BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_A11 (886 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 40 0.002 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 40 0.002 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 40 0.004 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 38 0.008 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 36 0.033 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 36 0.044 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.058 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.076 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 35 0.10 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 35 0.10 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 35 0.10 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 35 0.10 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 34 0.18 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 33 0.23 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.41 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 32 0.54 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 32 0.71 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.71 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 32 0.71 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.71 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 31 0.94 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 31 1.2 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 31 1.2 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 31 1.6 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 31 1.6 SB_20156| Best HMM Match : GED (HMM E-Value=6.8e-16) 30 2.2 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_13398| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_31904| Best HMM Match : Extensin_2 (HMM E-Value=0.5) 28 2.7 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 30 2.9 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 30 2.9 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 30 2.9 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_37033| Best HMM Match : Annexin (HMM E-Value=0) 30 2.9 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 30 2.9 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 3.3 SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 29 3.8 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 29 3.8 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 29 3.8 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) 29 5.0 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 29 5.0 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 29 5.0 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 29 5.0 SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 29 6.6 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 29 6.6 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 29 6.6 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 29 6.6 SB_18739| Best HMM Match : YhhN (HMM E-Value=7.3) 26 7.9 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 28 8.7 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_59124| Best HMM Match : Bac_luciferase (HMM E-Value=1.6) 28 8.7 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 28 8.7 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 28 8.7 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 28 8.7 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/51 (39%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPGXSPL-XXGXPPXPXXHXXPWGXLGXTPP 801 PPPPP PP PP PG +P G PP P P G + PP Sbjct: 341 PPPPPISKPPTSTRSAPPPP-PGRAPQPLGGPPPPPPGRRPPSGKINPPPP 390 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 5/53 (9%) Frame = +1 Query: 631 SKTPXXXPPPPPXX-----PPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXP 774 S+T PPPPP PPP PP PG P P P P Sbjct: 187 SRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRP 239 Score = 29.9 bits (64), Expect = 2.9 Identities = 20/62 (32%), Positives = 21/62 (33%), Gaps = 7/62 (11%) Frame = +1 Query: 637 TPXXXPPPPPXXPPPXXXXXXXKPP----GPGXSPLXXGXPPXPXXH---XXPWGXLGXT 795 T PPPP PPP PP GP + PP P P L T Sbjct: 258 TSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNAT 317 Query: 796 PP 801 PP Sbjct: 318 PP 319 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/51 (33%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = +1 Query: 640 PXXXPPPPPX--XPPPXXXXXXXKPPGPG--XSPLXXGXPPXPXXHXXPWG 780 P PPPP PPP K P G P G PP P + +G Sbjct: 135 PKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFG 185 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPP 801 PP P P +PP P P G PP P P PP Sbjct: 232 PPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPP 281 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/51 (39%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPGXSPL-XXGXPPXPXXHXXPWGXLGXTPP 801 PPPPP PP PP PG +P G PP P P G + PP Sbjct: 253 PPPPPISKPPTSTRSAPPPP-PGRAPQPLGGPPPPPPGRRPPSGKINPPPP 302 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 5/53 (9%) Frame = +1 Query: 631 SKTPXXXPPPPPXX-----PPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXP 774 S+T PPPPP PPP PP PG P P P P Sbjct: 99 SRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRP 151 Score = 29.9 bits (64), Expect = 2.9 Identities = 20/62 (32%), Positives = 21/62 (33%), Gaps = 7/62 (11%) Frame = +1 Query: 637 TPXXXPPPPPXXPPPXXXXXXXKPP----GPGXSPLXXGXPPXPXXH---XXPWGXLGXT 795 T PPPP PPP PP GP + PP P P L T Sbjct: 170 TSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNAT 229 Query: 796 PP 801 PP Sbjct: 230 PP 231 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/51 (33%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = +1 Query: 640 PXXXPPPPPX--XPPPXXXXXXXKPPGPG--XSPLXXGXPPXPXXHXXPWG 780 P PPPP PPP K P G P G PP P + +G Sbjct: 47 PKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFG 97 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPP 801 PP P P +PP P P G PP P P PP Sbjct: 144 PPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPP 193 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +1 Query: 631 SKTPXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXP 774 S P PPPPP PPP PP P P PP P P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +1 Query: 631 SKTPXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXP 756 S P PPPPP PPP PP P +P PP P Sbjct: 388 SPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPP 801 P PPPPP PPP PP P P PP P P PP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPP 801 P PPPPP PPP PP P P PP P P PP Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 637 TPXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXP 774 +P PPPPP PPP PP P P PP P P Sbjct: 377 SPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXP 756 P PPPPP PPP PP P P PP P Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXP 774 P PPPPP PPP PP P P PP P P Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXP 756 P PPPPP PPP PP P P PP P Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +1 Query: 640 PXXXPPP-PPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPP 801 P PPP PP PPP PP P P PP P P L PP Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 36.7 bits (81), Expect = 0.025 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPP 801 P PPPP PPP +PP P P PP P P PP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPP 801 P PPP P PPP PP P P PP P P PP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 631 SKTPXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXP 774 S P PPPP PPP PP P P PP P P Sbjct: 377 SPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXP 774 P PPPP PPP PP P P PP P P Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPP 801 P PP PP PPP P P P PP P P PP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 31.9 bits (69), Expect = 0.71 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXP 774 P PPPP PPP PP P P P P P Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 28.3 bits (60), Expect = 8.7 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 638 PXXXPPXPXXXPXPPXXXXXPXSPRGRGXPPXXGGYPRXPXXTXXLGXXWAPP 796 P PP P P PP P P PP P P L APP Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP---PPPPPPPPALRLACAPP 441 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPP 801 PPPPP PPP PP P P P P P G G PP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQP-GCAGLPPP 742 Score = 37.5 bits (83), Expect = 0.014 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 655 PPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPP 801 P PP PPP PP P P G PP P P G G PP Sbjct: 710 PMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPP--PPPPGCAGLPPP 756 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPPXXXXG 816 PPPPP PP PP P P G PP P L PP G Sbjct: 695 PPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPG 749 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +1 Query: 652 PPPPPXXPP-PXXXXXXXKPPGPGXSPLXXG-XPPXPXXHXXPWGXLGXTPP 801 PPPPP P PP P PL G P P P G G PP Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPP 728 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/62 (29%), Positives = 20/62 (32%) Frame = +2 Query: 614 PIXTIFQKPXXXPPXPXXXPXPPXXXXXPXSPRGRGXPPXXGGYPRXPXXTXXLGXXWAP 793 P+ I PP P P P P P PP G P P + G P Sbjct: 682 PLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLP-PPPPSPQPGCAGLP 740 Query: 794 PP 799 PP Sbjct: 741 PP 742 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 655 PPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXP 756 PPPP P P PP P P G PP P Sbjct: 726 PPPPPSPQPGCAGLPPPPPPP--PPGCAGLPPPP 757 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 637 TPXXXPPPPPX---XPPPXXXXXXXKPPGPGXSPLXXGXPPXP 756 TP PPPPP PPP KPP P P PP P Sbjct: 549 TPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 637 TPXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXP 756 TP PPPPP PPP PP P P PP P Sbjct: 655 TPEAGPPPPPP-PPPGGQAGGAPPPPPPPLPGGAAPPPPP 693 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 35.5 bits (78), Expect = 0.058 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPP 750 P PPPPP PPP PP P P+ P Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAP 722 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSP 729 P PPPPP PPP PP P +P Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXS 726 P PPPPP PPP PP P S Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPS 712 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXP 774 PPPPP PPP PP P P PP P P Sbjct: 683 PPPPPPPPPP--------PPPPPPPPPQPSTPPPPPPSTPP 715 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +1 Query: 634 KTPXXXPPPPPXXPPPXXXXXXXKPPGPGXSP 729 +T PPPPP PPP +P P P Sbjct: 679 QTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = +2 Query: 614 PIXTIFQKPXXXPPXPXXXPXPPXXXXXPXSPRGRGXPP-XXGGYPRXP 757 PI T+ P PP P P PP P PP G P P Sbjct: 677 PIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 35.1 bits (77), Expect = 0.076 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +1 Query: 628 FSKTPXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXP 774 FS P PPP P PPP PP P PP P P Sbjct: 88 FSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPP 136 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPW 777 P PPP P PPP P P P PP P P+ Sbjct: 177 PPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPY 222 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +1 Query: 640 PXXXPPPPPXXP-PPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPP 801 P PPPP P PP PP P P PP P P+ PP Sbjct: 128 PNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPP 182 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPP 801 P PPPP PPP P P P PP P P PP Sbjct: 98 PYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPP 151 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXP 774 P PPP P PPP P P P PP P P Sbjct: 185 PPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAP 229 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXP 774 P P PPP PPP P P P PP P P Sbjct: 169 PPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPP 213 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +2 Query: 638 PXXXPPXPXXXPXPPXXXXXPXSPRGRGXPPXXGGYPRXPXXTXXLGXXWAPPP 799 P PP P PP P P PP YP P + PPP Sbjct: 176 PPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAP---NPPYPPPP 226 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXP 756 PPP P PPP PP P PP P Sbjct: 205 PPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXP 774 P PP PP PP PP P PP P P Sbjct: 147 PYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPP 191 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPL 732 P PPPPP PPP PP P +PL Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPPTPL 497 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +1 Query: 634 KTPXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXP 756 + P PPPPP PPP PP P P PP P Sbjct: 462 QAPPPPPPPPPPPPPP------PPPPPPPPPPFPPPPPPTP 496 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 655 PPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXH 765 PPPP PPP PP P P PP H Sbjct: 464 PPPP--PPPPPPPPPPPPPPPPPPPPFPPPPPPTPLH 498 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/59 (30%), Positives = 19/59 (32%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPPXXXXG 816 P PPPP PP P P+ PP P P LG PP G Sbjct: 341 PSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPG 399 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +2 Query: 638 PXXXPPXPXXXPXPPXXXXXPXSPRGRGXPPXXGGYPRXPXXTXXLGXXWAPPP 799 P P P PP P G PP G P P G PPP Sbjct: 327 PPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPP 380 Score = 29.1 bits (62), Expect = 5.0 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +1 Query: 652 PPPPPXXP---PPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPP 801 PPPPP PP PP G +P G P P G PP Sbjct: 327 PPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPP 379 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +2 Query: 638 PXXXPPXPXXXPXPPXXXXXPXSPRGRGXPPXXGGYPRXPXXTXXLGXXWAPPP 799 P PP PP P P PP GG P +G PPP Sbjct: 326 PPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPP 379 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXP 756 P PPPPP PP PPG G +P PP P Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPPPGDGGAP----PPPPP 336 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXP 756 P P P PPP PP P P G PP P Sbjct: 296 PADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPP 334 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGP 717 PPPPP PPP PP P Sbjct: 316 PPPPPPPPPPGDGGAPPPPPPP 337 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +1 Query: 655 PPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPP 801 P PP P PP PG +P PP P P G G PP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAP-----PPPPPPPPPPPGDGGAPPP 333 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPP 801 PPPPP PPP PP P SP PP P L PP Sbjct: 204 PPPPPPRPPPSPPPP---PPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPP 250 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSP 729 P PP PP PPP PP P SP Sbjct: 208 PPRPPPSPPPPPPPPSPSPPRPPPPPPPSP 237 Score = 31.5 bits (68), Expect = 0.94 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXP 774 P PP PP PPP PP P P PP P P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPP--PPSPPRPLAAKLP 246 Score = 31.5 bits (68), Expect = 0.94 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXP 774 P PPPPP P P PP PL P P P Sbjct: 211 PPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMP 255 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 631 SKTPXXXPPPPPXXPP-PXXXXXXXKPPGPGXSP 729 S +P PPPPP PP P PP P P Sbjct: 223 SPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPP 256 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 635 KPXXXPPXPXXXPXPPXXXXXPXSPRGRGXPP 730 +P PP P P PP P PR PP Sbjct: 203 QPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPP 234 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPP 801 P PP PPP PP G P G PP P P+ G PP Sbjct: 452 PQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPF-YRGPPPP 500 Score = 31.9 bits (69), Expect = 0.71 Identities = 21/70 (30%), Positives = 23/70 (32%), Gaps = 4/70 (5%) Frame = +1 Query: 604 KSQTNXYYFSKTPXXX---PPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXP-XXHXX 771 K Y+ TP PPPP PP P G G L PP P Sbjct: 409 KEDQGDYFNLSTPAANMRLPPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGM 468 Query: 772 PWGXLGXTPP 801 P +G PP Sbjct: 469 PPPPMGMYPP 478 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = +1 Query: 634 KTPXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXP 756 +TP P PPP PP PP P +P G PP P Sbjct: 118 ETPSQAPSPPP---PPTSPATRAPPPPPPIAPATGGPPPPP 155 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 6/48 (12%) Frame = +1 Query: 631 SKTPXXXPPPP------PXXPPPXXXXXXXKPPGPGXSPLXXGXPPXP 756 S+ P PPP P PPP PP P +P G PP P Sbjct: 121 SQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPP 168 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPG 720 PPPPP PPP PP PG Sbjct: 198 PPPPPPPPPPPPILELAAPPPPG 220 Score = 32.3 bits (70), Expect = 0.54 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPG 714 P PPPPP PPP PPG Sbjct: 196 PPPPPPPPPPPPPPILELAAPPPPG 220 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXP 756 P PPP P PP P SP PP P Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPP 142 Score = 28.3 bits (60), Expect = 8.7 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 6/60 (10%) Frame = +2 Query: 638 PXXXPPXPXXXPXPPXXXXXPXSPRGRGXPPXX------GGYPRXPXXTXXLGXXWAPPP 799 P P P P PP P SP R PP GG P P G PPP Sbjct: 113 PPRAPETPSQAPSPPPP---PTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPP 169 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXP 756 PPPP PPP PP P L PP P Sbjct: 188 PPPPSGGPPPPPPPPPPPPPPP---ILELAAPPPP 219 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 33.5 bits (73), Expect = 0.23 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 6/56 (10%) Frame = +1 Query: 652 PPPP----PXXPPPXXXXXXXKPPGPGXS--PLXXGXPPXPXXHXXPWGXLGXTPP 801 PPPP P PPP PP PG S P G PP P P G PP Sbjct: 934 PPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLP---PPPGGSAPPPPP 986 Score = 31.5 bits (68), Expect = 0.94 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +1 Query: 652 PPPPP--XXPPPXXXXXXXKPPGPGXSPLXXGXPPXP 756 PPPPP PPP PP G +P PP P Sbjct: 955 PPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPP 991 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/61 (34%), Positives = 23/61 (37%), Gaps = 4/61 (6%) Frame = +1 Query: 631 SKTPXXXPP----PPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTP 798 S++P PP PPP PPP PP PG S PP P G P Sbjct: 907 SESPSASPPGGSVPPP--PPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAP 964 Query: 799 P 801 P Sbjct: 965 P 965 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +2 Query: 659 PXXXPXPPXXXXXPXSPRGRGXPPXXGGYPRXPXXTXXLGXXWAPPP 799 P P P P P G PP GG P P PPP Sbjct: 942 PSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPP 988 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXP 774 PPPPP PPP PP P G PP P + P Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPP-----PFGAPPPPALNGGP 230 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -3 Query: 806 FXGGVXPXXPQGXXXXWGXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 F GG G G GG G G G F GGG GGGGG G Sbjct: 1758 FGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGG 1813 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 773 GXXXXWGXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 G G GG G G G GGG GGGGG G Sbjct: 1775 GGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGG 1819 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = -3 Query: 749 GGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXGVFEK*Y 621 GG RG G GG+ GGG GGGG G ++ Y Sbjct: 93 GGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSY 135 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 628 FSKTPXXXPPPPPXXPPPXXXXXXXKPPGPGXSP 729 FS PPPPP PPP PP P P Sbjct: 1150 FSVRDQIPPPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 31.5 bits (68), Expect = 0.94 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPGXSP 729 PPPPP PPP PP P P Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 655 PPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXP 756 PPPP PPP PP P P PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPP----PPPTP 1186 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXP 774 PPPPP PP PP P P G PP P P Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPP--PPPTNGPPPPPPPTNGP 404 Score = 31.9 bits (69), Expect = 0.71 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXP 774 PPPPP PP PP P P G PP P P Sbjct: 376 PPPPPTNGPPPPPPPTNGPPPP--PPPTNGPPPPPPPTNGP 414 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/48 (31%), Positives = 17/48 (35%) Frame = +1 Query: 631 SKTPXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXP 774 + P PPP PPP PP P P PP P + P Sbjct: 351 TNNPPSPPPPTNNTPPPPPPTNKPPPPPP---PTNGPPPPPPPTNGPP 395 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPP--GPGXSPLXXGXPPXP 756 P PPPP PPP PP GP P PP P Sbjct: 369 PPTNKPPPP--PPPTNGPPPPPPPTNGPPPPPPPTNGPPPP 407 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXP 774 PPPPP PP P P P PP P + P Sbjct: 346 PPPPPTNNPPSPPPPTNNTP-PPPPPTNKPPPPPPPTNGPP 385 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -3 Query: 776 QGXXXXWGXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 Q +G GG G G GG GGG GGGGG G Sbjct: 650 QNDDDDYGDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 695 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 755 GXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 G GG G G GG GGG GGGGG G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 698 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 755 GXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 G GG G G GG GGG GGGGG G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 755 GXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 G GG G G GG GGG GGGGG G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 755 GXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 G GG G G GG GGG GGGGG G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 755 GXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 G GG G G GG GGG GGGGG G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 755 GXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 G GG G G GG GGG GGGG G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 755 GXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 G GG G G GG GGG GG GG G Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 755 GXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 G G G G GG GGG GGGGG G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 697 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 31.9 bits (69), Expect = 0.71 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 3/62 (4%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPG---XSPLXXGXPPXPXXHXXPWGXLGXTPPXXX 810 P PPPPP P P P GP P G P P P G P Sbjct: 34 PYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIGPPGL 93 Query: 811 XG 816 G Sbjct: 94 PG 95 Score = 30.7 bits (66), Expect = 1.6 Identities = 21/73 (28%), Positives = 21/73 (28%) Frame = +1 Query: 661 PPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPPXXXXGXXXXSXXX 840 PP P P PPGP P G PP P P G G G Sbjct: 706 PPGLPGPPGPASPPSPPGPPGPPGPNG-PPGPNGPLGPPGECGPAGNAGGVGCQGHHGNP 764 Query: 841 LGXQRLXSAPXXP 879 G Q P P Sbjct: 765 AGSQGPNGQPGPP 777 Score = 30.7 bits (66), Expect = 1.6 Identities = 21/73 (28%), Positives = 21/73 (28%) Frame = +1 Query: 661 PPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPPXXXXGXXXXSXXX 840 PP P P PPGP P G PP P P G G G Sbjct: 791 PPGLPGPPGPASPPSPPGPPGPPGPKG-PPGPNGPLGPPGECGPAGNAGGVGCQGNHGNP 849 Query: 841 LGXQRLXSAPXXP 879 G Q P P Sbjct: 850 AGSQGPNGQPGPP 862 Score = 29.9 bits (64), Expect = 2.9 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPPXXXXG 816 PPPP PPP PPGP P G P P P G G P G Sbjct: 31 PPPPYEAPPPPPG-----PPGPDGPPGFPG-PQGPNGPKGPPGLPGPPGPPGFQG 79 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 661 PPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLG 789 PP P P PPGP P G PP P P G G Sbjct: 876 PPGLPGPPGPASPPSPPGPPGPPGPKG-PPGPNGCLGPPGDAG 917 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.9 bits (69), Expect = 0.71 Identities = 19/62 (30%), Positives = 21/62 (33%) Frame = +1 Query: 616 NXYYFSKTPXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXT 795 N Y+ PPPPP PP PP P +P P P P L Sbjct: 38 NFTYYPHFISSSPPPPPPSPPAAAPAA---PPPPAAAPAAPPPPAAPPAAPPPPPPLPAP 94 Query: 796 PP 801 PP Sbjct: 95 PP 96 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/64 (26%), Positives = 20/64 (31%), Gaps = 4/64 (6%) Frame = +1 Query: 622 YYFSKTPXXXPPPPP----XXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLG 789 ++ S +P PP PP PPP PP PP P P Sbjct: 44 HFISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAP 103 Query: 790 XTPP 801 PP Sbjct: 104 QPPP 107 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +1 Query: 640 PXXXPPP--PPXXPPPXXXXXXXKPPGPGXSPLXXGXPP 750 P PPP PP PPP PP +P PP Sbjct: 72 PAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 31.9 bits (69), Expect = 0.71 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 755 GXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 G GG G G GG GGG GGGGG G Sbjct: 73 GGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 755 GXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 G GG G G GG GGG GGGGG G Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDG 102 