 85 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPP 911 P+ P PP PPPP A P PPP PP Sbjct: 45 PVQSSPPPPSPPPP--STPTTACP---PPPSPP 72 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 32.7 bits (71), Expect = 0.40 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +3 Query: 465 PXTPXXXGPPPPP--XPXXXXPPPPPXPP 545 P P PPPPP P PPPPP P Sbjct: 67 PPPPPIYSPPPPPIYPPPIYSPPPPPIYP 95 Score = 32.3 bits (70), Expect = 0.53 Identities = 19/52 (36%), Positives = 20/52 (38%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P PPPPP + P PPP PP PP P PPP Sbjct: 45 PPYRSPVTIPPPPPVY-----SRPVAFPPP-PPIYSPPPPPIYPPPIYSPPP 90 Score = 32.3 bits (70), Expect = 0.53 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +3 Query: 465 PXTPXXXGPPPP--PXPXXXXPPPPPXPPXXPXP 560 P P PPPP P P PPPP PP P Sbjct: 68 PPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSP 101 Score = 32.3 bits (70), Expect = 0.53 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPP-XPXXGXAPPP 967 P PP PP PP P PPP P +PPP Sbjct: 71 PIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPP 103 Score = 32.3 bits (70), Expect = 0.53 Identities = 17/36 (47%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = +2 Query: 872 PRXPPPX-PPPXPPXXPXP--XPPPXPXXGXAPPPR 970 P PPP PP PP P P PPP P +PPP+ Sbjct: 79 PIYPPPIYSPPPPPIYPPPIYSPPPTP---ISPPPK 111 Score = 31.5 bits (68), Expect = 0.93 Identities = 19/54 (35%), Positives = 22/54 (40%), Gaps = 7/54 (12%) Frame = +3 Query: 813 PLXXXPXPP---PPPPPXXXXXXRA--XPXXXPPP--XPPXXPXXXPPRAPRXA 953 P+ P PP PPPPP + P PPP PP P PP+ A Sbjct: 63 PVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISPPPKVHHPA 116 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXP--XPPPXPXXGXAPPP 967 P PP PP PP P P PPP P PPP Sbjct: 67 PPPPPIYSPPPPPIYPPPIYSPPPPPIY---PPP 97 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +2 Query: 875 RXPPPXPPPXPPXX-PXPXPPPXPXXGXAPPP 967 R P PPP P P PPP P PPP Sbjct: 48 RSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPP 79 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 3/44 (6%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPP---PPPXPXXXXPPPPPXPPXXPXP 560 PP P P P PPP P PPPP PP P Sbjct: 45 PPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSP 88 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = +2 Query: 107 PXPXXXFXXXPLFXXPPPXWXPPXXP--PPP---PXXPXXXPXP 223 P P + F PPP + PP P PPP P P P P Sbjct: 54 PPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPP 97 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 7/31 (22%) Frame = +3 Query: 489 PPPPPX----PXXXXPPP---PPXPPXXPXP 560 PPPPP P PPP PP PP P P Sbjct: 67 PPPPPIYSPPPPPIYPPPIYSPPPPPIYPPP 97 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/39 (35%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +2 Query: 107 PXPXXXFXXXPLFXXPPPXWXPPXXP--PPPPXXPXXXP 217 P P + P PPP + PP P PPP P P Sbjct: 67 PPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTP 105 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 5/41 (12%) Frame = +2 Query: 98 PPXPX---PXXXFXXXPLFXXPPPXWXPP--XXPPPPPXXP 205 PP P P P++ PPP PP PPP P P Sbjct: 68 PPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISP 108 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Frame = +2 Query: 137 PLFXXPPPXWXPP-XXPPPPP--XXPXXXPXP 223 P++ PPP + P PPPPP P P P Sbjct: 38 PIYSPPPPPYRSPVTIPPPPPVYSRPVAFPPP 69 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPP 196 PP P + P PPP + PP P PP Sbjct: 77 PPPIYPPPIYSPPPPPIYPPPIYSPPPTPISPP 109 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 474 PXXXGPPPPP--XPXXXXPPPPPXPP 545 P PPPPP P PPP P P Sbjct: 83 PPIYSPPPPPIYPPPIYSPPPTPISP 108 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 32.7 bits (71), Expect = 0.40 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PP PP PP P P PP G P P Sbjct: 343 PIVNPPSLPPPPPSFPVPLPPVPGLPGIPPVP 374 Score = 31.5 bits (68), Expect = 0.93 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +2 Query: 137 PLFXXPP-PXWXPPXXPPPPPXXPXXXPXPXG 229 PL PP P PP PPPPP P P G Sbjct: 335 PLPVLPPVPIVNPPSLPPPPPSFPVPLPPVPG 366 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 P PP P P PP P PP P PP Sbjct: 351 PPPPPSFPVPLPPVPGLPGIPPVPLIPGIPP 381 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P PP P P P PP P P PP P PP Sbjct: 317 PTPPTPTLPPIPTIPTLPPLPVLPPVPIVNPPSLPPPPPSFPVPLPP 363 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 4/36 (11%) Frame = +2 Query: 872 PRXPP----PXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PP P PP PP P PP P P P Sbjct: 284 PTLPPNPLIPSPPSLPPIPLIPTPPTLPTIPLLPTP 319 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +1 Query: 829 PXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXPXGGPXXPPP 969 P PP P P P PP PP P P PP Sbjct: 317 PTPPTPTLPPIPTIPTLPPLPVLPPVPIVNPPSLPPPPPSFPVPLPP 363 >At5g10550.1 68418.m01221 DNA-binding bromodomain-containing protein low similarity to kinase [Gallus gallus] GI:1370092; contains Pfam profile PF00439: Bromodomain Length = 678 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXP 554 P PPP P PPPPP PP P Sbjct: 421 PSPPPSPVQ--PPPPPSPPPQP 440 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PPPP P PPP P P P Sbjct: 410 PPPPVIEITRDPSPPPSPVQPPPP 433 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 875 RXPPPXPPPXPPXXPXPXPPPXP 943 R P P P P P P P PPP P Sbjct: 419 RDPSPPPSPVQPPPP-PSPPPQP 440 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G G G G GG GG GGG G Sbjct: 73 GGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 104 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXG 466 G G G G GGG G GGG G G G Sbjct: 72 GGGGGRGYGGGGRREGGGYGGGDGGSYGGGG 102 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G GGG G GG GGG GG G Sbjct: 71 GGGGGGRGYGGG-GRREGGGYGGGDGGSYGG 100 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 919 GXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 G GG GG G R GGG GG G G Sbjct: 69 GSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 104 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G G GGGG G GGG G G G Sbjct: 72 GGGGGRGYGGGGRREGGGYGGGDGGSYGGGGG 103 >At4g29240.1 68417.m04182 leucine-rich repeat family protein / extensin family protein contains Pfam PF00560: Leucine Rich Repeat domains; similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana] Length = 415 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGG 883 G GGG G G GG GGG GG Sbjct: 31 GVGGGVGVGIGGGGGGGGGG 50 Score = 31.9 bits (69), Expect = 0.71 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGGXXXXG 136 G G G GGGGG GG GGG G Sbjct: 33 GGGVGVGIGGGGGGGGGGVWVGGGYNNGG 61 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXR 874 GGG G GGG G G GG GG R Sbjct: 33 GGGVGVGIGGGGGGGGGGVWVGGGYNNGGNR 63 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 32.7 bits (71), Expect = 0.40 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 420 GGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 GGG PP TP PPP P PP P PP P Sbjct: 44 GGGSSVPPPVMSPMPMMTPPPMPMTPPPMP-MTPPPMPMAPPPMP 87 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P P P P P P PPP Sbjct: 50 PPPVMSPMPMMTPPPMPMTPPPMPMTPPP 78 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +2 Query: 881 PPPXP--PPXPPXXPXPXPPPXPXXGXAPPP 967 PPP P PP P P P P P A PP Sbjct: 62 PPPMPMTPPPMPMTPPPMPMAPPPMPMASPP 92 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 6/52 (11%) Frame = +3 Query: 423 GGGXXPPXXXGXGXPXTPXXXGPPP--PPXPXXXXPPP----PPXPPXXPXP 560 G PP G G P P P P P PPP PP P P P Sbjct: 34 GSMSMPPMSSGGGSSVPPPVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPPP 85 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PP P P P P P APPP Sbjct: 58 PMMTPPPMPMTPPPMPMTPPPMPMAPPP 85 Score = 28.3 bits (60), Expect = 8.7 Identities = 17/59 (28%), Positives = 17/59 (28%), Gaps = 2/59 (3%) Frame = +2 Query: 794 GGGGXXPPXXXXXXXXXXXXXXXXXXPRXP--PPXPPPXPPXXPXPXPPPXPXXGXAPP 964 GGG PP P P PP P PP P PP P P Sbjct: 44 GGGSSVPPPVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTPSTSP 102 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +2 Query: 98 PPXPXPXXXFXXXPLFXXPPPX-WXPPXXPPPPPXXPXXXP 217 PP P P+ PPP PP P PP P P Sbjct: 51 PPVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMPMASP 91 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXP 554 P TP PPP P P P PP P Sbjct: 66 PMTPPPMPMTPPPMPMAPPPMPMASPPMMP 95 >At3g43583.1 68416.m04636 hypothetical protein Length = 100 Score = 32.7 bits (71), Expect = 0.40 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAP 961 PP PP P P P PPP P +P Sbjct: 22 PPEKPPSPEPPPSPEPPPSPEKPTSP 47 Score = 32.7 bits (71), Expect = 0.40 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +2 Query: 872 PRXPP-PXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PP P PPP P P P P P +P P Sbjct: 23 PEKPPSPEPPPSPEPPPSPEKPTSPEQPSSPEP 55 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P P P PP P P PPP Sbjct: 26 PPSPEPPPSPEPPPSPEKPTSPEQPSSPEPPP 57 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 495 PPPXPXXXXPPPPPXPPXXP 554 PP P PPP P PP P Sbjct: 22 PPEKPPSPEPPPSPEPPPSP 41 >At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to SP|P52597 Heterogeneous nuclear ribonucleoprotein F (hnRNP F) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 350 Score = 32.7 bits (71), Expect = 0.40 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G GG GGG G G GGGGG G Sbjct: 211 GGGGGLGGGNGSGGGGGGGGGGGRISG 237 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGG 880 G GGG G G G GGG GGG Sbjct: 211 GGGGGLGGGNGSGGGGGGGGG 231 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 936 GGGXGXGXXGGXGGGXGGGXRG 871 GGG G G G GGG GGG G Sbjct: 211 GGGGGLGGGNGSGGGGGGGGGG 232 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 960 GAXPXXGXGGGXGXGXXGGXGGGXGGG 880 G G G G G G GG GGG GGG Sbjct: 207 GMASGGGGGLGGGNGSGGGGGGGGGGG 233 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 931 GXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRGXXP 803 G G GG GGG G GGGGGGG G G P Sbjct: 207 GMASGGGGGLGGGNGSGG--------GGGGGGGGGRISGGSSP 241 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G GG G GGG G GGGGG Sbjct: 207 GMASGGGGGLGGGNGSGGGGGGGG 230 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 552 GXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXR 457 G G G GGG G G GGG G G R Sbjct: 211 GGGGGLGGGNGSGGGGGGGGGGGRISGGSSPR 242 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGGXRG 871 G G G G GG G G GGG G Sbjct: 207 GMASGGGGGLGGGNGSGGGGGGGG 230 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 222 GXGXXXGXXGGGGGXXGGXXXGGG 151 G G G GGGGG GG GG Sbjct: 215 GLGGGNGSGGGGGGGGGGGRISGG 238 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 863 GXXGGGGGGGXGGXXXG 813 G GGGGGGG GG G Sbjct: 221 GSGGGGGGGGGGGRISG 237 >At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 177 Score = 32.7 bits (71), Expect = 0.40 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPXPP 545 P PPPPP P P PP PP Sbjct: 120 PTICPPPPPPYPRQVHPQPPAPPP 143 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 470 HPXXXGPXPPPXPRXXXPXPPPXP 541 +P P PPP PR P PP P Sbjct: 119 NPTICPPPPPPYPRQVHPQPPAPP 142 >At3g02670.1 68416.m00258 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 217 Score = 32.7 bits (71), Expect = 0.40 Identities = 30/108 (27%), Positives = 30/108 (27%), Gaps = 4/108 (3%) Frame = +3 Query: 654 GAXGAXGXPGPXGXPXXXXPX----GGGGGPXXXXXXXXXXXXPRXXRPXAGGXGXXPLX 821 G G G PG G P P GGG P P GG PL Sbjct: 115 GIPGIPGLPGIPGSPGFRLPFPFPSSPGGGSIPGIPGSPGFRLPFPFPPSGGGIPGLPLP 174 Query: 822 XXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P PP P P PP P P R P PP Sbjct: 175 FPPLPPVTIP--------GLPLPFPPLPPVTIPSFPGFRFPPLPFLPP 214 >At2g39750.1 68415.m04881 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 694 Score = 32.7 bits (71), Expect = 0.40 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 492 PPPPXPXXXXPPPPPXP 542 PPPP P PPPPP P Sbjct: 107 PPPPPPPSPSPPPPPGP 123 Score = 32.7 bits (71), Expect = 0.40 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 893 PPPXPPXXPXPXPPPXP 943 PPP PP P P PPP P Sbjct: 107 PPPPPPPSPSPPPPPGP 123 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXP 931 PPP PPP P P P P Sbjct: 107 PPPPPPPSPSPPPPPGP 123 >At2g11005.1 68415.m01177 glycine-rich protein Length = 170 Score = 32.7 bits (71), Expect = 0.40 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 G G G GG G G GGG G G GGG G Sbjct: 11 GSGDGGGSGGGGGSGDGSGSGDGGGSGDGGGSRDSDGSGDSSGGGSG 57 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -3 Query: 574 KRTXXGXGXXGGXGGG-GGXXXXGXGGGGGPXXXG 473 K+ G G GG GGG G G G GGG G Sbjct: 6 KKWWFGSGDGGGSGGGGGSGDGSGSGDGGGSGDGG 40 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/47 (31%), Positives = 17/47 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GGG G+ G G GG G G + GGG G G Sbjct: 15 GGGSGGGGGSGDGSGSGDGGGSGDGGGSRDSDGSGDSSGGGSGDSGG 61 >At1g74720.1 68414.m08658 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1081 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGGP 485 G GGGGG G GGGGGP Sbjct: 609 GEGGGGGGGGGPGGGGGGGP 628 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGG 880 G GGG G G GG GGG GGG Sbjct: 609 GEGGGGGGG--GGPGGGGGGG 627 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 PP PPP P P P PP P P+ PPP Sbjct: 25 PPYPPPHPPVEVEENQPKTSPTPPPPHWMRYPPVLMPQMMYAPPP 69 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 32.7 bits (71), Expect = 0.40 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPP 911 P PPPPPP R P PPP PP Sbjct: 219 PLQPPPPPPPSQPLPR--PLLLPPPPPP 244 Score = 32.3 bits (70), Expect = 0.53 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +2 Query: 872 PRXPPPXPPPXPP-XXPXPXPPPXPXXGXAPP 964 P PPP PPP P P PPP P A P Sbjct: 219 PLQPPPPPPPSQPLPRPLLLPPPPPPSFHAQP 250 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXP 864 P P PPPPPPP P Sbjct: 215 PVLLPLQPPPPPPPSQP 231 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 5/29 (17%) Frame = +3 Query: 489 PPPPPXPXXXXP-----PPPPXPPXXPXP 560 PPPPP P P PPPP P P Sbjct: 222 PPPPPPPSQPLPRPLLLPPPPPPSFHAQP 250 >At2g41260.2 68415.m05096 glycine-rich protein / late embryogenesis abundant protein (M17) identical to late-embryogenesis abundant M17 protein GI:3342551 from [Arabidopsis thaliana] Length = 280 Score = 26.6 bits (56), Expect(2) = 0.44 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -2 Query: 854 GGGGGGGXGGXXXG 813 GGGGGGG GG G Sbjct: 123 GGGGGGGRGGCRWG 136 Score = 26.6 bits (56), Expect(2) = 0.44 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -2 Query: 854 GGGGGGGXGGXXXG 813 GGGGGGG GG G Sbjct: 178 GGGGGGGRGGCRWG 191 Score = 26.6 bits (56), Expect(2) = 0.44 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -2 Query: 854 GGGGGGGXGGXXXG 813 GGGGGGG GG G Sbjct: 233 GGGGGGGRGGCRWG 246 Score = 24.6 bits (51), Expect(2) = 0.44 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -2 Query: 863 GXXGGGGGGGXG 828 G GGGGGGG G Sbjct: 118 GGRGGGGGGGGG 129 Score = 24.6 bits (51), Expect(2) = 0.44 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -2 Query: 863 GXXGGGGGGGXG 828 G GGGGGGG G Sbjct: 173 GGRGGGGGGGGG 184 Score = 24.6 bits (51), Expect(2) = 0.44 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -2 Query: 863 GXXGGGGGGGXG 828 G GGGGGGG G Sbjct: 228 GGRGGGGGGGGG 239 >At5g52440.1 68418.m06507 HCF106 protein identical to HCF106 [Arabidopsis thaliana] GI:4894914; contains Pfam profile PF02416: mttA/Hcf106 family Length = 260 Score = 25.8 bits (54), Expect(2) = 0.44 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 835 PPPPPPPXXP 864 PPPPPPP P Sbjct: 168 PPPPPPPSVP 177 Score = 25.4 bits (53), Expect(2) = 0.44 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 826 PPXPPPPPPP 855 P PPPPPPP Sbjct: 164 PVQPPPPPPP 173 >At2g41260.1 68415.m05095 glycine-rich protein / late embryogenesis abundant protein (M17) identical to late-embryogenesis abundant M17 protein GI:3342551 from [Arabidopsis thaliana] Length = 225 Score = 26.6 bits (56), Expect(2) = 0.45 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -2 Query: 854 GGGGGGGXGGXXXG 813 GGGGGGG GG G Sbjct: 178 GGGGGGGRGGCRWG 191 Score = 24.6 bits (51), Expect(2) = 0.45 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -2 Query: 863 GXXGGGGGGGXG 828 G GGGGGGG G Sbjct: 173 GGRGGGGGGGGG 184 >At5g61660.1 68418.m07736 glycine-rich protein Length = 134 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 G G G+ G G G GG G GGGGGG G Sbjct: 72 GSGYGYGSGSGSGTGYGYGSGGGGARGGGYGYGSGNGRSGGGGGGGG 118 Score = 31.9 bits (69), Expect = 0.71 Identities = 16/46 (34%), Positives = 19/46 (41%) Frame = -3 Query: 970 AGGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 +G G + G+ G G GG G G GGGGGGG Sbjct: 73 SGYGYGSGSGSGTGYGYGSGGGGARGGGYGYGSGNGRSGGGGGGGG 118 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 RG G G G G G G G GG GGG Sbjct: 71 RGSGYGYGSGSGSGTGYGYGSGGGGARGGG 100 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG G G G G G GG GGG GG G Sbjct: 92 GGGGARGGGYGYGSGNGRSGGGGGG--GGFNG 