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 755 GXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGG 651 G GG G G GG GGG GGGGG Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGG 97 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 634 KTPXXXPPPPPXXPPPXXXXXXXKPPGP 717 KTP PPPPP PP PP P Sbjct: 1110 KTPLPPPPPPPTEIPPAQETFEGSPPCP 1137 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 31.5 bits (68), Expect = 0.94 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 755 GXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 G GG G G GG GGG GGGGG G Sbjct: 789 GGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDG 827 Score = 31.5 bits (68), Expect = 0.94 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -3 Query: 749 GGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXGVFE 630 GG G G GG GGG GGGGG GV + Sbjct: 840 GGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVIK 879 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = -3 Query: 800 GGVXPXXPQGXXXXWGXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 GG G G GG G G GG+ GGG GGGGG G Sbjct: 776 GGDGGGGGDGGGGGGGGGGGGGGGGGGDG-GGYGDGDGGGGGGGGGGGGGGDGG 828 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -3 Query: 755 GXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 G GG G GG+ GGG GGGGG G Sbjct: 825 GDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGG 863 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 800 GGVXPXXPQGXXXXWGXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 GG G +G GG G GG GGG GGGGG G Sbjct: 822 GGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 749 GGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 GG G G GG GGG GGGGG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGG 805 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 755 GXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 G GG G G GG GGG GGG G G Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYG 808 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 755 GXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 G GG G G GG GGG GGG G G Sbjct: 797 GGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGG 835 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/62 (32%), Positives = 23/62 (37%), Gaps = 5/62 (8%) Frame = +1 Query: 604 KSQTNXYYFSKTPXXXPPPPP-----XXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHX 768 K + Y ++ P PPPPP PPP PP P PL G P P Sbjct: 264 KRVSRRYTNTQRPTSQPPPPPPLTGGMLPPPFGGHPAAAPPPP---PLPAGVPAPPPPPP 320 Query: 769 XP 774 P Sbjct: 321 PP 322 >SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = -2 Query: 189 SSADRAESQHQREDEAQNTYEIHFTEIL*CRRIQNSN 79 + D E + + E+E +++YE +TEIL RR+ + N Sbjct: 341 NQVDGEEEEEEEEEEEEDSYEDEYTEILQRRRVVSFN 377 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = -2 Query: 189 SSADRAESQHQREDEAQNTYEIHFTEIL*CRRIQNSN 79 + D E + + E+E +++YE +TEIL RR+ + N Sbjct: 985 NQVDGEEEEEEEEEEEEDSYEDEYTEILQRRRVVSFN 1021 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 713 PGGFXXXXXXXGGGXXGGGGGXXXG 639 PGGF GGG GGGGG G Sbjct: 486 PGGFGGGGGASGGGGGGGGGGGFSG 510 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 30.7 bits (66), Expect = 1.6 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = -3 Query: 800 GGVXPXXPQGXXXXWGXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXGV 636 GGV G G GG G G GG GGG GGGGG GV Sbjct: 120 GGVGATGGHGGATG-GHGGATGGHGGATGGGG---GATGGGGGATGGGGGATGGV 170 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 755 GXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 G GG G G GG GGG GGGGG G Sbjct: 71 GGGGATGGHGGATGGGG---GATGDGGGATGGGGGATGG 106 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 755 GXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 G GG G G GG GGG GGGGG G Sbjct: 78 GHGGATGGGGGATGDGG---GATGGGGGATGGGGGATGG 113 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 30.7 bits (66), Expect = 1.6 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = -3 Query: 779 PQGXXXXWGXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXGVF 633 P+G G GG P G G GG GGG GG GG GVF Sbjct: 39 PRGAGRGGGRGG-PRGGGRGGGRGGGGGFKSPRGGGRGGGRGG-GRGVF 85 >SB_20156| Best HMM Match : GED (HMM E-Value=6.8e-16) Length = 172 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXP 756 P PPP PP PG +P G PP P Sbjct: 134 PTPPPVDNSDFDPRRPPAPPKPGGAPPIPGRPPIP 168 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = +1 Query: 658 PPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTP 798 PP PP + GPG P PP P H P+G G P Sbjct: 382 PPRGMPPKEDWGPGPRGMGPGMGPPRPMGPPGP--HGPPFGPRGPPP 426 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +2 Query: 638 PXXXPPXPXXXPXPPXXXXXPXSPRGRGXPPXXGGYPRXP 757 P PP P PP P PRG PP GG PR P Sbjct: 401 PGMGPPRPM---GPPGPHGPPFGPRG---PPPHGGPPRGP 434 >SB_13398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2149 Score = 27.9 bits (59), Expect(2) = 2.4 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 631 SKTPXXXPPPPPXXPPP 681 + P PPPPP PPP Sbjct: 2056 ASNPSPVPPPPPSVPPP 2072 Score = 20.6 bits (41), Expect(2) = 2.4 Identities = 8/20 (40%), Positives = 8/20 (40%) Frame = +1 Query: 658 PPPXXPPPXXXXXXXKPPGP 717 PPP PP PP P Sbjct: 2111 PPPPLPPGDGYEFQGVPPPP 2130 >SB_31904| Best HMM Match : Extensin_2 (HMM E-Value=0.5) Length = 398 Score = 27.9 bits (59), Expect(2) = 2.7 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 631 SKTPXXXPPPPPXXPPP 681 + P PPPPP PPP Sbjct: 305 ASNPSPVPPPPPSVPPP 321 Score = 20.6 bits (41), Expect(2) = 2.7 Identities = 8/20 (40%), Positives = 8/20 (40%) Frame = +1 Query: 658 PPPXXPPPXXXXXXXKPPGP 717 PPP PP PP P Sbjct: 360 PPPPLPPGDGYEFQGVPPPP 379 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 755 GXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGG 651 G GG G G GG GGG GGGGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 749 GGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 GG G G GG GGG GGGGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSP 729 P PPPPP PPP PG P Sbjct: 870 PPPPPPPPPPPPPPPPASSTGSTPGGDKVP 899 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/30 (36%), Positives = 12/30 (40%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSP 729 P PPPPP PPP G +P Sbjct: 864 PRRPPPPPPPPPPPPPPPPPPPASSTGSTP 893 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGP 717 PPPPP PPP KP P Sbjct: 80 PPPPPPPPPPPPPPGAKKPDDP 101 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPP 711 P PPPPP PPP K P Sbjct: 75 PLCAPPPPPPPPPPPPPPPGAKKP 98 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 755 GXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 G GG G PGGF G G GGGGG G Sbjct: 214 GVGGRSVWNGV---PGGFGGGGGVWGNGGGGGGGGGYSG 249 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXX-KPPGPGXSPLXXGXP-PXPXXHXXPWGXLGXTPP 801 PPPPP PP PP PG P+ P P P G G P Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGP 1286 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPP 750 PP PP PPP +PPGP P G P Sbjct: 1263 PPQPPFMPPPPRM----QPPGPPGPPGPPGPQP 1291 >SB_37033| Best HMM Match : Annexin (HMM E-Value=0) Length = 287 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/60 (28%), Positives = 20/60 (33%) Frame = +1 Query: 622 YYFSKTPXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPP 801 Y + P PPP PP PP PG P+ P + P G PP Sbjct: 13 YGYGGMPRPGAPPPMPQQPPPLGFDAMGPPQPGGMPMPMPGPYPSSGY--PTSVPGAAPP 70 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGP 717 PPPPP PPP KP P Sbjct: 281 PPPPPPPPPPPPPPGAKKPDDP 302 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPP 711 P PPPPP PPP K P Sbjct: 276 PLCAPPPPPPPPPPPPPPPGAKKP 299 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 25.4 bits (53), Expect(2) = 3.3 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 655 PPPPXXPPPXXXXXXXKPPGPGXSP 729 PPPP PPP +PP P P Sbjct: 755 PPPP--PPPAVPGEGARPPPPPPPP 777 Score = 24.6 bits (51), Expect(2) = 7.2 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 637 TPXXXPPPPPXXPPP 681 +P PPPP PPP Sbjct: 679 SPSSAPPPPAPPPPP 693 Score = 22.6 bits (46), Expect(2) = 3.3 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 652 PPPPPXXPPP 681 PPPP PPP Sbjct: 720 PPPPAPPPPP 729 Score = 22.2 bits (45), Expect(2) = 7.2 Identities = 9/24 (37%), Positives = 9/24 (37%) Frame = +1 Query: 661 PPXXPPPXXXXXXXKPPGPGXSPL 732 PP PP PP P PL Sbjct: 707 PPLSAPPLSSTLGPPPPAPPPPPL 730 >SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 931 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXP 774 P P PP PP PP G PP P H P Sbjct: 221 PGMPPGGPPPFPPTSDPNMGHHPPISGPPTTSMSGPPIPVHHGMP 265 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXP 774 PP PP P P PP P +PL G P P P Sbjct: 188 PPTPPAPPSPPIPTAPPTPPMP-ETPLPPGSPHIPPAPLHP 227 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPP 750 PPPPP PPP P PL G PP Sbjct: 512 PPPPPASPPPPLPAEEDNSP----PPLPAGPPP 540 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/56 (32%), Positives = 20/56 (35%) Frame = -3 Query: 806 FXGGVXPXXPQGXXXXWGXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 + GG P G G GG G G GG+ G GGGGG G Sbjct: 214 YNGGPAPGAVGGFG---GGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGGSYCG 266 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXP 774 P P PPP P P PP P PP P P Sbjct: 765 PQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEP 809 >SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) Length = 559 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Frame = -3 Query: 806 FXGGVXPXXPQGXXXXW-GXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGG 654 F GG+ P G + G GG P G PG GG GG G GG Sbjct: 178 FPGGMPGGMPGGMPGGFPGAGGMP---GGFPGAGGMPGGFPGAGGMPGGPGG 226 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSP 729 P PPPPP PPP PP P SP Sbjct: 54 PPPPPPPPPPPPPP--------PPPPSSSP 75 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKP 708 P PPPPP PPP +P Sbjct: 56 PPPPPPPPPPPPPPPPSSSPSRP 78 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 29.1 bits (62), Expect = 5.0 Identities = 25/85 (29%), Positives = 25/85 (29%), Gaps = 11/85 (12%) Frame = +1 Query: 595 VNYKSQTNXYYFSKTPXXXPPPPPXXPPPXXXXXXXKP-----------PGPGXSPLXXG 741 V K Q Y P PPPPP PP P PGP P G Sbjct: 1645 VGEKRQQPWYPVFHYPAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQG 1704 Query: 742 XPPXPXXHXXPWGXLGXTPPXXXXG 