121 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 G G G+ G G G GGG G G GGGG G G Sbjct: 70 GRGSGYGYGSGSGSGTGYGYGSGGGGARGGGYGYGSGNGRSGGGGGGGGFNG 121 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 G G G G G G G G G G GGG RG Sbjct: 68 GWGRGSGYGYGSGSGSGTGYGYGSG-GGGARG 98 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G GG G G G G GGGGG Sbjct: 94 GGARGGGYGYGSGNGRSGGGGGGG 117 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 32.3 bits (70), Expect = 0.53 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = +3 Query: 816 LXXXPXPPP---PPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRA-PRXAXXPPPAA 974 L P P P PPP P PPP P PP A P A PP A Sbjct: 20 LAQAPAPTPTATPPPATPPPVATPPPVATPPPAATPAPATPPPAATPAPATTPPSVA 76 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PP PPP P PPP A PP Sbjct: 33 PPATPPPVATPPPVATPPPAATPAPATPP 61 Score = 29.9 bits (64), Expect = 2.8 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 8/56 (14%) Frame = +3 Query: 828 PXPPPP---PPPXXXXXXRAXPXXX-PPPXPPXXPXXXPPR-APRXAXXP---PPA 971 P PPP PPP A P PPP P PP AP A P PPA Sbjct: 34 PATPPPVATPPPVATPPPAATPAPATPPPAATPAPATTPPSVAPSPADVPTASPPA 89 >At5g02600.2 68418.m00195 heavy-metal-associated domain-containing protein low similarity to gi:3168840 copper homeostasis factor; contains Pfam heavy-metal-associated domain PF00403; predicted proteins, Arabidopsis thaliana Length = 319 Score = 32.3 bits (70), Expect = 0.53 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPP 934 PPP PPP PP P PP Sbjct: 225 PPPPPPPSPPQSSPPSPP 242 Score = 29.9 bits (64), Expect = 2.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPP 536 PPPPP P PP PP Sbjct: 227 PPPPPSPPQSSPPSPP 242 >At5g02600.1 68418.m00196 heavy-metal-associated domain-containing protein low similarity to gi:3168840 copper homeostasis factor; contains Pfam heavy-metal-associated domain PF00403; predicted proteins, Arabidopsis thaliana Length = 319 Score = 32.3 bits (70), Expect = 0.53 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPP 934 PPP PPP PP P PP Sbjct: 225 PPPPPPPSPPQSSPPSPP 242 Score = 29.9 bits (64), Expect = 2.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPP 536 PPPPP P PP PP Sbjct: 227 PPPPPSPPQSSPPSPP 242 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 32.3 bits (70), Expect = 0.53 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 1/59 (1%) Frame = +3 Query: 429 GXXPPXXXGXGXPXTPXXXGPP-PPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRP 602 G PP G P P PPP PPPPP P P GG P Sbjct: 187 GMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAP 245 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +2 Query: 437 PPXXXGARXX-PHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 PP G R P P PPP P PPP P P P Sbjct: 199 PPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAP 240 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 733 GPPPPPXGXXXXGXPXGPGXPXAP 662 GPPPPP G P PG P AP Sbjct: 218 GPPPPPHGMQGPPPPR-PGMPPAP 240 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 3/42 (7%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPP---PPPXPPXXP 554 PP G P P PPPP P P PP P P Sbjct: 211 PPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMPP 252 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 417 GGGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 GG PP G P P P PP P PP P PP Sbjct: 213 GGMMRGPPPPPHGMQGPPPPR---PGMPPAPGGFAPPRPGMPP 252 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 875 RXPPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 R PPP PP P P P P G PPR Sbjct: 217 RGPPP-PPHGMQGPPPPRPGMPPAPGGFAPPR 247 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 32.3 bits (70), Expect = 0.53 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 1/59 (1%) Frame = +3 Query: 429 GXXPPXXXGXGXPXTPXXXGPP-PPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGGXRP 602 G PP G P P PPP PPPPP P P GG P Sbjct: 187 GMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAP 245 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +2 Query: 437 PPXXXGARXX-PHPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 PP G R P P PPP P PPP P P P Sbjct: 199 PPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAP 240 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 733 GPPPPPXGXXXXGXPXGPGXPXAP 662 GPPPPP G P PG P AP Sbjct: 218 GPPPPPHGMQGPPPPR-PGMPPAP 240 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 3/42 (7%) Frame = +3 Query: 438 PPXXXGXGXPXTPXXXGPPPPPXPXXXXPP---PPPXPPXXP 554 PP G P P PPPP P P PP P P Sbjct: 211 PPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMPP 252 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 417 GGGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPP 545 GG PP G P P P PP P PP P PP Sbjct: 213 GGMMRGPPPPPHGMQGPPPPR---PGMPPAPGGFAPPRPGMPP 252 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 875 RXPPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 R PPP PP P P P P G PPR Sbjct: 217 RGPPP-PPHGMQGPPPPRPGMPPAPGGFAPPR 247 >At4g14750.1 68417.m02270 calmodulin-binding family protein contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 387 Score = 32.3 bits (70), Expect = 0.53 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 486 GPPPPPXPXXXXPPPPPXPPXXPXP 560 GPPPP PPP PP P P Sbjct: 53 GPPPPACAITLKDSPPPPPPPPPPP 77 Score = 29.1 bits (62), Expect = 5.0 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 826 PPXPPPPPPP 855 PP PPPPPPP Sbjct: 67 PPPPPPPPPP 76 Score = 29.1 bits (62), Expect = 5.0 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 826 PPXPPPPPPP 855 PP PPPPPPP Sbjct: 68 PPPPPPPPPP 77 Score = 29.1 bits (62), Expect = 5.0 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 826 PPXPPPPPPP 855 PP PPPPPPP Sbjct: 69 PPPPPPPPPP 78 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 829 PXPPPPPPPXXP 864 P PPPPPPP P Sbjct: 67 PPPPPPPPPPPP 78 >At3g26400.1 68416.m03292 eukaryotic translation initiation factor 4B, putative/ eIF-4B, putative similar to eukaryotic initiation factor 4B [Arabidopsis thaliana] GI:6739518 Length = 532 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGG 488 G GG GGGG G GGGGG Sbjct: 194 GDGGGFGGGGSGFGGGGGGGGG 215 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGG 880 G GGG G G G GGG GGG Sbjct: 194 GDGGGFGGGGSGFGGGGGGGG 214 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGV 470 G G GGG G G GGGGG G+ Sbjct: 190 GRYSGDGGGFGGGGSGFGGGGGGGGGGL 217 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 32.3 bits (70), Expect = 0.53 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 492 PPPPXPXXXXPPPPPXPP 545 PPPP P P PPP PP Sbjct: 267 PPPPPPGSWQPSPPPPPP 284 Score = 32.3 bits (70), Expect = 0.53 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXP 542 PPPPP PPPPP P Sbjct: 268 PPPPPGSWQPSPPPPPPP 285 Score = 31.5 bits (68), Expect = 0.93 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPP 545 PPPPP PPPP PP Sbjct: 267 PPPPPPGSWQPSPPPPPPP 285 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 887 PXPPPXPPXXPXPXPPPXPXXG 952 P PPP P P PPP P G Sbjct: 267 PPPPPPGSWQPSPPPPPPPVSG 288 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 494 PPPXPRXXXPXPPPXPXP 547 PPP P P PPP P P Sbjct: 268 PPPPPGSWQPSPPPPPPP 285 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 Query: 152 PPPXWXPPXXPPPPP 196 PP W P PPPPP Sbjct: 271 PPGSWQPSPPPPPPP 285 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/43 (30%), Positives = 13/43 (30%) Frame = +1 Query: 814 PXXXPPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXP 942 P P PPPPPPP P PP P Sbjct: 272 PGSWQPSPPPPPPPVSGGMNGNSSDFSSNYSGPHGPSVPPPHP 314 >At3g08640.1 68416.m01003 alphavirus core protein family contains Pfam profile: PF00944 alphavirus core protein Length = 337 Score = 32.3 bits (70), Expect = 0.53 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGG 883 GGG GGG G G GG GG GG Sbjct: 62 GGGGGSTGNNGGGSGSGGGGGGFGGSGG 89 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 957 AXPXXGXGGGXGXGXXGGXGGGXGGG 880 A P G GGG G GG G GGG Sbjct: 56 AKPCAGGGGGGSTGNNGGGSGSGGGG 81 >At2g28440.1 68415.m03455 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; + Length = 268 Score = 32.3 bits (70), Expect = 0.53 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +3 Query: 816 LXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPA 971 L P PPPPPP + P P P P P P P PA Sbjct: 140 LADSPSPPPPPPQPESPSSPSYPEPAPVPAPSDDDSDDDPE-PETEYFPSPA 190 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 887 PXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PPP PP P P P P P Sbjct: 144 PSPPPPPPQPESPSSPSYPEPAPVPAP 170 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 PPPPP P P P P P P Sbjct: 147 PPPPPQPESPSSPSYPEPAPVPAP 170 >At2g04190.1 68415.m00404 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 411 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGA P G GGG G G G GGG G G Sbjct: 70 GGAGPGPGYGGGGGHG-PGYGGGGDGRG 96 Score = 31.5 bits (68), Expect = 0.93 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGG---XGGGXGGGXRG 871 GGG G GGG G G GG G G G G RG Sbjct: 26 GGGGPAFGGRGGGPGRGYGGGPRVHGPGYGIGSRG 60 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGGXXPPPPPP 413 G G GGGGG G GGG G G P G P P P Sbjct: 17 GVGSCVFGGGGGGPAFGGRGGGPGRGYGGGPRVHGPGYGIGSRGPDPGP 65 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 G G P G GGG G G GG G G G G Sbjct: 71 GAGPGPGYGGGGGHGPG-YGGGGDGRGYG 98 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = -1 Query: 594 PPPPXXXNXXXXGXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGGXXPPPP 418 P P G G G G GGG G G G G G G P PP Sbjct: 61 PDPGPGFFFGGAGPGPGYGGGGGHGPGYGGGGDGRGYGSETGGGNHGPEVTRTLRDEPP 119 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXGXGXXRAPXXXGGXXPPPPPP 412 G G GGG G G GGG G G P G P P P Sbjct: 17 GVGSCVFGGGGGGPAFGGRGGGPGRGYGGGPRVHGPGYGIGSRGPDPGP 65 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 G G G GG G G GGG G GGG G G G G Sbjct: 32 GEGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGG 83 Score = 31.9 bits (69), Expect = 0.71 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG GGG G G G G G GGG G Sbjct: 29 GGGGEGKKKNGGGEGGGGEGTSGEGGGGGGDG 60 Score = 31.9 bits (69), Expect = 0.71 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G GG G G G G GGGG G G RG Sbjct: 43 GGGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGGGDGTKGGGRRG 94 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGG 488 G GG GGGG G GGGGG Sbjct: 34 GKKKNGGGEGGGGEGTSGEGGGGG 57 >At5g60050.1 68418.m07530 PRLI-interacting factor-related contains weak similarity to PRLI-interacting factor G (GI:11139264) [Arabidopsis thaliana] Length = 499 Score = 29.1 bits (62), Expect(2) = 0.55 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 826 PPXPPPPPPP 855 PP PPPPPPP Sbjct: 38 PPLPPPPPPP 47 Score = 21.8 bits (44), Expect(2) = 0.55 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 835 PPPPPPPXXP 864 P PPPPP P Sbjct: 39 PLPPPPPPPP 48 >At5g07190.1 68418.m00819 embryo-specific protein 3, putative similar to embryo-specific protein 3 GI:3335171 from [Arabidopsis thaliana] Length = 213 Score = 31.9 bits (69), Expect = 0.71 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +2 Query: 872 PRXPPPX-PPPXPPXXPXPXPPPXPXXGXA 958 P PPP PP PP P PPP P A Sbjct: 157 PDLPPPHFPPEFPPETPTTPPPPPPRPSAA 186 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 P P PP P PP P PPPR Sbjct: 154 PSSPDLPPPHFPPEFPPETPTTPPPPPPR 182 >At4g34440.1 68417.m04894 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 670 Score = 31.9 bits (69), Expect = 0.71 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PP PP PP PPP +PPP Sbjct: 32 PPTPPSSPPPSSISAPPPDISASFSPPP 59 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P TP PP P PP PP P P Sbjct: 84 PQTPENPSPPAPEGSTPVTPPAPPQTPSNQSP 115 >At4g03120.1 68417.m00425 proline-rich family protein similar to U1 small nuclear ribonucleoprotein C; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 207 Score = 31.9 bits (69), Expect = 0.71 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 414 GGGGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPP 536 GGG G P G G P P G PPPP P P PP Sbjct: 147 GGGPPGMAPIPGQGGGPP--PNYNGLPPPP-PYHTNPAAPP 184 >At3g49840.1 68416.m05449 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 606 Score = 31.9 bits (69), Expect = 0.71 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 PP P PP P PPP P G APP Sbjct: 550 PPQYPQGHPPQYPYQGPPP-PHYGQAPP 576 >At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ boundaries domain protein 18 (LBD18) identical to LOB DOMAIN 18 [Arabidopsis thaliana] GI:17227164; supported by full-length cDNA gi:17227163 Length = 262 Score = 31.9 bits (69), Expect = 0.71 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -3 Query: 934 GGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 GG GG GGG G + GGGGGG G Sbjct: 4 GGNTITAVGGGGGGCGGGGSSGGGGSSGGGGGGPCG 39 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGGXRG 871 G GGG G G G GG GGG G Sbjct: 13 GGGGGCGGGGSSGGGGSSGGGGGG 36 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGP 485 G G GG G GG G GGGGGP Sbjct: 14 GGGGCGGGGSSGGGGSSG-GGGGGP 37 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXG 473 G GG GGGG G GGGG G Sbjct: 13 GGGGGCGGGGSSGGGGSSGGGGGGPCG 39 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXR 874 GGG G G G G GG GGG G + Sbjct: 12 GGGGGGCGGGGSSGGGGSSGGGGGGPCGACK 42 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG GGG G G G GGG G G Sbjct: 3 GGGNTITAVGGGGGGCGGGGSSGGGGSSGGGG 34 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGP 484 G G G G GG G GGG GP Sbjct: 13 GGGGGCGGGGSSGGGGSSGGGGGGP 37 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = -1 Query: 966 GGGAXPXXGXGGGX--GXGXXGGXG--GGXGGGXRG 871 GG G GGG G G GG G GG GGG G Sbjct: 4 GGNTITAVGGGGGGCGGGGSSGGGGSSGGGGGGPCG 39 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 31.9 bits (69), Expect = 0.71 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPP 911 PPPPPPP PPP PP Sbjct: 194 PPPPPPPTPRPPRLLSSQPAPPPTPP 219 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +2 Query: 872 PRXPPPXPPPXPP--XXPXPXPPPXPXXGXAPP 964 P PPP P P PP P PPP P P Sbjct: 193 PPPPPPPPTPRPPRLLSSQPAPPPTPPVSLPSP 225 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 896 PPXPPXXPXPXPPPXPXXGXAPPP 967 PP PP P P PP APPP Sbjct: 193 PPPPPPPPTPRPPRLLSSQPAPPP 216 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 9/36 (25%) Frame = +3 Query: 489 PPPPPXPXXXXPP--------PPPXPP-XXPXPXXV 569 PPPPP P PP PPP PP P P V Sbjct: 193 PPPPPPPPTPRPPRLLSSQPAPPPTPPVSLPSPSMV 228 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 489 PPPPPXPXXXXPP--PPPXPPXXP 554 PPPPP P P PPP PP P Sbjct: 54 PPPPPLPDFAPQPLLPPPSPPPPP 77 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXP 908 P PPPPP P P PPP P Sbjct: 52 PYPPPPPLPDFAPQPLLPPPSPPPPPP 78 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAP--PP 967 PP P P P P PPP P P PP Sbjct: 40 PPVDPSPSSVHRPYPPPPPLPDFAPQPLLPP 70 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 P PPP P P P PP P P Sbjct: 52 PYPPPPPLPDFAPQPLLPPPSPPP 75 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/50 (34%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXP--PRAPRXAXXPPPA 971 P PPPPPPP P P P P P A + PPP+ Sbjct: 59 PSPPPPPPPQWGPPSPHYPQGQPYSSPAYPPHQPPFNAGANGNSQFPPPS 108 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/50 (34%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXP--PRAPRXAXXPPPA 971 P PPPPPPP P P P P P A + PPP+ Sbjct: 59 PSPPPPPPPQWGPPSPHYPQGQPYSSPAYPPHQPPFNAGANGNSQFPPPS 108 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 31.9 bits (69), Expect = 0.71 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 7/55 (12%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPP------PXPPXXPXXXPPRA-PRXAXXPPPA 971 P PPPPPP P PP P PP P A A PPPA Sbjct: 236 PTPPPPPPSIAVKQSAPTPSPPPPIKKGSSPSPPPPPPVKKVGALSSSASKPPPA 290 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 492 PPPPXPXXXXPPPPPXPP 545 PPPP P PPP PP Sbjct: 256 PPPPIKKGSSPSPPPPPP 273 >At1g53640.1 68414.m06100 hypothetical protein ; expression supported by MPSS Length = 290 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 933 GGXGXGXXGGXGGGXGGGXRG 871 GG G G GG GGG GGG G Sbjct: 269 GGGGCGGGGGCGGGCGGGCGG 289 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGG 880 G G G G G GG GGG GGG Sbjct: 270 GGGCGGGGGCGGGCGGGCGGG 290 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 31.9 bits (69), Expect = 0.71 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G GG G G G GGG GGG G Sbjct: 783 GGGGCGGGHHGGGGGGCGGCGGGGCGGGGDG 813 Score = 31.9 bits (69), Expect = 0.71 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GGG GGG G G GG G G GG G Sbjct: 784 GGGCGGGHHGGGGGGCGGCGGGGCGGGGDGGG 815 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 216 GXXXGXXGGGGGXXGGXXXGGGXXXXGXXQXXKXGXGXGG 97 G G GGGG GG GGG G G G GG Sbjct: 775 GYHHGGHHGGGGCGGGHHGGGGGGCGGCGGGGCGGGGDGG 814 Score = 31.5 bits (68), Expect = 0.93 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G GGG G GG GG GGG G Sbjct: 779 GGHHGGGGCGGGHHGGGGGGCGGCGGGGCGG 809 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGG 491 G G GG GGGG G GGGG Sbjct: 784 GGGCGGGHHGGGGGGCGGCGGGG 806 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -3 Query: 559 GXGXXGGXGGG-GGXXXXGXGGGG 491 G G GG GGG GG G GGGG Sbjct: 788 GGGHHGGGGGGCGGCGGGGCGGGG 811 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -3 Query: 934 GGXXXGXXGGXGGGXXXGXARXXXXXXGGG-GGGGXG 827 GG G GG GGG G GGG GGGG G Sbjct: 779 GGHHGG--GGCGGGHHGGGGGGCGGCGGGGCGGGGDG 813 >At5g65630.1 68418.m08256 DNA-binding bromodomain-containing protein similar to 5.9 kb fsh membrane protein [Drosophila melanogaster] GI:157455; contains Pfam profile PF00439: Bromodomain Length = 590 Score = 31.5 bits (68), Expect = 0.93 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPP 937 PPP PP P P P PPP Sbjct: 349 PPPPPPVIQPELPQPQPPP 367 >At5g60850.1 68418.m07633 Dof-type zinc finger domain-containing protein similar to zinc finger protein OBP4 gi:5059396 from [Arabidopsis thaliana]; EMBL:AF155817 Length = 307 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGG 488 G GG GGGG G GGGGG Sbjct: 11 GVGGGGGGGGRFFGGGIGGGGG 32 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGGXR 874 G GGG G GG GGG GG R Sbjct: 14 GGGGGGGRFFGGGIGGGGGGDRR 36 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 942 GXGGGXGXGXXGGXGGGXGGGXR 874 G GGG G GG GG GGG R Sbjct: 13 GGGGGGGGRFFGGGIGGGGGGDR 35 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 936 GGGXGXGXXGGXGGGXGGGXRG 871 GGG G G GG GGG GG G Sbjct: 128 GGGQGGGGQGGGGGGAEGGTTG 149 Score = 31.1 bits (67), Expect = 1.2 Identities = 26/91 (28%), Positives = 26/91 (28%), Gaps = 1/91 (1%) Frame = -3 Query: 733 GPPPPPXGXXXXGXPXGPGXPXAPXAPXARXXXXXLXVXXXXXXGRXPPPXXXKRTXX-G 557 G PPPP P P P PP T Sbjct: 63 GNPPPPSPQYSPPPPPSQSSPPRSRCPPVPTTGCCNQPPGPPPSTMYSPPYPYFYTPPYP 122 Query: 556 XGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G GG G GGG G GGGGG G G Sbjct: 123 YGTIGGGGQGGG----GQGGGGGGAEGGTTG 149 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +3 Query: 486 GPPPPPXPXXXXPPPP--PXPPXXPXP 560 G PPPP P PPPP PP P Sbjct: 63 GNPPPPSPQYSPPPPPSQSSPPRSRCP 89 >At4g21720.1 68417.m03145 expressed protein Length = 139 Score = 31.5 bits (68), Expect = 0.93 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAPP 964 P PPP PP P PPP PP Sbjct: 104 PKRPPPPPPKPQPPPPPPRSQKPMQPP 130 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 887 PXPPPXPPXXPXPXPPPXPXXGXAPPP 967 P PP PP P P PPP PP Sbjct: 104 PKRPPPPPPKPQPPPPPPRSQKPMQPP 130 Score = 30.3 bits (65), Expect = 2.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 492 PPPPXPXXXXPPPPP 536 PPPP P PPPPP Sbjct: 107 PPPPPPKPQPPPPPP 121 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXP 554 PPPPP P PPP P P Sbjct: 108 PPPPPKPQPPPPPPRSQKPMQP 129 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPP 937 P P P PPP PP P PP Sbjct: 109 PPPPKPQPPPPPPRSQKPMQPP 130 >At3g46240.1 68416.m05005 protein kinase-related similar to light repressible receptor protein kinase (GI:1321686) [Arabidopsis thaliana] Length = 441 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 568 TXXGXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXPXPXXXGG 437 T G G G GGGG G G G G G G GG Sbjct: 311 TGSGSGSGSGGSGGGGSGSSGSGSGSGGTSKGGTGGSNEVSPGG 354 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 31.5 bits (68), Expect = 0.93 Identities = 42/180 (23%), Positives = 42/180 (23%), Gaps = 6/180 (3%) Frame = +3 Query: 423 GGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXPPXXP-XPXXVR----FXXXG 587 G G P G P P P P PPPP P P V F G Sbjct: 54 GSGPRPSPPFGQSPQSFPQQQQQQPRPSPMARPGPPPPAAMARPGGPPQVSQPGGFPPVG 113 Query: 588 GGXRPXXXXXXTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXX 767 P G G P P G P P G GP Sbjct: 114 RPVAPPSNQPPFGGRPSTGPLVG--GGSSFPQPGGFPASGPPGGVPSGPPSGARPIGFGS 171 Query: 768 XPRXXRPXAGGXGXXPLXXXPXPP-PPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 P P G P P P PP PP P P P P Sbjct: 172 PP----PMGPGMSMPPPSGMPGGPLSNGPPPSGMHGGHLSNGPPPSGMPGGPLSNGPPPP 227 Score = 31.5 bits (68), Expect = 0.93 Identities = 26/91 (28%), Positives = 26/91 (28%), Gaps = 9/91 (9%) Frame = +3 Query: 297 GGPPXPXNPXGXXXXXXXXXXXXXXXXXXXXQXTXXXXGGGGG----GGXX---PPXXXG 455 GGPP P G T GGG GG PP Sbjct: 98 GGPPQVSQPGGFPPVGRPVAPPSNQPPFGGRPSTGPLVGGGSSFPQPGGFPASGPPGGVP 157 Query: 456 XGXPX--TPXXXGPPPPPXPXXXXPPPPPXP 542 G P P G PPP P PPP P Sbjct: 158 SGPPSGARPIGFGSPPPMGPGMSMPPPSGMP 188 Score = 30.3 bits (65), Expect = 2.2 Identities = 43/185 (23%), Positives = 45/185 (24%), Gaps = 2/185 (1%) Frame = +3 Query: 417 GGGGGXXPPXXXGXGXPXTPXXXGPPPPPXPXXXXPPPPPXP-PXXPXPXXVRFXXXGGG 593 GGG P P GPP P PPP P P P + G Sbjct: 136 GGGSSFPQPGGFPASGPPGGVPSGPPSGARPIGFGSPPPMGPGMSMPPPSGMPGGPLSNG 195 Query: 594 XRPXXXXXXTXXXXXXXRAXGAXGAXGXPGPXGXPXXXXPXGGGGGPXXXXXXXXXXXXP 773 P G G GP P P G P Sbjct: 196 --PPPSGMHGGHLSNGPPPSGMPGGPLSNGP--PPPMMGPGAFPRGSQFTSGPMMAPPPP 251 Query: 774 RXXRPXAGG-XGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRX 950 P AG G PL P PPP PP P P PP+ Sbjct: 252 YGQPPNAGPFTGNSPLSSPPAHSIPPPTNFPGVPYGR-----PPMPGGFPYGAPPQQLPS 306 Query: 951 AXXPP 965 A P Sbjct: 307 APGTP 311 >At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 341 Score = 31.5 bits (68), Expect = 0.93 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXP 542 PPPPP P PPPP P Sbjct: 23 PPPPPPPPSSSLPPPPLP 40 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 887 PXPPPXPPXXPXPXPPPXPXXGXAPP 964 P PPP PP P PPP P A P Sbjct: 23 PPPPPPPPSSSLP-PPPLPTEIQANP 47 >At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 388 Score = 31.5 bits (68), Expect = 0.93 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXP 542 PPPPP P PPPP P Sbjct: 23 PPPPPPPPSSSLPPPPLP 40 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 887 PXPPPXPPXXPXPXPPPXPXXGXAPP 964 P PPP PP P PPP P A P Sbjct: 23 PPPPPPPPSSSLP-PPPLPTEIQANP 47 >At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 Zinc finger, C3HC4 type (RING finger) Length = 359 Score = 31.5 bits (68), Expect = 0.93 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 495 PPPXPXXXXPPPPPXPPXXP 554 PPP P PPPP PP P Sbjct: 24 PPPPPYYYLDPPPPPPPFPP 43 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPP 545 PPPP PPPPP PP Sbjct: 25 PPPPYYYLDPPPPPPPFPP 43 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPP 545 PPPPP PPPPP P Sbjct: 24 PPPPPYYYLDPPPPPPPFP 42 >At2g34670.1 68415.m04259 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 561 Score = 31.5 bits (68), Expect = 0.93 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 1/58 (1%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXPXXXPXPXGGXXXXXLXXEKXXXXXXGG-XXXGGAPGPXKP 322 P P PP PP PP P P L E+ GG G AP P P Sbjct: 73 PLPPSPPPTLPPSPPPPPPFSPDLRNPETSHDLADEEEEGENDGGNDGSGAAPPPPLP 130 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXP 554 P PP P P PPP PP P Sbjct: 73 PLPPSPPPTLPPSPPPPPPFSP 94 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXP 943 PP PPP P P P PP P Sbjct: 75 PPSPPPTLPPSPPPPPPFSP 94 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 887 PXPPPXPPXXPXPXPPPXP 943 P PP PP P PPP P Sbjct: 73 PLPPSPPPTLPPSPPPPPP 91 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXP 560 P PPP PPPPP P P Sbjct: 76 PSPPPTLPPSPPPPPPFSPDLRNP 99 >At1g65440.1 68414.m07424 glycine-rich protein Length = 1647 Score = 31.5 bits (68), Expect = 0.93 Identities = 18/56 (32%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -3 Query: 973 AAGGGXXAXRGAR--GGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 + GGG + + GG G G GG A GGGG GG G G Sbjct: 1526 SGGGGWGSESAGKKTGGGSTGGWGSESGGNKSDGAGSWGSGSGGGGSGGWGNDSGG 1581 >At1g53620.1 68414.m06094 glycine-rich protein Length = 143 Score = 31.5 bits (68), Expect = 0.93 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 936 GGGXGXGXXGGXGGGXGGGXRG 871 GGG G G G GGG GGG G Sbjct: 74 GGGDGGGCDGDAGGGDGGGCGG 95 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGG 883 R GG G GGG GG GGG GG Sbjct: 68 RSGGCG-GGGDGGGCDGDAGGGDGGGCGG 95 >At1g32360.1 68414.m03989 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 384 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -3 Query: 934 GGXXXGXXGGXGGG-XXXGXARXXXXXXGGGGGGGXG 827 GG G GG GGG G + GGGGG G G Sbjct: 214 GGYGSGGGGGSGGGSVGGGGSSSNVVVLGGGGGSGSG 250 >At1g28240.1 68414.m03466 expressed protein Length = 581 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 P PPP P P PP P G A PPR Sbjct: 523 PNFPPPPPSPPPPVLISSDLPRKMSSGRATPPR 555 >At1g11850.1 68414.m01363 expressed protein Length = 93 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXG-XXGGXGGGXGGGXRG 871 GG G G G G G GG GGG GGG G Sbjct: 60 GGLGIGAGIGAGAGLGLGGGGFGGGAGGGLGG 91 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = -2 Query: 968 GGGXXGPPXGXGGVXGGXXXXXXXXXXXXXXXXAXGXXGGGGGGGXGGXXXG 813 GGG G G G + GG G GGG GGG GG G Sbjct: 41 GGGGSGDGLGLG-LGGGAGLGGLGIGAGIGAGAGLGLGGGGFGGGAGGGLGG 91 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG G G G G G G GGG GG G Sbjct: 55 GGAGLGGLGIGAGIGAGAGLGLGGGGFGGGAG 86 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXGPXXXG 472 G G G G G G G G GGG G G Sbjct: 63 GIGAGIGAGAGLGLGGGGFGGGAGGGLGG 91 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 558 GXGXGXGXGGGXGXXXRGXGGGXG 487 G G G G GGG G G G G G Sbjct: 46 GDGLGLGLGGGAGLGGLGIGAGIG 69 >At1g04660.1 68414.m00463 glycine-rich protein Length = 212 Score = 31.5 bits (68), Expect = 0.93 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 G G G GG G GG GGG GG GGG G G Sbjct: 135 GVGGLGGVGGLGGAGLGGVGGVGGGIGKAGGIGGLGGLGGAGGGLGGVGGLG 186 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXX--GXARXXXXXXGGGGGGGXGXXXRGXXPXP 797 GG G GG G GG GGG G + GGG GGG G P P Sbjct: 157 GGGIGKAGGIGGL--GGLGGAGGGLGGVGGLGKAGGIGVGGGIGGGHGVVGGVIDPHP 212 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -1 Query: 966 GGGAXPXXGXGGG-XGXGXXGGXGGGXGGGXRG 871 GGG G GGG G G GG GG GG G Sbjct: 123 GGGVGGLGGVGGGVGGLGGVGGLGGAGLGGVGG 155 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GG GGG G G GG GG GV G Sbjct: 125 GVGGLGGVGGGVG-GLGGVGGLGGAGLGGVGG 155 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGG 883 GG G GG G G GG GGG GG Sbjct: 114 GGVGGLGGVGG--GVGGLGGVGGGVGG 138 >At3g57500.1 68416.m06401 hypothetical protein Length = 139 Score = 26.6 bits (56), Expect(2) = 1.0 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +3 Query: 804 GXXPLXXXPXPPPPPPP 854 G + P PPPPPPP Sbjct: 106 GIPAVSAAPSPPPPPPP 122 Score = 23.4 bits (48), Expect(2) = 1.0 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +3 Query: 837 PPPPPPXXXXXXRAXP 884 PPPPPP R+ P Sbjct: 116 PPPPPPPATAEERSKP 131 >At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly identical to RNA helicase [Arabidopsis thaliana] GI:1488521; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 671 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G GGG G GG G G GG Sbjct: 638 GGGRGNRFGGGGGNRFGGGGGRGRGGSGG 666 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGG-GXRG 871 R GG GGG G GG G G GG G RG Sbjct: 635 RFGGGGRGNRFGGGGGNRFGGGGGRGRGGSGGRG 668 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G G GGGG G GGG G G G Sbjct: 637 GGGGRGNRFGGGGGNRFGGGGGRGRGGSGGRG 668 >At4g03390.1 68417.m00461 leucine-rich repeat transmembrane protein kinase, putative similar to Z. mays leucine-rich repeat transmembrane protein kinase LRRTPK 1, GenBank accession number AF023164 Length = 776 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 826 PPXPPPPPPPXXP 864 PP PPPPPPP P Sbjct: 427 PPPPPPPPPPPPP 439 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 826 PPXPPPPPPPXXP 864 PP PPPPPPP P Sbjct: 428 PPPPPPPPPPPPP 440 Score = 30.7 bits (66), Expect = 1.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 814 PXXXPPXPPPPPPP 855 P PP PPPPPPP Sbjct: 427 PPPPPPPPPPPPPP 440 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXP 542 PPPPP P PPPPP P Sbjct: 427 PPPPPPP----PPPPPPP 440 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 492 PPPPXPXXXXPPPPPXPP 545 PPPP P PPPPP PP Sbjct: 427 PPPPPP----PPPPPPPP 440 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 31.1 bits (67), Expect = 1.2 Identities = 23/68 (33%), Positives = 24/68 (35%), Gaps = 13/68 (19%) Frame = +3 Query: 804 GXXPLXXXPXPPPP-------------PPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 G PL P PPPP PPP + P PPP PP P R Sbjct: 113 GHDPLAITPSPPPPSKTHERSRPITPSPPPPSKTHEPSRPNTPPPP-PPPSKTHEPSR-- 169 Query: 945 RXAXXPPP 968 R PPP Sbjct: 170 RITPSPPP 177 >At3g49300.1 68416.m05388 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 86 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPP 536 P P PPPPP P PPPPP Sbjct: 62 PTKPGYGFPPPPPPP--LSPPPPP 83 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 101 PXPXPXXXFXXXPLFXXPPPXWXPPXXPPPPP 196 P P P P + PPP PP PPPPP Sbjct: 54 PGPDPKHD-PTKPGYGFPPPP-PPPLSPPPPP 83 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +3 Query: 486 GPPP---PPXPXXXXPPPPPXPPXXPXP 560 GP P P P PPPPP P P P Sbjct: 55 GPDPKHDPTKPGYGFPPPPPPPLSPPPP 82 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 799 GXGXXPXXXPPXPPPPPP 852 G G P PP PPPPP Sbjct: 66 GYGFPPPPPPPLSPPPPP 83 >At3g26120.1 68416.m03257 RNA-binding protein, putative similar to GB:AAC39463 from [Zea mays], PF00076 RNA recognition motif (2 copies) Length = 615 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 498 PPXPXXXXPPPPPXPPXXPXP 560 PP P PPPP PP P P Sbjct: 66 PPHPMMFSPPPPQPPPPPPRP 86 Score = 25.0 bits (52), Expect(2) = 9.4 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 170 PPXXPPPPPXXP 205 PP PPPPP P Sbjct: 75 PPPQPPPPPPRP 86 Score = 21.4 bits (43), Expect(2) = 9.4 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 152 PPPXWXPPXXPP 187 PPP PP PP Sbjct: 36 PPPPQLPPPLPP 47 >At3g13225.1 68416.m01660 WW domain-containing protein contains Pfam profile PF00397: WW domain Length = 863 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 P P PPPP PPPPP P P Sbjct: 508 PPPPGEEWIPPPPSESEDVPPPPPDSYSEPIP 539 >At3g11820.2 68416.m01448 syntaxin 121 (SYP121) / syntaxin-related protein (SYR1) contains Pfam profiles: PF00804 syntaxin and PF05739: SNARE domain; identical to cDNA syntaxin-related protein At-SYR1 (At-Syr1) GI:4206788, SP|Q9ZSD4 Syntaxin 121 (AtSYP121) (Syntaxin-related protein At-Syr1) {Arabidopsis thaliana} Length = 315 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = -2 Query: 863 GXXGGGGGGGXGGXXX--GXXPXPPRAR 786 G GGGGGG GG G P PP+AR Sbjct: 284 GGGGGGGGGTTGGSQPNSGTPPNPPQAR 311 >At3g11820.1 68416.m01449 syntaxin 121 (SYP121) / syntaxin-related protein (SYR1) contains Pfam profiles: PF00804 syntaxin and PF05739: SNARE domain; identical to cDNA syntaxin-related protein At-SYR1 (At-Syr1) GI:4206788, SP|Q9ZSD4 Syntaxin 121 (AtSYP121) (Syntaxin-related protein At-Syr1) {Arabidopsis thaliana} Length = 346 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = -2 Query: 863 GXXGGGGGGGXGGXXX--GXXPXPPRAR 786 G GGGGGG GG G P PP+AR Sbjct: 315 GGGGGGGGGTTGGSQPNSGTPPNPPQAR 342 >At3g04570.1 68416.m00485 DNA-binding protein-related contains Pfam domain PF03479: Domain of unknown function (DUF296), found in AT-hook motifs Pfam:PF02178 Length = 315 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 544 GGXGGGGGXXXXGXGGGGGPXXXGVXG 464 GG GG GG GGGG P G G Sbjct: 246 GGGGGSGGVVPGQLGGGGSPLSSGAGG 272 >At2g30505.1 68415.m03716 Expressed protein Length = 321 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 826 PPXPPPPPPPXXP 864 PP PPPPPPP P Sbjct: 6 PPPPPPPPPPPPP 18 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPP 545 PPPPP PPPPP PP Sbjct: 6 PPPPP------PPPPPPPP 18 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPP 964 PPP PPP PP PPP G P Sbjct: 6 PPPPPPPPPP------PPPRRDSGFGDP 27 >At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Daucus carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 185 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG 833 G G R +GG G GG GGG G R GG GG G Sbjct: 133 GSGGYRGRRDQGGYNRGGGGGYGGG-YGGDRREGGYGDGGYGGQG 176 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -3 Query: 940 ARG-GXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 ARG G G GG G G G GGGGG G G Sbjct: 119 ARGSGTRGGMVGGYGSGGYRGRRDQGGYNRGGGGGYGGG 157 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 31.1 bits (67), Expect = 1.2 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 4/70 (5%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGG----XGXXXRGXXPX 800 GGG A G G G GG GG G GGGGG G G G Sbjct: 125 GGGYGASDGGYGAPAGGYGGGAGG---YGGNSSYSGNAGGGGGYGGNSSYGGNAGGYGGN 181 Query: 799 PPAXGRXXRG 770 PP G G Sbjct: 182 PPYSGNAVGG 191 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GG GA G GG GGG GGGGG G G Sbjct: 122 GGPGGGYGASDGGYGAPAGGYGGGAGGYGGNSSYSGNAGGGGGYGGNSSYG 172 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 588 PPXXXNXXXXGXGXGXGXGGGXGXXXRGXGGG 493 PP N G G G GGG G G GG Sbjct: 182 PPYSGNAVGGGGGYGSNFGGGGGYGVAGGVGG 213 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGG 895 GGG GGG G G GG GG Sbjct: 190 GGGGGYGSNFGGGGGYGVAGGVGG 213 >At1g68390.1 68414.m07813 expressed protein contains Pfam profile PF03267: Arabidopsis protein of unknown function, DUF266; expression supported by MPSS Length = 408 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 826 PPXPPPPPPPXXP 864 PP PPPPPPP P Sbjct: 79 PPSPPPPPPPSPP 91 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXP 919 P PPP PPP PP P Sbjct: 79 PPSPPPPPPPSPPSEP 94 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAPPP 967 PP PPP PP P P PP Sbjct: 79 PPSPPPPPPPSPPSEPEQNGLKSFIEPP 106 >At1g50300.1 68414.m05639 zinc finger (Ran-binding) family protein / RNA recognition motif (RRM)-containing protein similar to SP|Q27294 RNA-binding protein cabeza {Drosophila melanogaster}; contains Pfam profiles: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 372 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 R G A P GG G G G GGG GG G Sbjct: 159 RCGTARPAGASGGSMGAGRGRGRGGGADGGAPG 191 >At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family protein Length = 558 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 826 PPXPPPPPPPXXP 864 PP PPPPPPP P Sbjct: 258 PPTPPPPPPPPPP 270 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPP 899 P PPPPPPP A PP Sbjct: 261 PPPPPPPPPPRPLAKAARAQKSPP 284 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXP 925 P PP PPP PP P P Sbjct: 255 PFAPPTPPPPPPPPPPRP 272 >At1g35830.1 68414.m04452 VQ motif-containing protein contains PF05678: VQ motif Length = 302 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 826 PPXPPPPPPPXXP 864 PP PPPPPPP P Sbjct: 81 PPQPPPPPPPPPP 93 >At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family protein weak similarity to SP|Q00765 Polyposis locus protein 1 (TB2 protein) {Homo sapiens}; contains Pfam profile PF03134: TB2/DP1, HVA22 family Length = 315 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 826 PPXPPPPPPPXXP 864 PP PPPPPPP P Sbjct: 234 PPGPPPPPPPPPP 246 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPPAA 974 P PPPPPPP A P P P + A P PA+ Sbjct: 235 PGPPPPPPPPPPSPTTAAKRNADPAQP--SPTEAEEASQTVAALPEPAS 281 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 486 GPPPPPXPXXXXPPPPPXP 542 GPPPPP PPPPP P Sbjct: 236 GPPPPP------PPPPPSP 248 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 829 PXPPPPPPPXXP 864 P PPPPPPP P Sbjct: 237 PPPPPPPPPPSP 248 >At3g50190.1 68416.m05488 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 463 Score = 25.8 bits (54), Expect(2) = 1.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 835 PPPPPPPXXP 864 PPPPPPP P Sbjct: 11 PPPPPPPQLP 20 Score = 23.4 bits (48), Expect(2) = 1.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 829 PXPPPPPP 852 P PPPPPP Sbjct: 10 PPPPPPPP 17 >At5g25550.1 68418.m03040 leucine-rich repeat family protein / extensin family protein similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana]; contains Pfam PF00560: Leucine Rich Repeat domains Length = 433 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +2 Query: 872 PRXPP-PXPPPXPPXXPXPXPPPXPXXGXAP 961 P PP PPP P P PPP P AP Sbjct: 400 PTSPPLSTPPPARPCPPVYSPPPPPPLSLAP 430 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +3 Query: 465 PXTPXXXGPPPP-PXPXXXXPPPPP 536 P +P PPP P P PPPPP Sbjct: 400 PTSPPLSTPPPARPCPPVYSPPPPP 424 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +2 Query: 872 PRXPPPX--PPPXPPXXPXPXPPPXPXXGXAPPP 967 P P P PPP P PPP P +PPP Sbjct: 46 PSKPSPSMSPPPSPSLPLSSSPPPPPPHKHSPPP 79 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 Query: 471 TPXXXGPPPPPXPXXXXPPPPPXPPXXPXP 560 +P PP P P PPPPP P P Sbjct: 50 SPSMSPPPSPSLPLSSSPPPPPPHKHSPPP 79 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/52 (28%), Positives = 18/52 (34%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P P P P P + P PP PP PP + + PPP Sbjct: 39 PTICSPPPSKPSPSMSPPPSPSLPLSSSPPPPPPHKHSPPPLS--QSLSPPP 88 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 P PPP PP PPP PPPR Sbjct: 67 PPPPPPHKHSPPPLSQSLSPPPLITVIHPPPPR 99 >At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPP 536 P P PPP P P PPPPP Sbjct: 97 PHLPPHHLPPPFPGPYDSAPPPPP 120 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGG 593 PPP P PPP P P P VR G G Sbjct: 477 PPPTQPPAGEKPPPYPLFPPGLIPGMVRKMQIGSG 511 >At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPP 536 P P PPP P P PPPPP Sbjct: 97 PHLPPHHLPPPFPGPYDSAPPPPP 120 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGG 593 PPP P PPP P P P VR G G Sbjct: 477 PPPTQPPAGEKPPPYPLFPPGLIPGMVRKMQIGSG 511 >At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPP 536 P P PPP P P PPPPP Sbjct: 97 PHLPPHHLPPPFPGPYDSAPPPPP 120 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXPXXVRFXXXGGG 593 PPP P PPP P P P VR G G Sbjct: 477 PPPTQPPAGEKPPPYPLFPPGLIPGMVRKMQIGSG 511 >At4g16830.1 68417.m02540 nuclear RNA-binding protein (RGGA) identical to nuclear RNA binding protein GI:6492264 from [Arabidopsis thaliana] Length = 355 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 936 GGGXGXGXXGGXGGGXGGGXRG 871 GGG G G GGG GGG RG Sbjct: 114 GGGAPRGSFRGEGGGPGGGRRG 135 >At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 646 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGG 883 RGGG G GGG G GG G GG Sbjct: 568 RGGGGADYYGGGGGYGGVPGGGYGAMPGG 596 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 R G+ G GGG G G GGG GGG G Sbjct: 564 RREGSYSRGGGGGGGGGGSDYYGGGGYGGGGYG 596 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G GG G G G GG G G Sbjct: 578 GGGGSDYYGGGGYGGGGYGGAPSGGYGAG 606 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGX--GGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G GG G GGG G GG GGGG G G Sbjct: 548 GGGKKRSGGRFGGRDFRREGSYSRGGGGGGGGGGSDYYGGGGYGGGGYGGAPSG 601 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 919 GXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 G G GGG R GGGGGG G Sbjct: 62 GGGGASGGGYRNDGGRTGYGYGAGGGGGGGG 92 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGG 488 G GG GGGG G G GGG Sbjct: 572 GGGGGGGGGGSDYYGGGGYGGG 593 Score = 28.3 bits (60), Expect = 8.7 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXX--GXARXXXXXXGGGGGGGXGXXXR 815 A GG A G+R GG GG G GGGGGGG G R Sbjct: 45 AGYGGQPA--GSRWAPPSSGGGGASGGGYRNDGGRTGYGYGAGGGGGGGGGWNNR 97 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 541 GXGGGGGXXXXGXGGGGGPXXXGVXGXP 458 G GGGGG GGGG G G P Sbjct: 572 GGGGGGGGGGSDYYGGGGYGGGGYGGAP 599 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -1 Query: 969 RGGGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 R G+ G GGG G G GGG GGG G Sbjct: 564 RREGSYSRGGGGGGGGGGSDYYGGGGYGGGGYG 596 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 966 GGGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GGG G GG G G G GG G G Sbjct: 578 GGGGSDYYGGGGYGGGGYGGAPSGGYGAG 606 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = -3 Query: 967 GGGXXAXRGARGGXXXGXXGGX--GGGXXXGXARXXXXXXGGGGGGGXGXXXRG 812 GGG G GG G GGG G GG GGGG G G Sbjct: 548 GGGKKRSGGRFGGRDFRREGSYSRGGGGGGGGGGSDYYGGGGYGGGGYGGAPSG 601 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 919 GXXGGXGGGXXXGXARXXXXXXGGGGGGGXG 827 G G GGG R GGGGGG G Sbjct: 62 GGGGASGGGYRNDGGRTGYGYGAGGGGGGGG 92 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGG 488 G GG GGGG G G GGG Sbjct: 572 GGGGGGGGGGSDYYGGGGYGGG 593 Score = 28.3 bits (60), Expect = 8.7 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = -3 Query: 973 AAGGGXXAXRGARGGXXXGXXGGXGGGXXX--GXARXXXXXXGGGGGGGXGXXXR 815 A GG A G+R GG GG G GGGGGGG G R Sbjct: 45 AGYGGQPA--GSRWAPPSSGGGGASGGGYRNDGGRTGYGYGAGGGGGGGGGWNNR 97 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 541 GXGGGGGXXXXGXGGGGGPXXXGVXGXP 458 G GGGGG GGGG G G P Sbjct: 572 GGGGGGGGGGSDYYGGGGYGGGGYGGAP 599 >At3g18360.1 68416.m02335 VQ motif-containing protein contains PF05678: VQ motif Length = 285 Score = 30.7 bits (66), Expect = 1.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 814 PXXXPPXPPPPPPP 855 P PP PPPPPPP Sbjct: 201 PPQPPPHPPPPPPP 214 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPP 934 PP PPP PP P P PP Sbjct: 201 PPQPPPHPP--PPPPPP 215 >At3g07540.1 68416.m00900 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 841 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 896 PPXPPXXPXPXPPPXPXXGXAP 961 PP PP P P PPP P P Sbjct: 59 PPPPPSPPQPLPPPAPTFATFP 80 Score = 29.9 bits (64), Expect = 2.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPP 536 PPPPP P PPP P Sbjct: 59 PPPPPSPPQPLPPPAP 74 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +3 Query: 465 PXTPXXXGPPPPPXPXXXXPPPPPXPPXXPXPXXV 569 P P PPP P P PPP P P + Sbjct: 49 PFFPLYSSTSPPPPPSPPQPLPPPAPTFATFPANI 83 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 152 PPPXWXPPXXPPPPPXXP 205 PPP PP P PPP P Sbjct: 427 PPPQRPPPAMPEPPPLVP 444 >At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 561 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 7/43 (16%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXP-------XXXPPPXPPXXP 920 PL P PPPPPPP + PPP PP P Sbjct: 360 PLVYSPPPPPPPPPPFFQGLFSSKKGKSKKNNSNPPPPPPPPP 402 Score = 29.1 bits (62), Expect = 5.0 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 826 PPXPPPPPPP 855 PP PPPPPPP Sbjct: 394 PPPPPPPPPP 403 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +1 Query: 805 GXXPXXXPPXPPPPPPPXXPXXXXXXXXXXXXXXXXXXPPXTPPXP 942 G P PPPPPPP PP PP P Sbjct: 356 GSDPPLVYSPPPPPPPPPPFFQGLFSSKKGKSKKNNSNPPPPPPPP 401 Score = 24.6 bits (51), Expect(2) = 9.4 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +3 Query: 507 PXXXXPPPPPXPP 545 P PPPPP PP Sbjct: 445 PLMPIPPPPPPPP 457 Score = 21.8 bits (44), Expect(2) = 9.4 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +3 Query: 525 PPPPXPPXXPXP 560 PPPP PP P Sbjct: 450 PPPPPPPPFKMP 461 >At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi domain-containing protein similar to SP|Q9XGW1 PINHEAD protein (ZWILLE protein) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 990 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 489 PPPPPXPXXXXPPPPPXPPXXPXPXXVRF 575 PPPPP PP PP P P RF Sbjct: 80 PPPPPHLLPLSPPLPPLLPLPPPHSMTRF 108 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 495 PPPXPXXXXPPPPPXPPXXPXP 560 PPP P P PP PP P P Sbjct: 79 PPPPPPHLLPLSPPLPPLLPLP 100 >At1g62510.1 68414.m07053 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 149 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 P P P P P P P P P P A PR Sbjct: 40 PSPSPKPKPNPKPKPTPHPSPSPAIAKCPR 69 >At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 359 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +3 Query: 828 PXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPP-RAPRXAXXPPP 968 P P P PP PP PP P PP +AP PP Sbjct: 60 PHPHPHPPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKPP 107 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPR 947 P+ PP PP P PP PP P PP+ R Sbjct: 183 PVSPPAKPPVKPPVYPPTKAPVKPPVSPPTKPPVTPPVYPPKFNR 227 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 P+ PP PP P PP PP P PP P Sbjct: 79 PVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKP 122 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 P+ PP PP P PP PP P PP P Sbjct: 151 PVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKP 194 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPP-RAPRXAXXPPPAA 974 PP PP P PP PP P PP P A PP + Sbjct: 162 PPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPVS 209 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/65 (27%), Positives = 20/65 (30%), Gaps = 2/65 (3%) Frame = +3 Query: 786 PXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP--RXAXX 959 P A P+ PP PP PP PP P PP P + Sbjct: 66 PPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVY 125 Query: 960 PPPAA 974 PP A Sbjct: 126 PPTKA 130 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/53 (30%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPP-RAPRXAXXPPP 968 P+ PP PP PP PP P PP +AP PP Sbjct: 107 PVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPP 159 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/53 (30%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPP-RAPRXAXXPPP 968 P+ PP P P PP PP P PP +AP PP Sbjct: 159 PVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPVSPP 211 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = +3 Query: 834 PPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP--RXAXXPPPAA 974 PP PP A P PP PP PP P + PP A Sbjct: 102 PPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKA 150 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/52 (30%), Positives = 18/52 (34%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPPP 968 P+ PP PP P PP PP P P +AP PP Sbjct: 131 PVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVYP---PTKAPVKPPTKPP 179 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/44 (29%), Positives = 14/44 (31%) Frame = +3 Query: 813 PLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAP 944 P+ PP PP P PP P P PP P Sbjct: 171 PVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPVSPPTKP 214 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 872 PRXPPPXPPPXPPXXPXPXPPPXPXXGXAPPPR 970 P P P PP P P PPP P PPPR Sbjct: 12 PWNSPYSPHLHPPSAPLPPPPPLP---PPPPPR 41 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 881 PPPXPPPXPPXXPXPXPP 934 PPP PPP PP P P Sbjct: 31 PPPLPPPPPPRQSHPESP 48 >At1g30475.1 68414.m03725 expressed protein Length = 162 Score = 26.6 bits (56), Expect(2) = 1.7 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -2 Query: 854 GGGGGGGXGGXXXG 813 GGGGGGG GG G Sbjct: 124 GGGGGGGGGGSSSG 137 Score = 24.2 bits (50), Expect(2) = 8.3 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -2 Query: 854 GGGGGGGXGGXXXG 813 GGGGGGG G G Sbjct: 125 GGGGGGGGGSSSGG 138 Score = 22.6 bits (46), Expect(2) = 1.7 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 863 GXXGGGGGGG 834 G GGGGGGG Sbjct: 123 GGGGGGGGGG 132 Score = 22.6 bits (46), Expect(2) = 8.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 863 GXXGGGGGGG 834 G GGGGGGG Sbjct: 124 GGGGGGGGGG 133 >At5g22790.1 68418.m02664 expressed protein Length = 433 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGGXRG 871 GG GGG G GG GGG G G G Sbjct: 103 GGDENGNNDGGGNGGNGDGGGGGGDGEGDDG 133 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXG 464 G G GGG G GGGGG G G Sbjct: 104 GDENGNNDGGGNGGNGDGGGGGGDGEGDDG 133 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/60 (28%), Positives = 20/60 (33%) Frame = +3 Query: 786 PXAGGXGXXPLXXXPXPPPPPPPXXXXXXRAXPXXXPPPXPPXXPXXXPPRAPRXAXXPP 965 P +G P P PPPP P PPP P P PP+ + P Sbjct: 299 PPSGQSQPPPTIQPPYQPPPPTQSLH-----QPPYQPPPQQPQYPQQPPPQLQHPSGYNP 353 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +3 Query: 474 PXXXGPPPPPXPXXXXPPPPPX-PPXXPXP 560 P P PP P PP PP PP P P Sbjct: 348 PSGYNPEEPPYPQQSYPPNPPRQPPSHPPP 377 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 884 PPXPPPXPPXXPXPXPPPXPXXGXAPP 964 PP PP PP P P P APP Sbjct: 364 PPNPPRQPPSHPPPGSAPSQQYYNAPP 390 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/30 (36%), Positives = 12/30 (40%) Frame = +2 Query: 470 HPXXXGPXPPPXPRXXXPXPPPXPXPXPXP 559 HP P PP P+ P PP P P Sbjct: 347 HPSGYNPEEPPYPQQSYPPNPPRQPPSHPP 376 >At4g32340.1 68417.m04603 expressed protein Length = 238 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 G P G GG G G GGG GGG Sbjct: 79 GSRLPQGGSNGGFGGRGGDGAGGGGGGG 106 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 964 GGXXAXRGARGGXXXGXXGGXGGGXXXG 881 GG G RGG G GG GGG G Sbjct: 85 GGSNGGFGGRGGDGAGGGGGGGGGSVDG 112 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -1 Query: 963 GGAXPXXGXGGGXGXGXXGGXGGGXGGG 880 GG+ G GG G G GG GGG G Sbjct: 85 GGSNGGFGGRGGDGAGGGGGGGGGSVDG 112 >At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi|20465684|gb|AY096677.1| Length = 158 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -3 Query: 553 GXXGGXGGGGGXXXXGXGGGGGPXXXGVXGXP 458 G GG GG GG G G G G G+ G P Sbjct: 87 GLGGGVGGLGGLGGLGGGSGLGHGVGGIGGDP 118 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -3 Query: 559 GXGXXGGXGGGGGXXXXGXGGGGGP-XXXGVXGXPXPXXXGG 437 G G GG GGG G G GG P G+ G GG Sbjct: 94 GLGGLGGLGGGSGLGHGVGGIGGDPGIGSGIGGLGGAGGLGG 135 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.310 0.152 0.543 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,840,559 Number of Sequences: 28952 Number of extensions: 673115 Number of successful extensions: 37267 Number of sequences better than 10.0: 378 Number of HSP's better than 10.0 without gapping: 1262 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16587 length of database: 12,070,560 effective HSP length: 82 effective length of database: 9,696,496 effective search space used: 2511392464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 43 (21.9 bits)
- SilkBase 1999-2023 -