816 P P P G G P G Sbjct: 1705 IPGYPGAPAGPPGRDGPMGPPGPSG 1729 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPPXXXXG 816 P P PP PP P P P G PP P P G G P G Sbjct: 1793 PKGMPGPPGPPGPPGAIGWKGNPGNPAGPPGLDG-PPGPPGPQGPKGWPGVPGPPGPPG 1850 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPGXSP--LXXGXPPXPXXH 765 PPPPP P P PG SP PP P H Sbjct: 466 PPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPPKH 505 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 29.1 bits (62), Expect = 5.0 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 800 GGVXPXXPQGXXXXWGXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 GG +G G GG R G G GGG GGGGG G Sbjct: 721 GGWQKDYQRGGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRG 774 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +1 Query: 610 QTNXYYF--SKTPXXXPPP-PPXXPPPXXXXXXXKPP 711 Q N +Y + TP PPP PP PPP +PP Sbjct: 418 QINIHYRCGTATPPPTPPPTPPPTPPPTTLPPTTQPP 454 >SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPP 711 PPPPP PPP PP Sbjct: 365 PPPPPHSPPPPLPVIQLNPP 384 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 652 PPPPPXXPPPXXXXXXXKPPGPGXSPL 732 PPPPP PPP PP P SP+ Sbjct: 463 PPPPPMSPPP------PTPPPPATSPV 483 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSP 729 P PPPP PPP PP P P Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = -3 Query: 800 GGVXPXXPQGXXXXWGXGGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 GG+ P P+G G G G GG GGG GG G G Sbjct: 105 GGMGPMAPEGGPSEGGLMQKQFIEGGEGGMGGGMSMGGGMGGGMSMGGMGGGMG 158 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -3 Query: 749 GGXPXXRGXXPGPGGFXXXXXXXGGGXXGGGGGXXXG 639 GG G G GG+ GGG GGG G G Sbjct: 180 GGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRG 216 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 655 PPPPXXPPPXXXXXXXKPPGPG 720 PPPP PP KPP PG Sbjct: 663 PPPPPPPPGGGVPGPPKPPPPG 684 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXP 774 P PPPPP PPP P PP P P Sbjct: 107 PPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMP 151 >SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 610 QTNXYYFSKTPXXXPPPPPXXPPP 681 Q N Y TP PPPP P P Sbjct: 64 QANRLYCGSTPPQPTPPPPRPPTP 87 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 640 PXXXPPPPPXXPPPXXXXXXXKPPGP 717 P PPPP PP PPGP Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGP 121 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/59 (28%), Positives = 19/59 (32%), Gaps = 2/59 (3%) Frame = +1 Query: 628 FSKTPXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPP--XPXXHXXPWGXLGXTP 798 + +P PP PP PP P P P PP P H P L P Sbjct: 264 YPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPPSLHRYPQSPLRYPP 322 >SB_18739| Best HMM Match : YhhN (HMM E-Value=7.3) Length = 306 Score = 25.8 bits (54), Expect(2) = 7.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 652 PPPPPXXPPP 681 PPPPP PPP Sbjct: 252 PPPPPPPPPP 261 Score = 21.0 bits (42), Expect(2) = 7.9 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 631 SKTPXXXPPPPP 666 S P PPPPP Sbjct: 249 SNRPPPPPPPPP 260 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/52 (28%), Positives = 18/52 (34%) Frame = +1 Query: 601 YKSQTNXYYFSKTPXXXPPPPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXP 756 ++S+ N P PPP PPP PP P PP P Sbjct: 199 FQSKPNSQMPPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPP 250 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = +1 Query: 658 PPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPP 801 PP PP PP PG +P G PP P PP Sbjct: 53 PPAGGYPPPQPGYAGGPPPPGIAPGIGGPPPSGQYGAPPTSQPYGAPP 100 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 28.3 bits (60), Expect = 8.7 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +1 Query: 658 PPPXXPPPXXXXXXXKPPGPGXSPLXXGXPPXPXXHXXPWGXLGXTPP 801 P P P +PPG G P G PP P P G L PP Sbjct: 360 PKPLMSTPVQRPPGMRPPGAGNGP---GGPPPPWSK--PGGILPGPPP 402 >SB_59124| Best HMM Match : Bac_luciferase (HMM E-Value=1.6) Length = 1953 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -3 Query: 236 RPTFSIFLKSFHLGSGAALTAPRASTN 156 RP+F + LKS G+GAA P TN Sbjct: 1831 RPSFKLVLKSLEEGNGAARVRPCRITN 1857 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 634 KTPXXXPPPPPXXPPP 681 ++P PPPPP PPP Sbjct: 1309 ESPPPPPPPPPPPPPP 1324 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 625 YFSKTPXXXPPPPPXXPPP 681 Y+S P PPP P PPP Sbjct: 159 YYSPPPQPPPPPLPPPPPP 177 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +1 Query: 598 NYKSQTNXYYFSKTPXXXPPPPPXXPPP 681 NYK + + PPPPP PPP Sbjct: 194 NYKGTYSIMLLAYGDAKPPPPPPPPPPP 221 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 625 YFSKTPXXXPPPPPXXPPP 681 Y P PPPPP PPP Sbjct: 206 YGDAKPPPPPPPPPPPPPP 224 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,902,766 Number of Sequences: 59808 Number of extensions: 397922 Number of successful extensions: 3412 Number of sequences better than 10.0: 73 Number of HSP's better than 10.0 without gapping: 1089 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2256 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2526446612 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -