BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_A09 (805 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 58 1e-08 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 54 1e-07 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 7e-07 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 49 4e-06 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 48 7e-06 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 46 3e-05 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 46 4e-05 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 44 1e-04 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 44 1e-04 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 43 3e-04 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 43 3e-04 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 42 4e-04 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 42 8e-04 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 42 8e-04 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 42 8e-04 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 36 8e-04 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 41 0.001 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 40 0.002 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 40 0.002 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 40 0.002 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 38 0.007 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 38 0.010 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 38 0.013 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 37 0.017 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 37 0.017 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 36 0.038 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 34 0.046 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.051 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 36 0.051 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.051 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.051 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.051 SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) 36 0.051 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 35 0.067 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 35 0.067 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.067 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.067 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 34 0.078 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 34 0.082 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 35 0.089 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.089 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 35 0.089 SB_25393| Best HMM Match : Collagen (HMM E-Value=0.00015) 35 0.089 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.089 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.089 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 34 0.12 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 34 0.12 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 34 0.16 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 33 0.21 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 33 0.21 SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 33 0.27 SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 33 0.27 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 33 0.27 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 33 0.27 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 33 0.36 SB_52043| Best HMM Match : Collagen (HMM E-Value=0.77) 33 0.36 SB_33199| Best HMM Match : Collagen (HMM E-Value=0.77) 33 0.36 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 33 0.36 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 33 0.36 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.36 SB_43407| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.36 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.36 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 33 0.36 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.36 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.47 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.47 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.47 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.47 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.63 SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) 29 0.68 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.83 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 31 0.83 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 31 0.83 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 31 0.83 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.83 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 31 0.83 SB_58915| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 0.85 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 31 1.1 SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) 31 1.1 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 31 1.1 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 31 1.1 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 31 1.1 SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) 31 1.4 SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) 31 1.4 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 31 1.4 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) 30 1.9 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 30 1.9 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_57911| Best HMM Match : Drf_FH1 (HMM E-Value=2.3) 30 1.9 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 30 1.9 SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 30 1.9 SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 30 2.5 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 30 2.5 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_42551| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_38491| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) 29 3.3 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 29 3.3 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 29 3.3 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 29 3.3 SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) 29 4.4 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 29 4.4 SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 29 4.4 SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) 29 4.4 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 29 4.4 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 29 4.4 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 29 4.4 SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) 29 4.4 SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) 29 4.4 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) 29 5.8 SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) 29 5.8 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 29 5.8 SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_51094| Best HMM Match : VWA (HMM E-Value=0) 29 5.8 SB_41312| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 29 5.8 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 29 5.8 SB_38133| Best HMM Match : TolA (HMM E-Value=0.38) 25 7.7 SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) 28 7.7 SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) 28 7.7 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 28 7.7 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 28 7.7 SB_40892| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 28 7.7 SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 57.6 bits (133), Expect = 1e-08 Identities = 33/90 (36%), Positives = 33/90 (36%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P PP PP P PPP P P P P PPP P PPP PPP Sbjct: 366 PPPPPPPPPPPSPPPP------PPPPPPSPPPPPQPPPPPPPPPPPPPPPP--------- 410 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P PPPPPP P P Sbjct: 411 --------PPPPPPPPAPPPPPPPPPPPPP 432 Score = 57.2 bits (132), Expect = 1e-08 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PPPP P P P PP PP P P PPPP PPP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 56.8 bits (131), Expect = 2e-08 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P PP PP P PP P P P P PPP P PPP PPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP--------- 415 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPP 772 P P PPPPPP Sbjct: 416 -------PPPAPPPPPPPPPPPPP 432 Score = 44.8 bits (101), Expect = 8e-05 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 526 PPXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPPXXPPP 672 PP PP PP P P P PP P P P PPP PPP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP-PPPPPPPP 414 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = +1 Query: 526 PPXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXP-PPXXPPPXR 678 PP PP PP P P P PP P P P P PP PP R Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALR 435 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPP 634 P PP PP P PPP P P PP Sbjct: 404 PPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 57.2 bits (132), Expect = 1e-08 Identities = 34/94 (36%), Positives = 34/94 (36%), Gaps = 4/94 (4%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P PP PP P PPP P P P P PPP P PPP PPP A Sbjct: 123 PYPPPPNPPYP-PPPNAPYPPSPNAPYPPPPNPPY-PPPLYP-PPPNPPPPNAPYPPPPY 179 Query: 701 XXXXXXXXPXXPXXAXXXPP----PPPPXXPXXP 790 P P PP PPPP P P Sbjct: 180 PPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPP 213 Score = 57.2 bits (132), Expect = 1e-08 Identities = 31/91 (34%), Positives = 32/91 (35%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P PP PP P PP P P P P PPP P PPP PP Sbjct: 147 PYPPPPNPPYP--PPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNP 204 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXPXXPF 793 P P A P PPPP P P+ Sbjct: 205 PPPNPPYPP--PPNAPNPPYPPPPNAPNPPY 233 Score = 56.8 bits (131), Expect = 2e-08 Identities = 29/91 (31%), Positives = 30/91 (32%), Gaps = 2/91 (2%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXP--PPXAXXXXXXX 700 PP P P PP P P P P PPP P PPP P PP Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPS 143 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXPXXPF 793 P P PPPP P P P+ Sbjct: 144 PNAPYPPPPNPPYPPPLYPPPPNPPPPNAPY 174 Score = 56.8 bits (131), Expect = 2e-08 Identities = 32/95 (33%), Positives = 33/95 (34%), Gaps = 1/95 (1%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P PP PP P PP P P P P PPP P P PPP A Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYP----PPPNAPYPPSPN 145 Query: 701 XXXXXXXXPXXPXXAXXXPP-PPPPXXPXXPFFFP 802 P P PP PPPP P P +P Sbjct: 146 APYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYP 180 Score = 56.4 bits (130), Expect = 3e-08 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P PP PP P PPP P P P P PPP P PPP P Sbjct: 155 PYPPPLYPPPPNPPP--PNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYP 212 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P PP PPP P Sbjct: 213 PPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 54.0 bits (124), Expect = 1e-07 Identities = 31/92 (33%), Positives = 32/92 (34%), Gaps = 1/92 (1%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P PP P P PP P P P P PPP P PPP PPP Sbjct: 139 PYPPSPNAPYPPPP-------NPPYPPPLYPPPPNPPPPNAPYPPPPYPPPP-NPPYPPP 190 Query: 701 XXXXXXXXPXXPXXAXXXPP-PPPPXXPXXPF 793 P P PP PPPP P P+ Sbjct: 191 PNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPY 222 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/85 (31%), Positives = 27/85 (31%), Gaps = 1/85 (1%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPP-PPXPPPXXXXXXXXXXXXXXX 701 PP P PP P P P PP PP P P PP P PPP Sbjct: 84 PPTNFSPNPPYPPP-PYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPP 142 Query: 702 XXXXXXPXQXXPXXPXXXPPPXPXP 776 P P P PP P P Sbjct: 143 SPNAPYPPPPNPPYPPPLYPPPPNP 167 Score = 44.8 bits (101), Expect = 8e-05 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPP--PPXPPP 656 PP PPP P P P PP PP P P PP P PPP Sbjct: 162 PPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPP 207 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +1 Query: 526 PPXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXP--XPPPXXPPP 672 PP PP PP P P P PP P P P PPP P P Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPPYPP-PPNAPYPPPPNPPYPPPPNAPYP 141 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/65 (26%), Positives = 17/65 (26%) Frame = +2 Query: 587 PXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPP 766 P P PP PP PPP P A PPP Sbjct: 70 PDAPCLVSAKCGGHPPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPN 129 Query: 767 PPXXP 781 PP P Sbjct: 130 PPYPP 134 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 54.4 bits (125), Expect = 1e-07 Identities = 34/102 (33%), Positives = 37/102 (36%), Gaps = 1/102 (0%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGG-GXXGXX 613 G G GGGGGG G G G GGG GGG G GG G G Sbjct: 783 GDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGY 842 Query: 612 GXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKIFXXKXSN 487 G G GGG G GG GG G + + S+ Sbjct: 843 ADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVIKNEESS 884 Score = 53.2 bits (122), Expect = 2e-07 Identities = 31/94 (32%), Positives = 31/94 (32%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG GGG G G GGG GGG G GGG Sbjct: 772 GGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYG 831 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 832 DGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGG 865 Score = 52.8 bits (121), Expect = 3e-07 Identities = 32/94 (34%), Positives = 32/94 (34%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G GGGGGG G G G GGG G G G GG Sbjct: 777 GDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGF 836 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG G GG GG G Sbjct: 837 GDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGG 870 Score = 40.7 bits (91), Expect = 0.001 Identities = 25/72 (34%), Positives = 25/72 (34%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G GGGGGG G G G A G G GGG G GGG Sbjct: 802 GDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGG 861 Query: 621 GXXGXXXXGXXG 586 G G G G Sbjct: 862 GGGGGGGGGGGG 873 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GG GG G GGG G G G G GGG G G GG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGG 818 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 51.6 bits (118), Expect = 7e-07 Identities = 29/88 (32%), Positives = 30/88 (34%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXX 706 PP P P PPP P P P P PPP PPP PP + Sbjct: 914 PPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQP--PPPGGNAPPPPPPPGGS------APP 965 Query: 707 XXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P PPPPPP P P Sbjct: 966 PGGGAPPLPPPPGGSAPPPPPPPPPPPP 993 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = +3 Query: 525 PPXXXXPPPPXPX----PXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PPPP P P P PP P P PPPP PPP Sbjct: 947 PPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/76 (31%), Positives = 24/76 (31%) Frame = +2 Query: 446 PPPXXFRGNXXFXKLEXXXKKIFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPX 625 PPP GN P P PP P PP P P Sbjct: 921 PPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGS 980 Query: 626 XPPPXXPXPPPXXPPP 673 PPP P PPP PPP Sbjct: 981 APPP--PPPPPPPPPP 994 Score = 39.9 bits (89), Expect = 0.002 Identities = 25/84 (29%), Positives = 25/84 (29%), Gaps = 2/84 (2%) Frame = +3 Query: 525 PPXXXXPPPPXP--XPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXX 698 PP PPPP P P PP P P PPP PPP Sbjct: 914 PPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPP----GGSAPPPGGG 969 Query: 699 XXXXXXXPXQXXPXXPXXXPPPXP 770 P P P PPP P Sbjct: 970 APPLPPPPGGSAPPPPPPPPPPPP 993 Score = 36.7 bits (81), Expect = 0.022 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +1 Query: 526 PPXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPPXXPPPXR 678 PP P PP P P PP P P PPP PPP R Sbjct: 947 PPGGNAPPPPPPPGGSAPP-PGGGAPPLPPPPGGSAPPPPPPPPPPPPPMR 996 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/57 (29%), Positives = 17/57 (29%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P PP PPP PPP P PPPPPP P Sbjct: 910 PSASPPGGSVPPP-PPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPP 965 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 49.2 bits (112), Expect = 4e-06 Identities = 33/101 (32%), Positives = 33/101 (32%), Gaps = 11/101 (10%) Frame = +2 Query: 521 PXPPXXXP------PXPXPPPXXXXXXXPXXPXXXXP--XXPXXPPPXXP---XPPPXXP 667 P PP P P P PPP P P P P PPP P PPP P Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPP--P 167 Query: 668 PPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 PP A P PPPPPP P P Sbjct: 168 PPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPP 208 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 G P PP P PPP P P PPP PPP PPP Sbjct: 150 GPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPP 202 Score = 41.1 bits (92), Expect = 0.001 Identities = 27/92 (29%), Positives = 27/92 (29%), Gaps = 2/92 (2%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXX--PPPXXPXPPPXXPPPXAXXXXX 694 P PP P PPP P P P PPP P P P A Sbjct: 126 PPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPA----- 180 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P PPPPPP P P Sbjct: 181 ---VPLAAASPPPPSGGPPPPPPPPPPPPPPP 209 Score = 37.5 bits (83), Expect = 0.013 Identities = 28/99 (28%), Positives = 28/99 (28%), Gaps = 9/99 (9%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP------XXPXPPPXXPPPXAX 682 P PP PP P P P P PPP P PPP P Sbjct: 108 PTPP---PPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGP 164 Query: 683 XXXXXXXXXXXXXXPXXPXXAXXXPPP---PPPXXPXXP 790 P P A PPP PPP P P Sbjct: 165 PPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPP 203 Score = 36.7 bits (81), Expect = 0.022 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPP---PXXPPP 673 G P PP P P P P P P PPP P PP PPP Sbjct: 163 GPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPP 218 Score = 31.9 bits (69), Expect = 0.63 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPP 644 PP PPPP P P P PP PP PPPP Sbjct: 189 PPPSGGPPPPPPPPPPP---PP------PPILELAAPPPP 219 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 48.4 bits (110), Expect = 7e-06 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGGG G G GG GG G G G GGGG GG Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G GGG G G G GGG G GG GG G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 GGG GGGG G G G GG G G G GGGG G Sbjct: 72 GGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/51 (45%), Positives = 23/51 (45%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G GGG G G G G GGG G GG GG G Sbjct: 67 GGGGGGGG-GGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG--GGGVG 114 Score = 35.1 bits (77), Expect = 0.067 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXG 619 G G GGGGGG G G G GGG GGG G GGG G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGG----DDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 32.7 bits (71), Expect = 0.36 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXG 529 GGG GGG GGG G G G G GGG G G G Sbjct: 76 GGGGGGGGDDGDGGGGDGGGG----GGGGDGGGGGGGGGGGVGRARFG 119 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 46.8 bits (106), Expect = 2e-05 Identities = 32/91 (35%), Positives = 32/91 (35%), Gaps = 4/91 (4%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGGG G G A GGG GGG G GGG G G Sbjct: 1757 GFGGGGGGGGMGGGGGMAGGGGGMGGGGM-----AAGGGEFGGGEGMGGGGMAGGGGGMG 1811 Query: 600 XG----XXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG G G Sbjct: 1812 GGGGGMGGGGEGMGAAGGGMGAGGEGGGAGG 1842 Score = 43.6 bits (98), Expect = 2e-04 Identities = 27/79 (34%), Positives = 27/79 (34%), Gaps = 1/79 (1%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGX-GGGGXGXGXXGGXXX 599 G G GGG G G G GGG GGGG G G G Sbjct: 1766 GMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMG 1825 Query: 598 XXXGGXXXXGXGXGXGGGG 542 GG G G G GGGG Sbjct: 1826 AAGGGMGAGGEGGGAGGGG 1844 Score = 41.9 bits (94), Expect = 6e-04 Identities = 27/84 (32%), Positives = 27/84 (32%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GGG G G G GGG GGG G G GG Sbjct: 1760 GGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGG 1819 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGG 524 G G G G GG G GG Sbjct: 1820 GGEGMGAAGGGMGAGGEGGGAGGG 1843 Score = 39.1 bits (87), Expect = 0.004 Identities = 26/84 (30%), Positives = 26/84 (30%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GGGGG G A GGG GGG G GGG Sbjct: 1764 GGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGM-AGGGGGMGGGGGGMGGGGE 1822 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXG 550 G G GGG G Sbjct: 1823 GMGAAGGGMGAGGEGGGAGGGGGG 1846 Score = 34.3 bits (75), Expect = 0.12 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXG-XXXXXXXGGGXGXGGXXXGGXG 520 GG GGG G GGG G G G GGG G GG G G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGG 1807 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GG GGGG G G GG GG G G GGG Sbjct: 1756 GGFGGGGGG-GGMGGGGGMAGGGGGMGGGGMAAGGG 1790 Score = 33.1 bits (72), Expect = 0.27 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GG G G G GG G G G GG GG GG Sbjct: 1799 GGGGMAGGGGGMGGG----GGGMGGGGEGMGAAGGGMGAGGEGGGAGGG 1843 Score = 31.9 bits (69), Expect = 0.63 Identities = 28/89 (31%), Positives = 28/89 (31%), Gaps = 5/89 (5%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGX----GGGGXGXGXXGG 608 G G GGG G G G GGG GGG G G GG Sbjct: 1759 GGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGG--GG 1816 Query: 607 XXXXXXG-GXXXXGXGXGXGGGGXXXXGG 524 G G G G G GGG GG Sbjct: 1817 MGGGGEGMGAAGGGMGAGGEGGGAGGGGG 1845 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 46.4 bits (105), Expect = 3e-05 Identities = 30/96 (31%), Positives = 33/96 (34%), Gaps = 2/96 (2%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGG--GXGXXGGG 628 G ++G G GGGG + G G GGG GG G G GGG Sbjct: 125 GGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGG 184 Query: 627 XXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G GG GG G Sbjct: 185 GHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYG 220 Score = 45.2 bits (102), Expect = 6e-05 Identities = 32/92 (34%), Positives = 32/92 (34%), Gaps = 4/92 (4%) Frame = -2 Query: 789 GXXGXXGGGGG----GXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G GGGGG G G G G GGG GGG G G G Sbjct: 131 GYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYG-GGGYGGGGYGGGGHGGG 189 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G G G GGG G GG GG Sbjct: 190 GYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGG 221 Score = 42.3 bits (95), Expect = 4e-04 Identities = 30/87 (34%), Positives = 31/87 (35%), Gaps = 3/87 (3%) Frame = -1 Query: 775 GXGXGGGXXXGXX---GXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGX 605 G G GGG G G + G G GGG GGGG G G GG Sbjct: 135 GRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGG 194 Query: 604 XXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG G G GGGG GG Sbjct: 195 GYGGGGGGY---GGSGYGGGGGYGGGG 218 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGGG G G GG G G G G GG G GG Sbjct: 183 GGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGG 226 Score = 39.1 bits (87), Expect = 0.004 Identities = 32/97 (32%), Positives = 33/97 (34%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGX---GXXGG 631 G + G G GGG G G G GGG GGG G GG Sbjct: 134 GGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGG 193 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G GGG G GG GG G Sbjct: 194 GGYG-GGGGGYGGSGYGGGGGYGGG-GYGGGRSGGGG 228 Score = 38.3 bits (85), Expect = 0.007 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G GG G G GG GG GG Sbjct: 178 GGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGG 226 Score = 36.3 bits (80), Expect = 0.029 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG--GXXXXGG 524 GGG GGG G G GG GG G G GGG G GG Sbjct: 124 GGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGG 169 Score = 35.1 bits (77), Expect = 0.067 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G GG GG G G G GGG Sbjct: 193 GGGYGGGG---GGYGGSGYGGGGGYGGGGYGGGRSGGG 227 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGG---GXGXGGXXXGGXG 520 GGG GGG G GG G G G GG G G GG GG G Sbjct: 124 GGGRRGGGYG--GGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGG 175 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -1 Query: 652 GGXGGGGXG-XGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G G GG GG G G GGGG G Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRG 165 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG GGGG G G GG GG G G G GGGG GG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 GGG GGGG G G GG GG G G G GGGG G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG GGGG G G GG GG G G G GGGG GG Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGGG G G GG GG G G G GGGG G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GG GGG G GGG G G G G GGG G GG G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGGG G G GG GG G G G G GG G Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G G GGG G G GG GG G G G GGGG GG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 41.9 bits (94), Expect = 6e-04 Identities = 23/51 (45%), Positives = 23/51 (45%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G GGG G G G G GGG G GG GG G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG-------GGGGGGGGGGAGGAG 706 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GGG G G G G GGG G G G G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G GGG G G G G GG G G G G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GGG GGGG G G GG GG G G G G G N Sbjct: 673 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDGDVDSN 721 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GGG GGGG G G GG GG G G G G G N Sbjct: 674 GGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDGDVDSNN 722 Score = 34.3 bits (75), Expect = 0.12 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G GGG GGG G GGG G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGG----------GGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 44.8 bits (101), Expect = 8e-05 Identities = 30/96 (31%), Positives = 30/96 (31%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GGGGG G G GGG G G G GGG Sbjct: 265 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGAT--GGGGGATGVGGGATGGGGG 322 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 G G GG G GG GG G P Sbjct: 323 ATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGP 358 Score = 43.6 bits (98), Expect = 2e-04 Identities = 32/96 (33%), Positives = 32/96 (33%), Gaps = 2/96 (2%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GGGGG G G GGG GGG G GGG Sbjct: 272 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGAT--GVGGGATGGGGGATGGGV- 328 Query: 621 GXXGXXXXGXXGXXXXXXXGGGX--GXGGXXXGGXG 520 G G G GGG G GG GG G Sbjct: 329 GATGGGGGATGGGGGVTGGGGGATGGGGGPGSGGCG 364 Score = 42.3 bits (95), Expect = 4e-04 Identities = 30/95 (31%), Positives = 31/95 (32%), Gaps = 2/95 (2%) Frame = -2 Query: 798 KKKGXXGXXG--GGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGX 625 + G G G GGGGG G G GGG GGG G GGG Sbjct: 236 RSNGRLGGGGATGGGGGATGGGGGATGGGGGAT---------GGGGGATGGGGGATGGGG 286 Query: 624 XGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GG G GG GG G Sbjct: 287 GATGGGGGATGGGGGATGGGGGATGVGGGATGGGG 321 Score = 41.5 bits (93), Expect = 8e-04 Identities = 26/84 (30%), Positives = 26/84 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G GG Sbjct: 259 GATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATG 318 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGG 524 GG G G GGGG GG Sbjct: 319 GGGGATGGGVGATGGGGGATGGGG 342 Score = 40.7 bits (91), Expect = 0.001 Identities = 31/96 (32%), Positives = 31/96 (32%), Gaps = 2/96 (2%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GGGGG G G GGG GGG G GGG Sbjct: 244 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGAT--GGGGGATGGGGGATGGGGG 301 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGG--XXXGGXG 520 G G G GGG GG GG G Sbjct: 302 ATGGGG--GATGVGGGATGGGGGATGGGVGATGGGG 335 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG G G G G GG GG G G G GGG GG Sbjct: 304 GGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGG 347 Score = 38.3 bits (85), Expect = 0.007 Identities = 27/85 (31%), Positives = 27/85 (31%), Gaps = 4/85 (4%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGG----GXGXGXXGGXX 602 G GGG G G G G GG GGG G G G GG Sbjct: 283 GGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGG 342 Query: 601 XXXXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G G GG G Sbjct: 343 GVTGGGGGATGGGGGPGSGGCGEDG 367 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXG-XGGGGXXXXGG 524 GGG G G G G GG GG G G G GGGG GG Sbjct: 318 GGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGG 362 Score = 31.9 bits (69), Expect = 0.63 Identities = 27/76 (35%), Positives = 27/76 (35%), Gaps = 4/76 (5%) Frame = -2 Query: 801 GKKKGXXGXXGGGGG--GXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXX--GGGXGXXG 634 G G G GGGGG G G G G A GGG GGG G G Sbjct: 294 GATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATG 353 Query: 633 GGXXGXXGXXXXGXXG 586 GG G G G G Sbjct: 354 GG--GGPGSGGCGEDG 367 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG G GG GG G G GGGG GG Sbjct: 228 GGSRLSNDRSNGRLGGGGATGGGGGATGGGGGATGGGGGATGGG 271 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P P PP PP P P PPPP P P Sbjct: 464 PPPPPPPPPPPPPPPP-----PPPPPPPPFPPPPPPTP 496 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PP PPPP P P P PP PP P P PPPP P Sbjct: 464 PPPPPPPPPPPPPPPP----PP-----PPPPPPFPPPPPPTP 496 Score = 37.5 bits (83), Expect = 0.013 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 587 PXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P P PPP P PPP PPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 34.7 bits (76), Expect = 0.089 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXP 667 G PP PP P PPP P P PPP P PPP P Sbjct: 461 GQAPPPPPPPPPPPPPP---------------PPPPPPPPPPFPPPPPPTP 496 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 725 PXXPXXAXXXPPPPPPXXPXXPF 793 P P PPPPPP P PF Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPF 488 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 725 PXXPXXAXXXPPPPPPXXPXXPFFFP 802 P P PPPPPP P P FP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFP 489 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 725 PXXPXXAXXXPPPPPPXXPXXPFFFP 802 P P PPPPPP P P F P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPP 490 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P PPPP P P P PP PP P P PP P P Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 42.3 bits (95), Expect = 4e-04 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 6/57 (10%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXP------XXPPPXXPXPPPXXPPP 673 P PP PP P PPP P P P P PP P PP PPP Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP P PP P P P P P P P PP PPP Sbjct: 218 PPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 37.1 bits (82), Expect = 0.017 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = +2 Query: 629 PPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 PPP P PPP PPP P P + PPPPPP P P Sbjct: 204 PPPPPPRPPPSPPPP-----------------PPPPSPSPPRPPPPPPPSPPRP 240 Score = 35.1 bits (77), Expect = 0.067 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 551 PXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPP 655 P PPP P P P P PPP P PP Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 Score = 33.1 bits (72), Expect = 0.27 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXA 679 P P P PPP P P P PP P PPP P P A Sbjct: 195 PTSPSQITQPPPPPPRP-----PPSPPPPPPPPSPSPPRPPPPPPPSPPRPLA 242 Score = 31.9 bits (69), Expect = 0.63 Identities = 18/65 (27%), Positives = 18/65 (27%) Frame = +3 Query: 570 PXXXXPPXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXXXXXXXXPXQXXPXXPX 749 P P PP P P PPPP P P P P P Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEP-PPIPNMPP 256 Query: 750 XXPPP 764 PPP Sbjct: 257 TLPPP 261 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PP PPPP P PP PP P PPPP PP Sbjct: 368 PPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PPP P P PP PP P PPP PPP Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PP PPPP P P PP PP P PPPP PP Sbjct: 359 PPTNNTPPPPPPTNKPPPPPPPTNGPPPPPP-PTNGPPPPPPP 400 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXP---PPXXPPP 673 P PP PP P PP P P P PP P P PP PPP Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPP 400 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PP PP P P PP PP P PPPP PP Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPP 390 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P P PP PP P P PP PPP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPP 389 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP PP P PP P P P PP P PPP PP Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP--PPPPPTNGPP 415 Score = 37.9 bits (84), Expect = 0.010 Identities = 22/74 (29%), Positives = 22/74 (29%) Frame = +2 Query: 551 PXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPX 730 P PPP P P P P P PP PPP P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPP---------PPPPTNGPPP 396 Query: 731 XPXXAXXXPPPPPP 772 P PPPPPP Sbjct: 397 PPPPTNGPPPPPPP 410 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXP---PPXXPPP 673 P PP P P PP P P P PP P P PP PPP Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPP 670 P PP P P PPP P P P P P PP PP Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P PP P P PPP P P PPPPPP P Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPP 406 Score = 35.1 bits (77), Expect = 0.067 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +1 Query: 526 PPXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPPXXPPP 672 PP P PP P P P PP P P PP PPP Sbjct: 359 PPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTN-GPPPPPPPTNGPPP 406 Score = 31.9 bits (69), Expect = 0.63 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +2 Query: 629 PPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 PPP PP PPP P P PPPPPP P Sbjct: 346 PPPPPTNNPPSPPPPT---NNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPP 396 Score = 31.9 bits (69), Expect = 0.63 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +1 Query: 526 PPXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPP--XXPPP 672 PP PP PP P P PP P P PPP PPP Sbjct: 349 PPTNNPPSPPPPTNNTPPPPPPTNKPPPPPP---PTNGPPPPPPPTNGPPP 396 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 544 PXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPPXXPPP 672 P PP P P PP P P P PP PPP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPP--PPPPTNGPPP 386 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 43.2 bits (97), Expect = 3e-04 Identities = 27/93 (29%), Positives = 28/93 (30%), Gaps = 3/93 (3%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXX---PPPXXPXPPPXXPPPXAXXXX 691 P PP P PPP P P P P PPP PP PPP Sbjct: 316 PPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPP 375 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P + PPPPPP P Sbjct: 376 PPPPPIEGR-----PPSSLGNPPPPPPPGRGAP 403 Score = 41.9 bits (94), Expect = 6e-04 Identities = 29/98 (29%), Positives = 29/98 (29%), Gaps = 9/98 (9%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPP----XXPPPXAX 682 G P PP P PPP P P P PPP PPP PPP Sbjct: 303 GAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRP--PPPSRGAPPPPSMGMAPPPVGG 360 Query: 683 XXXXXXXXXXXXXXPXXPXXAXXXPP-----PPPPXXP 781 P P PP PPPP P Sbjct: 361 AAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPP 398 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/90 (25%), Positives = 23/90 (25%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P PP P P P P P P P PP PP Sbjct: 297 PPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPP 356 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P PPPPPP P Sbjct: 357 PVGGAAPPPPPPPPVGGPPPPPPPIEGRPP 386 Score = 37.5 bits (83), Expect = 0.013 Identities = 26/107 (24%), Positives = 29/107 (27%) Frame = +2 Query: 446 PPPXXFRGNXXFXKLEXXXKKIFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPX 625 PPP RG+ ++ P PP PPP P P Sbjct: 305 PPPPPSRGSAP----PPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGG 360 Query: 626 XPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPP 766 PP P PP PPP P P PP P Sbjct: 361 AAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGP 407 Score = 37.1 bits (82), Expect = 0.017 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PP PPP P P PP P PPPP PP Sbjct: 356 PPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPP 398 Score = 36.3 bits (80), Expect = 0.029 Identities = 22/84 (26%), Positives = 22/84 (26%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXXX 704 PP PPP P PP PP P P PPP Sbjct: 298 PPPSRGAPPPPPSRGSAPPPPPARMGTAPP-PPPPSRSSQRPPPPSRGAPPPPSMGMAPP 356 Query: 705 XXXXXPXQXXPXXPXXXPPPXPXP 776 P P PPP P P Sbjct: 357 PVGGAAPPPPPPPPVGGPPPPPPP 380 Score = 34.3 bits (75), Expect = 0.12 Identities = 27/100 (27%), Positives = 27/100 (27%), Gaps = 10/100 (10%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXP----XXPPPXXP------XPPPXXPP 670 P PP P PPP P P P PPP P PPP Sbjct: 287 PPPPPSRGAAP-PPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGA 345 Query: 671 PXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P P PPPPPP P Sbjct: 346 PPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRP 385 Score = 28.3 bits (60), Expect = 7.7 Identities = 22/85 (25%), Positives = 22/85 (25%), Gaps = 7/85 (8%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPP-------XPPPXXXXXXXXXXXXXXX 701 PPPP P PP PP PPPP PPP Sbjct: 288 PPPPSRGAAPP---PPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRG 344 Query: 702 XXXXXXPXQXXPXXPXXXPPPXPXP 776 P PPP P P Sbjct: 345 APPPPSMGMAPPPVGGAAPPPPPPP 369 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 42.7 bits (96), Expect = 3e-04 Identities = 29/96 (30%), Positives = 29/96 (30%), Gaps = 2/96 (2%) Frame = -2 Query: 801 GKKKGXXGXXGGG--GGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGG 628 G G G GGG GGG G GGG GGG G GGG Sbjct: 48 GATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGG 107 Query: 627 XXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GG G G GG G Sbjct: 108 GGATGGHGGATGGGVGATGGHGGATGGHGGATGGHG 143 Score = 41.9 bits (94), Expect = 6e-04 Identities = 30/95 (31%), Positives = 30/95 (31%), Gaps = 1/95 (1%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGG-GX 625 G G G GGGGG G G GGG GGG G GG G Sbjct: 59 GGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGAT--GGGGGATGGGGGATGGHGG 116 Query: 624 XGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G GG GG G Sbjct: 117 ATGGGVGATGGHGGATGGHGGATGGHGGATGGGGG 151 Score = 39.5 bits (88), Expect = 0.003 Identities = 31/94 (32%), Positives = 31/94 (32%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GGGGG G G G A GG GGG GGG Sbjct: 41 GATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGG---GGGATGDGGGAT 97 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G G GG G Sbjct: 98 GGGGGATGG--GGGATGGHGGATGGGVGATGGHG 129 Score = 36.7 bits (81), Expect = 0.022 Identities = 33/97 (34%), Positives = 33/97 (34%), Gaps = 5/97 (5%) Frame = -2 Query: 801 GKKKGXXGXXGGGGG--GXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G G GGGGG G G G G A GGG GG G G Sbjct: 74 GATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATG 133 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGG--XGXGGXXXGG 526 G G G G G GGG G GG GG Sbjct: 134 GHGGATGGHG-GATGGGGGATGGGGGATGGGGGATGG 169 Score = 36.3 bits (80), Expect = 0.029 Identities = 26/82 (31%), Positives = 26/82 (31%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXXXX 590 G GGG G G G G GG GG G G GG Sbjct: 91 GDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGG---ATG 147 Query: 589 GGXXXXGXGXGXGGGGXXXXGG 524 GG G G G GGG GG Sbjct: 148 GGGGATGGGGGATGGGGGATGG 169 Score = 33.9 bits (74), Expect = 0.16 Identities = 23/82 (28%), Positives = 23/82 (28%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXXXX 590 G GGG G G G GG GGGG G GG Sbjct: 63 GGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGV 122 Query: 589 GGXXXXGXGXGXGGGGXXXXGG 524 G G G GG GG Sbjct: 123 GATGGHGGATGGHGGATGGHGG 144 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = -3 Query: 671 GGGXXGGGXGXXGX-GXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G GG G G GG GG GG Sbjct: 100 GGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGG 149 Score = 33.5 bits (73), Expect = 0.21 Identities = 23/82 (28%), Positives = 23/82 (28%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXXXX 590 G GG G G G G GG GGG G GG Sbjct: 77 GGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHG 136 Query: 589 GGXXXXGXGXGXGGGGXXXXGG 524 G G G GGG GG Sbjct: 137 GATGGHGGATGGGGGATGGGGG 158 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = -2 Query: 657 GGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGG---XGXGGXXXGGXG 520 GG G GG G G G G GGG G GG GG G Sbjct: 40 GGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGG 88 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 GG GG G G GG GG G G GGGG G Sbjct: 40 GGATGGHGGATGGGGGAT----GGGATGGGGGATGGGGGATGG 78 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 42.3 bits (95), Expect = 4e-04 Identities = 26/96 (27%), Positives = 27/96 (28%), Gaps = 6/96 (6%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPP------XXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXX 686 PP PPPP P P P PP P PPPP PPP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPPCHQ 155 Query: 687 XXXXXXXXXXXPXQXXPXXPXXXPPPXPXPXXXXLF 794 P P PPP P +F Sbjct: 156 TQVVHSVQLHASPPGPPPAPMPAPPPMVVPSHRHVF 191 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P PPP P PPP PPP P P PPPPPP P P Sbjct: 102 PPPPPPPPP-PPPPPPPPPPITLHHEQHVVSHVMHPAPP------PPPPPPPAPCMP 151 Score = 37.9 bits (84), Expect = 0.010 Identities = 23/82 (28%), Positives = 23/82 (28%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P PP PP P PPP PPP P PP PP Sbjct: 102 PPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPP--CHQTQVV 159 Query: 701 XXXXXXXXPXXPXXAXXXPPPP 766 P P A PPP Sbjct: 160 HSVQLHASPPGPPPAPMPAPPP 181 Score = 33.5 bits (73), Expect = 0.21 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +2 Query: 629 PPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXPFFFP 802 PPP P PPP PPP P PPPPP P P P Sbjct: 104 PPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPA---------PPPPPPPPPAPCMPP 152 Score = 32.3 bits (70), Expect = 0.47 Identities = 17/65 (26%), Positives = 17/65 (26%) Frame = +3 Query: 570 PXXXXPPXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXXXXXXXXPXQXXPXXPX 749 P P P P P PPPP PPP P P P Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPA 147 Query: 750 XXPPP 764 PP Sbjct: 148 PCMPP 152 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG GGG G G GG GG G G G GGGG GG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGG 123 Score = 41.5 bits (93), Expect = 8e-04 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG G GG G G GG GG G G G GGGG Sbjct: 88 GGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGGG G G GG GG G G G GG G GG Sbjct: 84 GGGFGGGG-GFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GG GGG G GGG G G G G GGG G GG GG G Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFGG-----GGGGGGGFGGGGGGGFG 128 Score = 33.1 bits (72), Expect = 0.27 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGG 540 GGG GGG G G G GG G G G GG GG Sbjct: 84 GGGFGGGG-GFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 41.5 bits (93), Expect = 8e-04 Identities = 27/96 (28%), Positives = 27/96 (28%), Gaps = 7/96 (7%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP-----XXPXPPP--XXPPP 673 G P PP PPP P P PPP P PPP PPP Sbjct: 193 GPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPP 252 Query: 674 XAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P PPPPP P Sbjct: 253 PMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGP 288 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/92 (27%), Positives = 25/92 (27%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P PP P P PPP P P P P P PPP Sbjct: 310 PPPPLNATPPP-PPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPL 368 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXPXXPFF 796 P PPPPPP P F Sbjct: 369 GGPPPPPPGRRPPSGKINPPPPPPPAMDKPSF 400 Score = 38.3 bits (85), Expect = 0.007 Identities = 28/115 (24%), Positives = 29/115 (25%) Frame = +2 Query: 446 PPPXXFRGNXXFXKLEXXXKKIFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPX 625 PPP RG P PP P PP P P P Sbjct: 216 PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGEN-RPPPPMRGPTSGGEPPPPKNAPPPPK 274 Query: 626 XPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P PP PP + P P PPPPPP P Sbjct: 275 RGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVP 329 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PPPP P P PP PP PPPP P Sbjct: 358 PPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 393 Score = 35.9 bits (79), Expect = 0.038 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 513 LXXXPPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPP 644 L PP PPPP P PP PP PPPP Sbjct: 240 LPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPP 283 Score = 35.5 bits (78), Expect = 0.051 Identities = 26/90 (28%), Positives = 27/90 (30%), Gaps = 4/90 (4%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP----XXPXPPPXXPPPXAX 682 G P PP PPP P P P PPP P PPP PP + Sbjct: 297 GPPLPPSRDQAPAPPPPLNAT---PPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTS- 352 Query: 683 XXXXXXXXXXXXXXPXXPXXAXXXPPPPPP 772 P PPPPPP Sbjct: 353 ------TRSAPPPPPGRAPQPLGGPPPPPP 376 Score = 32.7 bits (71), Expect = 0.36 Identities = 25/106 (23%), Positives = 26/106 (24%) Frame = +3 Query: 453 PXXLGETXXXGNWXXXXKKFLXXXPPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPX 632 P GE N K+ PP PP PP P P Sbjct: 257 PTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNA 316 Query: 633 PPPPXPPPXXXXXXXXXXXXXXXXXXXXXPXQXXPXXPXXXPPPXP 770 PPP PPP P P PPP P Sbjct: 317 TPPP-PPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPP 361 Score = 31.5 bits (68), Expect = 0.83 Identities = 21/85 (24%), Positives = 22/85 (25%), Gaps = 1/85 (1%) Frame = +2 Query: 521 PXPPXXXPPXPX-PPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXX 697 P PP P PPP P P P PP P P + Sbjct: 250 PPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPA 309 Query: 698 XXXXXXXXXPXXPXXAXXXPPPPPP 772 P P P PPPP Sbjct: 310 PPPPLNATPPPPPPSRDQVPLPPPP 334 Score = 30.3 bits (65), Expect = 1.9 Identities = 24/92 (26%), Positives = 26/92 (28%), Gaps = 2/92 (2%) Frame = +2 Query: 521 PXPPXXXPPXPX--PPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 P P PP P PPP P PPP PP PPP + Sbjct: 133 PPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGS-----FPPP----PPMGKPPPPSGNKPT 183 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P + PPPP P Sbjct: 184 FGNSRTSTNGPPPPPHSRHGSAPPPPERSSGP 215 Score = 26.6 bits (56), Expect(2) = 1.8 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXP 667 P PPP P PPP P Sbjct: 2 PPPPPPPGPPPPPSAP 17 Score = 22.2 bits (45), Expect(2) = 1.8 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 758 PPPPPXXPXXP 790 PPPPP P P Sbjct: 10 PPPPPSAPSGP 20 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 41.5 bits (93), Expect = 8e-04 Identities = 27/96 (28%), Positives = 27/96 (28%), Gaps = 7/96 (7%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP-----XXPXPPP--XXPPP 673 G P PP PPP P P PPP P PPP PPP Sbjct: 105 GPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPP 164 Query: 674 XAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P PPPPP P Sbjct: 165 PMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGP 200 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/92 (27%), Positives = 25/92 (27%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P PP P P PPP P P P P P PPP Sbjct: 222 PPPPLNATPPP-PPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPL 280 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXPXXPFF 796 P PPPPPP P F Sbjct: 281 GGPPPPPPGRRPPSGKINPPPPPPPAMDKPSF 312 Score = 38.3 bits (85), Expect = 0.007 Identities = 28/115 (24%), Positives = 29/115 (25%) Frame = +2 Query: 446 PPPXXFRGNXXFXKLEXXXKKIFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPX 625 PPP RG P PP P PP P P P Sbjct: 128 PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGEN-RPPPPMRGPTSGGEPPPPKNAPPPPK 186 Query: 626 XPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P PP PP + P P PPPPPP P Sbjct: 187 RGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVP 241 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PPPP P P PP PP PPPP P Sbjct: 270 PPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 305 Score = 35.9 bits (79), Expect = 0.038 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 513 LXXXPPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPP 644 L PP PPPP P PP PP PPPP Sbjct: 152 LPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPP 195 Score = 35.5 bits (78), Expect = 0.051 Identities = 26/90 (28%), Positives = 27/90 (30%), Gaps = 4/90 (4%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP----XXPXPPPXXPPPXAX 682 G P PP PPP P P P PPP P PPP PP + Sbjct: 209 GPPLPPSRDQAPAPPPPLNAT---PPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTS- 264 Query: 683 XXXXXXXXXXXXXXPXXPXXAXXXPPPPPP 772 P PPPPPP Sbjct: 265 ------TRSAPPPPPGRAPQPLGGPPPPPP 288 Score = 32.7 bits (71), Expect = 0.36 Identities = 25/106 (23%), Positives = 26/106 (24%) Frame = +3 Query: 453 PXXLGETXXXGNWXXXXKKFLXXXPPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPX 632 P GE N K+ PP PP PP P P Sbjct: 169 PTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNA 228 Query: 633 PPPPXPPPXXXXXXXXXXXXXXXXXXXXXPXQXXPXXPXXXPPPXP 770 PPP PPP P P PPP P Sbjct: 229 TPPP-PPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPP 273 Score = 31.5 bits (68), Expect = 0.83 Identities = 21/85 (24%), Positives = 22/85 (25%), Gaps = 1/85 (1%) Frame = +2 Query: 521 PXPPXXXPPXPX-PPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXX 697 P PP P PPP P P P PP P P + Sbjct: 162 PPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPA 221 Query: 698 XXXXXXXXXPXXPXXAXXXPPPPPP 772 P P P PPPP Sbjct: 222 PPPPLNATPPPPPPSRDQVPLPPPP 246 Score = 30.3 bits (65), Expect = 1.9 Identities = 24/92 (26%), Positives = 26/92 (28%), Gaps = 2/92 (2%) Frame = +2 Query: 521 PXPPXXXPPXPX--PPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 P P PP P PPP P PPP PP PPP + Sbjct: 45 PPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGS-----FPPP----PPMGKPPPPSGNKPT 95 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P + PPPP P Sbjct: 96 FGNSRTSTNGPPPPPHSRHGSAPPPPERSSGP 127 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 41.5 bits (93), Expect = 8e-04 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG GGG G G G G GGG GG GG G Sbjct: 180 GGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYG 230 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/51 (41%), Positives = 23/51 (45%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKNFF 503 GGG GGGG G G GG GG G G GGG GG +N + Sbjct: 203 GGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGG--SKGGGYDRNSY 251 Score = 37.9 bits (84), Expect = 0.010 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 4/48 (8%) Frame = -1 Query: 655 GGGXGG--GGXGXGXXGGXXXXXXGGXXXXGX--GXGXGGGGXXXXGG 524 GGG GG GG G G GG GG G G G GGGG GG Sbjct: 192 GGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGG 239 Score = 35.1 bits (77), Expect = 0.067 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GG G GGG G G G GGG G GG G G Sbjct: 191 GGGGYGGSKGGYGGGSGGG-GYGGGRGGGGYGGGHGGGGYGGGGRHDYGGG 240 Score = 34.7 bits (76), Expect = 0.089 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GGG GG G G G G G GGG G GG GG Sbjct: 185 GGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGG 233 Score = 33.5 bits (73), Expect = 0.21 Identities = 27/86 (31%), Positives = 28/86 (32%) Frame = -2 Query: 798 KKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXG 619 K +G G G GGG G G GGG GGG G G G G Sbjct: 173 KPRGDSGGGGSQGGGYRSGGGGYGGSKG------------GYGGGSGGGGYG-GGRGGGG 219 Query: 618 XXGXXXXGXXGXXXXXXXGGGXGXGG 541 G G G GGG GG Sbjct: 220 YGGGHGGGGYGGGGRHDYGGGSKGGG 245 Score = 31.5 bits (68), Expect = 0.83 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 677 RXGGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGG 540 R GGG GG G G G GG G G G GG GG Sbjct: 189 RSGGGGYGGSKGGYGGG---SGGGGYGGGRGGGGYGGGHGGGGYGG 231 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GG G G G GGG G G G GG GG GG Sbjct: 196 GGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKGG 244 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = -2 Query: 654 GGXGXXGGG---XXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GG G GGG G G G G GGG G GG G G Sbjct: 179 GGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGG 226 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 35.5 bits (78), Expect(2) = 8e-04 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 530 PXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P PP P P P P P P PPP PPP Sbjct: 321 PDSTPATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPP 368 Score = 33.1 bits (72), Expect = 0.27 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPP 670 P PP P P P PPP P PPP PP Sbjct: 325 PATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/43 (30%), Positives = 13/43 (30%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PP P P P P P P PPP PP Sbjct: 330 PPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 25.0 bits (52), Expect(2) = 8e-04 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 755 PPPPPPXXPXXP 790 PPPPPP P P Sbjct: 360 PPPPPPPPPTPP 371 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P P PP PP P PPPP PP Sbjct: 683 PPPPPPPPPPPPPPPP-----PPPQPSTPPPPPPSTPP 715 Score = 36.7 bits (81), Expect = 0.022 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PPPP P P P PP PP P P P Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSP 729 Score = 34.7 bits (76), Expect = 0.089 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +2 Query: 506 KIFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPP 658 +I P PP P PPP P P P P PPP P PP Sbjct: 672 QILPIPIQTMVPPPPPPPPP-------PPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 33.9 bits (74), Expect = 0.16 Identities = 18/69 (26%), Positives = 18/69 (26%) Frame = +3 Query: 558 PXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXXXXXXXXPXQXXP 737 P P PP PP P P PP P PP P Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSA 734 Query: 738 XXPXXXPPP 764 P PPP Sbjct: 735 GNPQQQPPP 743 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 570 PXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P PP P P PPPP PPP Sbjct: 670 PIQILPIPIQTMVPPPPPPPPPPPPPPPP 698 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXP 667 PP PP P PPP P P P P P P P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSP 729 Score = 33.1 bits (72), Expect = 0.27 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPP 658 P PP PP P PPP P P P P P P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSP 729 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 571 PXXXXPXXXXXXXPPXXXXPXPXXPXPPPXXPPP 672 P P PP P P P PPP P P Sbjct: 670 PIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQP 703 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 41.1 bits (92), Expect = 0.001 Identities = 26/87 (29%), Positives = 26/87 (29%), Gaps = 3/87 (3%) Frame = +2 Query: 530 PXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXP---XPPPXXPPPXAXXXXXXX 700 P PP P PPP P P P PP PPP PPP Sbjct: 680 PSSAPPPPAPPPPPIGGGDPTIWVSGGP--PLSAPPLSSTLGPPPPAPPPPPLGRDSAAV 737 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXP 781 A PPPPPP P Sbjct: 738 FMLTWTPLTNTSSAANVPPPPPPPAVP 764 Score = 35.9 bits (79), Expect = 0.038 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PPPP P PP PPPP PPP Sbjct: 684 PPPPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPP 727 Score = 33.5 bits (73), Expect = 0.21 Identities = 25/87 (28%), Positives = 25/87 (28%) Frame = +1 Query: 520 SXPPXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPPXXPPPXRXXXXXXX 699 S PP PP PP P PP P P PPP PP R Sbjct: 682 SAPPPPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPP--PPLGR----DSA 735 Query: 700 XXXXXXXXXXTXXXRRXAXPPPXPXPA 780 T PPP P PA Sbjct: 736 AVFMLTWTPLTNTSSAANVPPPPPPPA 762 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PP P P P P P PP PP PPPP PP Sbjct: 295 PPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 552 PXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P P P P PP P PPPP PPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPP 324 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 6/44 (13%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPP------PPXPPP 656 PPPP P PP PP P P PP PP PPP Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 36.7 bits (81), Expect = 0.022 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Frame = +2 Query: 545 PXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXP-----PPXXPPP 673 P P PPP P P P PPP P P PP PPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 36.3 bits (80), Expect = 0.029 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPP----XPPP 656 PPPP PP PP P P PPPP PPP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPP 333 Score = 35.5 bits (78), Expect = 0.051 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPP 670 P PP P PPP P P P P PP PPP PP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPP----PPPPPPPPGDGGAPPPPPPP 337 Score = 33.1 bits (72), Expect = 0.27 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +2 Query: 587 PXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPP 766 P P P PPP PPP PPP P P PPPP Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPPPP-----------------PPPPGDGGAPPPPP 335 Query: 767 PP 772 PP Sbjct: 336 PP 337 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G GG GG G G G GGGG Sbjct: 132 GGGGGGGGGGGGGGGG---GGGGGGGGGGGGGGGGGGG 166 Score = 37.1 bits (82), Expect = 0.017 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGGG G G GG GG G G G GG G G Sbjct: 136 GGGGGGGGGGGGGGGG-----GGGGGGGGGGGGGGGDGDEDDDG 174 Score = 34.7 bits (76), Expect = 0.089 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GGG GGG G GGG G G G G GGG G G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG------GGGGGGDGDEDDDG 174 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 40.3 bits (90), Expect = 0.002 Identities = 27/93 (29%), Positives = 28/93 (30%), Gaps = 7/93 (7%) Frame = +2 Query: 542 PPXPXPPPXXXXXXXPXXPXXXXPXXPXX----PPPXXPXPPP---XXPPPXAXXXXXXX 700 PP P P P P P P P P P PPP PP Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGC 736 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXPXXPFFF 799 P P A PPPPP P P F+ Sbjct: 737 AGLPPPPPPPPPGCAGLPPPPPPIDVPMKPLFW 769 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PPPP P P PP P P PPPP PP Sbjct: 712 PPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 Score = 36.7 bits (81), Expect = 0.022 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 11/59 (18%) Frame = +3 Query: 513 LXXXPPXXXXPPP------PXPXPXPXXXXPPXXXXXXPPXXPXPXP-----PPPXPPP 656 L PP PPP P P P P PP PP P P P PPP PPP Sbjct: 691 LSVPPPPPPPPPPLLSGTLPMPPPPP---PPPPGCAGLPPPPPSPQPGCAGLPPPPPPP 746 Score = 35.1 bits (77), Expect = 0.067 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP PP P PP P P P PPP P PPP Sbjct: 710 PMPP---PPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPP 757 Score = 34.7 bits (76), Expect = 0.089 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXP-XXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PPP P P P PP P P PPPP P Sbjct: 719 PPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVP 763 Score = 32.3 bits (70), Expect = 0.47 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 12/50 (24%) Frame = +3 Query: 543 PPPPXPX--------PXPXXXXPPXXXXXXPPXXPXPXPPPP----XPPP 656 PPPP P P P PP P P P PPPP PPP Sbjct: 679 PPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPP 728 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 5/53 (9%) Frame = +3 Query: 513 LXXXPPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPP-----PPXPPP 656 L PP PP P P P PP P P PP PP PPP Sbjct: 709 LPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPP--PPPPPPGCAGLPPPPPP 759 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXP 667 P P P P P P P P P PPP P P P Sbjct: 718 PPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKP 766 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/54 (29%), Positives = 17/54 (31%), Gaps = 3/54 (5%) Frame = +1 Query: 526 PPXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXX---PXPPPXXPPPXR 678 PP PP P P P PP P P P PPP P + Sbjct: 712 PPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMK 765 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXP-PPXXPPP 673 G P PP PP PPP P P P PPP P P PP PP Sbjct: 239 GAPPPPHSMPPPGMPPPGMMPP--PGFPPMGMPGMGGMPPPGMPPPMPPGGMPP 290 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 PP PP PPP P P P PP P PPP Sbjct: 249 PPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPP 297 Score = 33.5 bits (73), Expect = 0.21 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 G P PP PP PP P P P PP PPP PPP Sbjct: 251 GMP-PPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPP--PPP 300 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PP PP P P P PP P P PP PP Sbjct: 248 PPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPP 290 Score = 28.7 bits (61), Expect = 5.8 Identities = 19/75 (25%), Positives = 19/75 (25%), Gaps = 1/75 (1%) Frame = +2 Query: 551 PXPPPXXXXXXXPXX-PXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXP 727 P PP P P P PP PPP PP P Sbjct: 225 PMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMP 284 Query: 728 XXPXXAXXXPPPPPP 772 PPPPP Sbjct: 285 PGGMPPNMEQPPPPP 299 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 39.9 bits (89), Expect = 0.002 Identities = 25/79 (31%), Positives = 25/79 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG A G G G G GGG G GG G G Sbjct: 37 GGVGGGGGNGGGAGNGV-GAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGA 95 Query: 600 XGXXGXXXXXXXGGGXGXG 544 G G GG G G Sbjct: 96 GGNVGGGGSGGVGGNGGSG 114 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/80 (30%), Positives = 24/80 (30%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G GGG G G G G G G G Sbjct: 33 GVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAG 92 Query: 600 XGXXGXXXXXXXGGGXGXGG 541 G G GG G GG Sbjct: 93 AGAGGNVGGGGSGGVGGNGG 112 Score = 37.9 bits (84), Expect = 0.010 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G GGG G G G GGG G GG GG G Sbjct: 35 GGGGVGGGGGN-GGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGG-GGGGAG 83 Score = 37.1 bits (82), Expect = 0.017 Identities = 25/78 (32%), Positives = 25/78 (32%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GGG G G G G G G GGGG G G G Sbjct: 36 GGGVGGGGGNG--GGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGA 93 Query: 595 XXGGXXXXGXGXGXGGGG 542 GG G G GG G Sbjct: 94 GAGGNVGGGGSGGVGGNG 111 Score = 36.7 bits (81), Expect = 0.022 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXG-GXXXXGXGXGXGGGGXXXXGG 524 GG GGGG G G GG G G G GGGG GG Sbjct: 66 GGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGG 109 Score = 35.9 bits (79), Expect = 0.038 Identities = 24/87 (27%), Positives = 24/87 (27%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G G GG G G G GGG GGG G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGA 87 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG G Sbjct: 88 AGAAGAGAGGNVGGGGSGGVGGNGGSG 114 Score = 35.9 bits (79), Expect = 0.038 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G GGGG GG Sbjct: 35 GGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGG 78 Score = 32.3 bits (70), Expect = 0.47 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G G G GG G G G GG G G G G GG G Sbjct: 50 GNGVGAGGCGCG-GGNDGGNGGGGAGNGGGGGGAGNGGAAGAAG 92 Score = 31.9 bits (69), Expect = 0.63 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG G G G G GG G G G GGG GG N Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGN 75 Score = 28.7 bits (61), Expect = 5.8 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG GG G G A GG GGG GG Sbjct: 52 GVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNG 111 Query: 621 G 619 G Sbjct: 112 G 112 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 39.9 bits (89), Expect = 0.002 Identities = 25/89 (28%), Positives = 26/89 (29%), Gaps = 2/89 (2%) Frame = +2 Query: 521 PXPPXXX--PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 P PP PP P P P P PPP P PPP PPP + Sbjct: 1026 PVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPS-TSQP 1084 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P PP P P Sbjct: 1085 VPPPRQPDPIPTNPAHPTEPPPRQPKPTP 1113 Score = 35.9 bits (79), Expect = 0.038 Identities = 24/90 (26%), Positives = 25/90 (27%), Gaps = 3/90 (3%) Frame = +2 Query: 530 PXXXPPXPX--PPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXP-PPXAXXXXXXX 700 P PP P P P P P P PP P PPP P PP + Sbjct: 1015 PHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPR 1074 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P P P P P Sbjct: 1075 QPPPPSTSQPVPPPRQPDPIPTNPAHPTEP 1104 Score = 32.7 bits (71), Expect = 0.36 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 6/56 (10%) Frame = +2 Query: 521 PXPPXXXP---PXPXPPPXXXXXXXP---XXPXXXXPXXPXXPPPXXPXPPPXXPP 670 P PP P P PPP P P P P PPP P P P P Sbjct: 1062 PSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTPAPRP 1117 Score = 32.3 bits (70), Expect = 0.47 Identities = 23/87 (26%), Positives = 23/87 (26%), Gaps = 3/87 (3%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXP-PXXXXXXPPXXPXPXPPP--PXPPPXXXXXXXXXXXXX 695 P P PP P P P PP P PPP P PPP Sbjct: 1020 PGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPP 1079 Query: 696 XXXXXXXXPXQXXPXXPXXXPPPXPXP 776 P Q P P P P Sbjct: 1080 STSQPVPPPRQPDPIPTNPAHPTEPPP 1106 Score = 31.1 bits (67), Expect = 1.1 Identities = 22/84 (26%), Positives = 22/84 (26%), Gaps = 2/84 (2%) Frame = +3 Query: 525 PPXXXXPPPPX--PXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXX 698 P PP P P P PP PP P P PP P P Sbjct: 1013 PVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSP-PPSAVPIPPPRKPSPPPSEPAP 1071 Query: 699 XXXXXXXPXQXXPXXPXXXPPPXP 770 P P P P P P Sbjct: 1072 PPRQPPPPSTSQPVPPPRQPDPIP 1095 Score = 29.1 bits (62), Expect = 4.4 Identities = 23/89 (25%), Positives = 23/89 (25%), Gaps = 2/89 (2%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPP--XXPPPXAXXXXX 694 P P PP P P P PPP P PPP PPP Sbjct: 1022 PTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPI-PPPRKPSPPPSEPAPPPRQPPPPS 1080 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P PPP P Sbjct: 1081 TSQPVPPPRQPDPIPTNPAHPTEPPPRQP 1109 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GGG GGG G GGG G G G GGG G GG G G Sbjct: 39 ADGGGGGGGGGG--GGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDG 89 Score = 35.9 bits (79), Expect = 0.038 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GGG GGGG G G G G G G GGG G N Sbjct: 47 GGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDGDADN 95 Score = 31.5 bits (68), Expect = 0.83 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGG 628 GGGGGG G G A GGG GGG G G Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDG 89 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 4/65 (6%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPP----PPXXPXX 787 P PPP P P PPP A P P PPPP P P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAP 109 Query: 788 PFFFP 802 P F P Sbjct: 110 PHFLP 114 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = +2 Query: 509 IFGXPXPPXXXPP--XPXPPPXXXXXXXPXXPXXXXPXXPXXPPP-XXPXPPPXXPPP 673 I P PP PP P PP P P P PPP P PPP P P Sbjct: 46 ISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAP 103 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPP 670 P PP P P PP P P P P P P P PP P Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPHFLP 114 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +3 Query: 543 PPPPXPXP---XPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P P PP PP P PP PPP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPP 90 Score = 34.7 bits (76), Expect = 0.089 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +2 Query: 587 PXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPP 766 P P P PPP P P PPP A P P PPP Sbjct: 51 PPPPPSPPAAAPAAPPP--PAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPA 108 Query: 767 PP 772 PP Sbjct: 109 PP 110 Score = 33.1 bits (72), Expect = 0.27 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXP--PXXXXXXPPXXPXPXPPPPXPPP 656 P PP P P P P P P P P PP PPP Sbjct: 43 PHFISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPP 87 Score = 32.7 bits (71), Expect = 0.36 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 6/55 (10%) Frame = +3 Query: 510 FLXXXPPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPX---PPP---PXPPP 656 F+ PP PPP P P PP PP P PPP P PPP Sbjct: 45 FISSSPPP---PPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPP 96 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +1 Query: 529 PXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPPXXPPP 672 P PP P P P PP P P P P PPP Sbjct: 62 PAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPP--PAQPAPQPPP 107 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/66 (33%), Positives = 25/66 (37%), Gaps = 2/66 (3%) Frame = +3 Query: 465 GETXXXGNWXXXX--KKFLXXXPPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPP 638 G + GN+ KK+L P PPP P P PP PP P P P Sbjct: 99 GSSCGKGNYPLMNAVKKYLGGYVPP---PPPTGTLPPPPVTPPPGPETPPPPDTPAPPVP 155 Query: 639 PPXPPP 656 P PP Sbjct: 156 PTEAPP 161 Score = 35.1 bits (77), Expect = 0.067 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = +3 Query: 510 FLXXXPPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 ++ PP PPPP P P PP PP P PP P Sbjct: 120 YVPPPPPTGTLPPPPVTPP-PGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +2 Query: 551 PXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPP--PXXPPPXA 679 P PPP P P P PPP P PP P PP A Sbjct: 122 PPPPPTGTLPPPPVTPP---PGPETPPPPDTPAPPVPPTEAPPTA 163 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPP 655 P PP PP P PP P P P P PP Sbjct: 131 PPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPPTGGSCVSKPP 175 Score = 28.7 bits (61), Expect = 5.8 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +2 Query: 503 KKIFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXP 667 KK G PP P PPP P P P P P P PP P Sbjct: 114 KKYLGGYVPP-PPPTGTLPPPPVTPPPGPETP--PPPDTPAPPVPPTEAPPTAPP 165 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PPPP P P P P PP P P PPPP P Sbjct: 1157 PPPPPPPPPPPPSSPS------PPPPPPPPPPPPTP 1186 Score = 34.3 bits (75), Expect = 0.12 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPPXXPPP 673 P P PPP P PPP PPP Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPP 1180 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 587 PXXPXXXXPXXPXXPPPXXPXPPPXXP 667 P P P P PPP P PPP P Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 31.5 bits (68), Expect = 0.83 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 587 PXXPXXXXPXXPXXPPPXXPXPPPXXPP 670 P P P P P P P PPP PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 587 PXXPXXXXPXXPXXPPPXXPXPPPXXPP 670 P P P PPP P PPP P Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +2 Query: 725 PXXPXXAXXXPPPPPPXXPXXP 790 P P + PPPPPP P P Sbjct: 1163 PPPPPPSSPSPPPPPPPPPPPP 1184 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 37.9 bits (84), Expect = 0.010 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -1 Query: 655 GGGXGGG--GXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 GGG GGG G G GG GG G G G GGGG G Sbjct: 73 GGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 117 Score = 36.7 bits (81), Expect = 0.022 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G GG GG G G G GGGG GG Sbjct: 70 GDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 112 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G G G G G G G GGG G G GG G Sbjct: 53 GGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDG 103 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG GGGG G G G G G G GGG GG Sbjct: 48 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGG 90 Score = 31.9 bits (69), Expect = 0.63 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GG GGG G G G G GGG G GG G G Sbjct: 48 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDG 97 Score = 31.9 bits (69), Expect = 0.63 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG G G G G GGG G GG G G Sbjct: 65 GDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGD----GGGGGDGGGGGDGGG 111 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 37.9 bits (84), Expect = 0.010 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -1 Query: 655 GGGXGGG--GXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 GGG GGG G G GG GG G G G GGGG G Sbjct: 88 GGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 132 Score = 36.7 bits (81), Expect = 0.022 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G GG GG G G G GGGG GG Sbjct: 85 GDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 127 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G G G G G G G GGG G G GG G Sbjct: 68 GGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDG 118 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG GGGG G G G G G G GGG GG Sbjct: 63 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGG 105 Score = 31.9 bits (69), Expect = 0.63 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GG GGG G G G G GGG G GG G G Sbjct: 63 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDG 112 Score = 31.9 bits (69), Expect = 0.63 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG G G G G GGG G GG G G Sbjct: 80 GDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGD----GGGGGDGGGGGDGGG 126 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 37.5 bits (83), Expect = 0.013 Identities = 26/90 (28%), Positives = 27/90 (30%) Frame = -1 Query: 796 KKRXXXXGXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGX 617 K+ G GG G G W G GGG GG G G Sbjct: 111 KRENGMEGWRRGGVQRGGRGG--WRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGN 168 Query: 616 XGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 GG GG G G G GGG G Sbjct: 169 GGGRGGGEGGGGRGRGTGGGSRGGGGDGRG 198 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GG GGG G G G G G G GG GG G Sbjct: 144 GGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGG 194 Score = 33.5 bits (73), Expect = 0.21 Identities = 29/92 (31%), Positives = 31/92 (33%), Gaps = 1/92 (1%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGGGX 625 G ++G G G GGG G G GGG G GG G GGG Sbjct: 123 GVQRGGRGGWRGRGGGEGNGAGGGIGRGGGR----------GRGGGEGGWGGRGGNGGGR 172 Query: 624 XGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXG 529 G G G G GGG G G G Sbjct: 173 GGGEGGGGRGR-GTGGGSRGGGGDGRGRGRGG 203 Score = 32.3 bits (70), Expect = 0.47 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GG GG G G G G GGG GG G G Sbjct: 150 GGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRG 200 Score = 31.9 bits (69), Expect = 0.63 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGG-GXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG G G G G G GG G G G G GG GG Sbjct: 136 GGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGG 180 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -2 Query: 657 GGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG G G G G G G GG GG G Sbjct: 136 GGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGG-EGGGG 180 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 666 GXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GG GGG G G G GG GG GG G Sbjct: 134 GRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRG 182 Score = 28.3 bits (60), Expect = 7.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GG GGG G G G GGG G GG G G Sbjct: 138 GEGNGAGGGIGRGGGRGRGGGEGGWGGRG-GNGGGRGGGEGGGGRGRGTGG 187 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG 548 GG GGG G G G G G G G GG Sbjct: 169 GGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRGRGG 203 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 GGG GGGG G G GG G G G G G G G Sbjct: 310 GGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDG 352 Score = 32.7 bits (71), Expect = 0.36 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXG-GXXXGGXG 520 G G GGG GGG G G G G G G G G G G G Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDG 355 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXG 529 GGG GGG G GGG G G G G G G G Sbjct: 310 GGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDGWG 357 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G GG G G G G G Sbjct: 309 GGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDGWG 357 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PPPP P PP P P P PPPP P Sbjct: 778 PPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKP 814 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 653 PPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 PP PPP P P A PPPPPP P P Sbjct: 777 PPPPPPPTKPATPRVPPNI-----PSRPPGARPTPPPPPPGKPTKP 817 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 37.1 bits (82), Expect = 0.017 Identities = 27/95 (28%), Positives = 27/95 (28%) Frame = +2 Query: 506 KIFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXX 685 K P PP P P PP P P P P P P P PP P A Sbjct: 238 KAIATPNPPM--PETPLPPATPNPFIPPASPNPSIPPAP--PNPSIPAPP-NPSIPLAPP 292 Query: 686 XXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P P PP P P P Sbjct: 293 NPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAP 327 Score = 37.1 bits (82), Expect = 0.017 Identities = 24/89 (26%), Positives = 24/89 (26%), Gaps = 1/89 (1%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPP-PXXPXPPPXXPPPXAXXXXXXXX 703 P PP P P P P P PP P P PP P A Sbjct: 257 PNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPP 316 Query: 704 XXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P P PP P P P Sbjct: 317 APPNPYIPTAPPNPSIPPAPPNPSIPPAP 345 Score = 36.3 bits (80), Expect = 0.029 Identities = 26/92 (28%), Positives = 26/92 (28%), Gaps = 2/92 (2%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXP-XXXXPXXPXXPP-PXXPXPPPXXPPPXAXXXXX 694 P PP PP P PP P P P P PP P P PP P P Sbjct: 186 PTPPT--PPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATP 243 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P P P P P Sbjct: 244 NPPMPETPLPPATPNPFIPPASPNPSIPPAPP 275 Score = 35.9 bits (79), Expect = 0.038 Identities = 22/80 (27%), Positives = 23/80 (28%) Frame = +2 Query: 551 PXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPX 730 P PP P P P P PP P P PP + P Sbjct: 177 PKPPAPSTIPTPPTPPAPPSPPIPTAPPT--PPMPETPLPPGSPHIPPAPLHPHIPPAPP 234 Query: 731 XPXXAXXXPPPPPPXXPXXP 790 P A P PP P P P Sbjct: 235 NPSKAIATPNPPMPETPLPP 254 Score = 35.1 bits (77), Expect = 0.067 Identities = 25/90 (27%), Positives = 25/90 (27%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P PP P P PP P P P P P P P PP P A Sbjct: 251 PLPPAT--PNPFIPPASPNPSIPPAPPN--PSIPAPPNPSIPLAPPNPYIPPAPPNLFIP 306 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P PP P P P Sbjct: 307 SAPPNPHIPPAPPNPYIPTAPPNPSIPPAP 336 Score = 33.1 bits (72), Expect = 0.27 Identities = 23/92 (25%), Positives = 23/92 (25%), Gaps = 4/92 (4%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXX----PXPPPXXPPPXAXXXXX 694 P P P PP P P P PP P PP P A Sbjct: 263 PASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPY 322 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P P PP P P P Sbjct: 323 IPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAP 354 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P PP P PP PP P P PP P P Sbjct: 231 PAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNP 268 Score = 31.5 bits (68), Expect = 0.83 Identities = 26/98 (26%), Positives = 27/98 (27%), Gaps = 5/98 (5%) Frame = +2 Query: 521 PXPPXXXPPX-PXPPPXXXXXXXPXXPXXXXPXX--PXXPPPXXPXPPPXXPP--PXAXX 685 P P PP P PP P P P P P P PP P P A Sbjct: 207 PMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASP 266 Query: 686 XXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXPFFF 799 P P + PP P P P F Sbjct: 267 NPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLF 304 Score = 30.7 bits (66), Expect = 1.4 Identities = 26/98 (26%), Positives = 26/98 (26%), Gaps = 8/98 (8%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXP----PPXXPXP--PPXXPPP--X 676 P P P PP P P P P P PP P P PP P P Sbjct: 221 PPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIP 280 Query: 677 AXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 A P P PP P P P Sbjct: 281 APPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAP 318 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 1/43 (2%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXP-PXXPXPXPPPPXP 650 PP P P P P PP P P P P PP P Sbjct: 194 PPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNP 236 Score = 29.9 bits (64), Expect = 2.5 Identities = 25/92 (27%), Positives = 25/92 (27%), Gaps = 5/92 (5%) Frame = +2 Query: 521 PXPPXXXPPXPXPP-PXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXX 697 P P PP P P P P P P P P P PP P A Sbjct: 275 PNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAP--PNPHIPPAPPNPYIPTAPPNPSI 332 Query: 698 XXXXXXXXXPXXPXXAXXXPPPP----PPXXP 781 P P P PP PP P Sbjct: 333 PPAPPNPSIPPAPPNPSIPPAPPNLFIPPATP 364 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +3 Query: 510 FLXXXPPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 F+ PP PP P P P P P PP P PP Sbjct: 304 FIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPP 352 Score = 28.3 bits (60), Expect = 7.7 Identities = 18/75 (24%), Positives = 18/75 (24%) Frame = +2 Query: 557 PPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXP 736 PP P P P P P PP P P A P P Sbjct: 162 PPVTETTTTKPETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIP 221 Query: 737 XXAXXXPPPPPPXXP 781 PP P P Sbjct: 222 PAPLHPHIPPAPPNP 236 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXP--XXPXXPPPXXPXPPPXXPP 670 P PP P PPP P P P P PPP PP PP Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 5/49 (10%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPP-----PXPPP 656 P PPPP P PP P P PPP P PPP Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPP 704 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 542 PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 PP P PP P P PPP P PPP Sbjct: 662 PPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPP 772 P PP P PPP A P P PPPPPP Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGA-PPPPPP 705 Score = 28.3 bits (60), Expect = 7.7 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +2 Query: 635 PXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P PPP PPP P P PPPPPP P Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPP-------PPPPLPGGAAPPPPPPIGGGAP 700 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 36.7 bits (81), Expect = 0.022 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P P P P P P P PPP P PP PP Sbjct: 1006 PTNPGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPP 1056 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXP 623 PP PPP P P PP PP P Sbjct: 1027 PPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPP 658 P P PP PP P P P P PPP P P Sbjct: 1016 PDPLPTDPPTE--PPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 2/33 (6%) Frame = +3 Query: 564 PXPXXXXPPXXXXXXPPXXPXPXPP--PPXPPP 656 P P PP PP P PP PP PP Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPP 1048 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +3 Query: 513 LXXXPPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXP 635 L PP PP P P PP PP P P Sbjct: 1019 LPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 36.3 bits (80), Expect = 0.029 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P P P PP PP P PPPP PPP Sbjct: 205 PKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPP 248 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 549 PPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PP P PP PP P PPPP PP Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 32.3 bits (70), Expect = 0.47 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 596 PXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P PPP PPP PPP Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPPPPP 248 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/64 (26%), Positives = 19/64 (29%) Frame = +2 Query: 479 FXKLEXXXKKIFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPP 658 F ++ K P P P P P P P P PP P PPP Sbjct: 191 FRRVHKKTKPSAAAPKQQKATPVNP-PEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Query: 659 XXPP 670 P Sbjct: 250 VKKP 253 Score = 28.3 bits (60), Expect(2) = 0.24 Identities = 13/44 (29%), Positives = 13/44 (29%) Frame = +2 Query: 542 PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P P P P P P PP PPP Sbjct: 200 PSAAAPKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPP 243 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +2 Query: 557 PPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXA 679 PP P P P P P P PPP P A Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKPAA 255 Score = 23.8 bits (49), Expect(2) = 0.24 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 734 PXXAXXXPPPPPPXXPXXP 790 P A PPPPPP P Sbjct: 235 PPPAAAPPPPPPPPPVKKP 253 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 35.9 bits (79), Expect = 0.038 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P PP P P P PP P PPP PPP Sbjct: 1329 PPWELPLPPSGLPLPLPRLPLPPLRLPPPHSRLPLPPPKLPPP 1371 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +1 Query: 529 PXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPPXXPP 669 P P PP P P PP P P PPP P Sbjct: 1329 PPWELPLPPSGLPLPLPRLPLPPLRLPPPHSRLPLPPPKLPPPSRIP 1375 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 2/45 (4%) Frame = +1 Query: 550 PPXPXXXPXXXXPXXXXXXXPPXXXXPXPXX--PXPPPXXPPPXR 678 PP P P P P P P PPP PPP R Sbjct: 1329 PPWELPLPPSGLPLPLPRLPLPPLRLPPPHSRLPLPPPKLPPPSR 1373 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 35.9 bits (79), Expect = 0.038 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG---XGXGXGGGG 542 GGG GGGG G G GG GG G G G GGG Sbjct: 112 GGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGGSKGGG 152 Score = 33.9 bits (74), Expect = 0.16 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GG GG GGG G G G GG G GG GG G Sbjct: 89 GGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYG 138 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GGG G G GGG G G G G GGG G G GG Sbjct: 100 GGGYGGSSRGGYGGGRGG--GGYGGGRGGGGYGGGRGGGYGGGRRDYGG 146 Score = 33.1 bits (72), Expect = 0.27 Identities = 16/46 (34%), Positives = 19/46 (41%) Frame = -1 Query: 643 GGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GGGG G GG GG G G G GGG G +++ Sbjct: 99 GGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDY 144 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 668 GGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GG GG G G GG G G G GG GG GG Sbjct: 94 GGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYG-GGRGGGYGGG 140 Score = 28.7 bits (61), Expect = 5.8 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = -3 Query: 677 RXGGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 R GG GG G G G G G GG GG GG Sbjct: 86 RGAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGG 136 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXG 563 GGG GGGG G G GG GG G G Sbjct: 342 GGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 30.3 bits (65), Expect(2) = 0.046 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXG 595 GGG GGG G GGG G G G Sbjct: 345 GGGGGGGGGGGGGGGRGGGGGFSSRG 370 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXG 586 GG GGG G GGG G G G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 677 RXGGGXXGGGXGXXGXGXXXXGG 609 R GGG GGG G G G GG Sbjct: 341 RGGGGGGGGGGGGGGGGGGRGGG 363 Score = 24.2 bits (50), Expect(2) = 0.046 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGG 754 G +G G GGGGGG Sbjct: 338 GSGRGGGGGGGGGGGG 353 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 35.5 bits (78), Expect = 0.051 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPPXXPPPXA 679 P P PPP P PPP PPP A Sbjct: 864 PRRPPPPPPPPPPPPPPPPPPPA 886 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 564 PXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P PP PP P P PPPP PPP Sbjct: 860 PRPRPRRPPP-----PPPPPPPPPPPPPPPP 885 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 558 PXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P P P PP PP P P PPPP PP Sbjct: 860 PRPRPRRPPPP------PPPPPPPPPPPPPPP 885 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 596 PXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P PPP P PPP PPP Sbjct: 862 PRPRRPPPPPPPPPPPPPPPP--PPP 885 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 35.5 bits (78), Expect = 0.051 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXX-GXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPK 511 GGG GGG GGG G G G G GGG G GG G K Sbjct: 184 GGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSK 238 Score = 34.3 bits (75), Expect = 0.12 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = -1 Query: 655 GGGXGGGG---XGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 GGG GGG G G G GG G G G GGGG G Sbjct: 184 GGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGG 229 Score = 31.5 bits (68), Expect = 0.83 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -2 Query: 654 GGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GG G GGG G G GGG G G GG G Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYG 227 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GG GGG G G GG G G G GGG Sbjct: 205 GGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGGG 241 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG 569 GGG GGG G G GG GG G Sbjct: 213 GGGYGGGRGGGGGYGGGRRDYGGGSKGGG 241 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 35.5 bits (78), Expect = 0.051 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = -1 Query: 652 GGXGGGGXGXGXXG-----GXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG GGGG G G G GG G G G GGGG GG Sbjct: 730 GGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRGGGG 777 Score = 34.7 bits (76), Expect = 0.089 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXG 529 GG G G GGG G G G G GGG G GG G Sbjct: 749 GGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGG 796 Score = 32.3 bits (70), Expect = 0.47 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGG-XGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 GG GGGG G G GG G G G G GG G G Sbjct: 780 GGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGGYGQGSGG 823 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -2 Query: 654 GGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GG G GG G G G GGG GG GG Sbjct: 749 GGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGG 791 Score = 28.3 bits (60), Expect = 7.7 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GGG GGG G G G GGG GG GG Sbjct: 733 GGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGG 781 Score = 28.3 bits (60), Expect = 7.7 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 677 RXGGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXG 528 R GGG GGG G G G GG G G G G GG G Sbjct: 754 RSGGGYRGGG-GYGGGGGGYRGG--GGYGGGHRGGGGYGGGGHRGGSYSG 800 Score = 28.3 bits (60), Expect = 7.7 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXG--XGGXXXGGXG 520 GGG GGG G GG G G G G GG G GG G Sbjct: 761 GGGGYGGGGGGYRGG--GGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYG 811 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 35.5 bits (78), Expect = 0.051 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GGG GGG GG G G G G GGG G GG GG Sbjct: 93 GGGSQGGGYRSGGG---GYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGG 138 Score = 34.7 bits (76), Expect = 0.089 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG GGG G GG GG G G G GGGG GG Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGR---GYGGGRGGGGRRDYGG 351 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXG 544 GGG GG G GGG G G G G GGG G Sbjct: 316 GGGYRSGGGGGYGGGRGG--GRGYGGGRGGGGRRDYGGGSRSG 356 Score = 28.3 bits (60), Expect = 7.7 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 652 GGXGGGG-XGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 G GGGG G G G GG G G G GGGG Sbjct: 89 GERGGGGSQGGGYRSG--GGGYGGSSRGGYGGGRGGGG 124 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 35.5 bits (78), Expect = 0.051 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +2 Query: 509 IFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 +F P PP P PPP P P PPP P P PPP Sbjct: 358 LFSFPPPPII----PIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPP 408 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +3 Query: 546 PPPXPXPX---PXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPP P P PP PP PPP PPP Sbjct: 383 PPPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPPP 422 Score = 29.1 bits (62), Expect = 4.4 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = -1 Query: 655 GGGXGGGGXGXG-XXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GGG GG G G G G G G G GG GG NF Sbjct: 2232 GGGGGGAGIGQGDCMDGDPGQAGGNGTRHGGRGGKGGVVFESVGGINPMNF 2282 >SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) Length = 592 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/70 (27%), Positives = 19/70 (27%) Frame = +3 Query: 549 PPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXXXXXXXXPXQ 728 PP P P P PP PP PPP P P P Q Sbjct: 70 PPAPQPVPNNMGPPPHVNQGPPPNSANQAPPPNPGPSPSFNSQGPPQRLPLQGFPSGPGQ 129 Query: 729 XXPXXPXXXP 758 P P P Sbjct: 130 AQPLMPQQQP 139 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 35.1 bits (77), Expect = 0.067 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P PP PP P P P PPP Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 530 PXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P PPP P P P PPP P PP PPP Sbjct: 546 PAVTPSEEPPPPPPGVDIPPPLP----PSEDPKPPPPPPEPPEECPPP 589 Score = 31.5 bits (68), Expect = 0.83 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 545 PXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P P P P PP P PPP P P Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEP 582 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 530 PXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPP 658 P PP P PP P P P PP P PPP Sbjct: 550 PSEEPPPP-PPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/50 (28%), Positives = 14/50 (28%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPP 769 P P P P PPP P P PPPPP Sbjct: 542 PAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +3 Query: 552 PXPXPXPXXXXPPXXXXXXPPXXPX--PXPPPPXPPP 656 P P PP PP P P PPPP P P Sbjct: 546 PAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEP 582 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 35.1 bits (77), Expect = 0.067 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 558 PXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P P PP P P PPPP PPP Sbjct: 409 PFPTPNRRRRRSLVQPPPPPPPAPLPPPPPPPP 441 Score = 32.3 bits (70), Expect = 0.47 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPP 673 P PPP P PPP PPP Sbjct: 424 PPPPPPPAPLPPPPPPPP 441 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 552 PXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P P PP P P PPPP P P Sbjct: 409 PFPTPNRRRRRSLVQPPPPPPPAPLPPPPPPPPQP 443 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 35.1 bits (77), Expect = 0.067 Identities = 22/82 (26%), Positives = 22/82 (26%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXXX 704 P PP P P PP PP P PPPP PPP Sbjct: 888 PKTTTAPPTTPTTPKPTTPAPP------PPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPT 941 Query: 705 XXXXXPXQXXPXXPXXXPPPXP 770 P PPP P Sbjct: 942 TQASTTRPTPPPPTSALPPPIP 963 Score = 33.5 bits (73), Expect = 0.21 Identities = 24/89 (26%), Positives = 24/89 (26%), Gaps = 1/89 (1%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXX 706 P P P PPP P P P PPP P P Sbjct: 898 PTTPKPTTPAPPPPLPLAPEPPPPL------PPPPPPIQTTRPTVPTTPTTQASTTRPTP 951 Query: 707 XXXXXXPXXPXXAXXXPPPP-PPXXPXXP 790 P A PPPP PP P P Sbjct: 952 PPPTSALPPPIPATQVPPPPLPPLPPPPP 980 Score = 33.5 bits (73), Expect = 0.21 Identities = 23/84 (27%), Positives = 24/84 (28%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P PP P P PPP P P P P P PPP + Sbjct: 906 PAPPPPLPLAPEPPPPLPPPPPPI--QTTRPTVPTTPTTQASTTRPTPPPPTS------A 957 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPP 772 P PPPPPP Sbjct: 958 LPPPIPATQVPPPPLPPLPPPPPP 981 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +3 Query: 543 PPPPX---PXPXPXXXXPPXXXXXXPPXXPXPXPPPP 644 PPPP P P P PP PP P P PPPP Sbjct: 951 PPPPTSALPPPIPATQVPP------PPLPPLPPPPPP 981 Score = 32.3 bits (70), Expect = 0.47 Identities = 26/91 (28%), Positives = 26/91 (28%), Gaps = 1/91 (1%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPP-PXXPPPXAXXXXXX 697 P P P P PP P P P P PP P P P A Sbjct: 898 PTTPKPTTPAPPPP-------LPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPT 950 Query: 698 XXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P A PPPP P P P Sbjct: 951 PPPPTSALPP--PIPATQVPPPPLPPLPPPP 979 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 552 PXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 P P P PP PP P PPPP P Sbjct: 949 PTPPPPTSALPPPIPATQVPPPPLPPLPPPPPP 981 Score = 28.3 bits (60), Expect = 7.7 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPP 670 P PP PP PP P P P P PPP P PP Sbjct: 949 PTPP---PPTSALPPPIPATQVPPPPL---PPLPPPPPPVQTTTAPTLPP 992 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 35.1 bits (77), Expect = 0.067 Identities = 26/89 (29%), Positives = 26/89 (29%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 G P P P P P P P P P PPP P P PPP A Sbjct: 445 GAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPH-PRVPPPGAPHP--RVPPPGA---PH 498 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P P PPP P Sbjct: 499 QRVPPPGAPHPRVPPPGAPHPRVPPPGAP 527 Score = 35.1 bits (77), Expect = 0.067 Identities = 26/89 (29%), Positives = 26/89 (29%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 G P P P P P P P P P PPP P P PPP A Sbjct: 505 GAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPH-PRVPPPGAPHP--RVPPPGA---SH 558 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P P PPP P Sbjct: 559 PRVPPPGAPHPRVPPPGAPHPRVPPPGTP 587 Score = 34.7 bits (76), Expect = 0.089 Identities = 28/100 (28%), Positives = 28/100 (28%), Gaps = 8/100 (8%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXP---P-----PXXPP 670 G P P P P P P P P P PPP P P P P PP Sbjct: 535 GAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPH-PRVPPPGAPHPRVPPPGTPHPRVPP 593 Query: 671 PXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P A P PPP PP P Sbjct: 594 PGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPPYQRVPP 633 Score = 34.3 bits (75), Expect = 0.12 Identities = 26/94 (27%), Positives = 26/94 (27%), Gaps = 5/94 (5%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPX---PPPXXPPPXA-- 679 G P P P P P P P P P PPP P PPP P P Sbjct: 455 GAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPH-PRVPPPGAPHQRVPPPGAPHPRVPP 513 Query: 680 XXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P P PPP P Sbjct: 514 PGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 547 Score = 32.3 bits (70), Expect = 0.47 Identities = 22/89 (24%), Positives = 22/89 (24%), Gaps = 2/89 (2%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXA--XXXXX 694 P P P P PP P P P P PPP P P Sbjct: 399 PRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPH 458 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P P PPP P Sbjct: 459 PRVPPPGAPHPRVPPPGAPHPRVPPPGAP 487 Score = 31.5 bits (68), Expect = 0.83 Identities = 23/85 (27%), Positives = 23/85 (27%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXX 706 PP P PPP P P P P P PPP P P Sbjct: 532 PPPGAPHPRVPPPGAPHPRVPP-PGASHPRVPPPGAPHPRVPPPGAPHPRV--------P 582 Query: 707 XXXXXXPXXPXXAXXXPPPPPPXXP 781 P P P PPP P Sbjct: 583 PPGTPHPRVPPPGAPHPKVPPPGAP 607 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +3 Query: 507 KFLXXXPPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 +F P PPP P P P PP P P PPP P Sbjct: 440 RFPPPGAPHPRVPPPGAPHPRVPPPGAP-HPRVPPPGAPHPRVPPPGAP 487 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXP 667 PP P PPP P P P PP PPP P Sbjct: 592 PPPGAPHPKVPPPGAPYQRLP-YSGAYHPRLPPPGPPYQRVPPPGAP 637 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 34.3 bits (75), Expect = 0.12 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPPXXPPP 673 P P PPP P PPP PPP Sbjct: 286 PIPPTLPPPPPPPPPPLPPPP 306 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 PP P P PPPP P P Sbjct: 288 PPTLPPPPPPPPPPLP 303 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 PP P P PP P PPP Sbjct: 292 PPPPPPPPPPLPPPPP 307 Score = 27.1 bits (57), Expect(2) = 0.078 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 Query: 521 PXPPXXXPPXPXPPP 565 P PP PP P PPP Sbjct: 286 PIPPTLPPPPPPPPP 300 Score = 26.6 bits (56), Expect(2) = 0.078 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPP 658 P P PPP P PPP Sbjct: 292 PPPPPPPPPPLPPPPP 307 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 34.3 bits (75), Expect = 0.12 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPPXXPPP 673 P P PPP P PPP PPP Sbjct: 62 PIPPTLPPPPPPPPPPLPPPP 82 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 PP P P PPPP P P Sbjct: 64 PPTLPPPPPPPPPPLP 79 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 PP P P PP P PPP Sbjct: 68 PPPPPPPPPPLPPPPP 83 Score = 27.1 bits (57), Expect(2) = 0.082 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 Query: 521 PXPPXXXPPXPXPPP 565 P PP PP P PPP Sbjct: 62 PIPPTLPPPPPPPPP 76 Score = 26.6 bits (56), Expect(2) = 0.082 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPP 658 P P PPP P PPP Sbjct: 68 PPPPPPPPPPLPPPPP 83 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 34.7 bits (76), Expect = 0.089 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG--GGXXXXG 527 GGG GGGG G G GG GG G G G GG G Sbjct: 81 GGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDG 125 Score = 31.9 bits (69), Expect = 0.63 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = -2 Query: 672 GGGXX--GGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGG 541 GGG GGG G GGG G G G G GG G G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDG 119 Score = 31.5 bits (68), Expect = 0.83 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = -1 Query: 655 GGGX--GGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGGG G G GG GG G G G GG GG Sbjct: 74 GGGDTDGGGGCGGGGGGG------GGVGGGGGGGGGGGDDCEDGGG 113 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G G G G G Sbjct: 91 GGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDGDEG 128 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXG 544 G G GGG G GGG G G G GG G Sbjct: 83 GCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDG 125 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 34.7 bits (76), Expect = 0.089 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PPP P P PP PP P PP P PP Sbjct: 1246 PPKFMGLPPPPPGMRPMPPQPPFMPP--PPRMQPPGPPGPPGPP 1287 Score = 33.1 bits (72), Expect = 0.27 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P PP PP P PPP PP Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPP 1278 Score = 32.7 bits (71), Expect = 0.36 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPP-PXXPP 670 P PP PP PP P P P PPP PP P PP Sbjct: 1235 PPPPPAMPPD-GPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPP 1284 Score = 32.3 bits (70), Expect = 0.47 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 506 KIFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXP 652 K G P PP P P PP P P P P P P P P Sbjct: 1248 KFMGLPPPPPGMRPMPPQPP-----FMPPPPRMQPPGPPGPPGPPGPQP 1291 Score = 31.9 bits (69), Expect = 0.63 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 6/57 (10%) Frame = +2 Query: 521 PXPPXXXPPXPX-----PPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPP-PXXPPP 673 P PP P P PPP P P P P PP P PP P P P Sbjct: 1236 PPPPAMPPDGPPKFMGLPPPPPGMRPMPPQP-PFMPPPPRMQPPGPPGPPGPPGPQP 1291 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 550 PPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPPXXPPPXR 678 PP P P P PP P P P P PPP R Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQP---PFMPPPPR 1274 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 34.7 bits (76), Expect = 0.089 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -1 Query: 655 GGGXGGGGXGXGXXG--GXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 446 GGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 31.9 bits (69), Expect = 0.63 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -2 Query: 657 GGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G GGG G G G G G G G GG GG G Sbjct: 439 GDGRGGDGGGDGG--GGGDGGGDGIDGGDGGGDGGGDGGGDGGGDG 482 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGG 556 GGG GGG G G G G G G GGG Sbjct: 446 GGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXG 544 G GG G GGG G G G GGG G G Sbjct: 439 GDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGG 480 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -2 Query: 657 GGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G G G G GGG G G GG G Sbjct: 421 GGGRDDGDGDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDG 466 >SB_25393| Best HMM Match : Collagen (HMM E-Value=0.00015) Length = 391 Score = 34.7 bits (76), Expect = 0.089 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PPP P P PP PP P P PPP Sbjct: 286 PPVDIQPPPVDIQPPPVDIQPPPVDIQQPPVDIQPPPVDIQPPP 329 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PPP P P P PP P P PP Sbjct: 293 PPVDIQPPPVDIQPPPVDIQQPPVDIQPPPVDIQPPPVDIQQPP 336 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PPP P PP PP P PPP Sbjct: 300 PPVDIQPPPVDIQQPPVDIQPPPVDIQPPPVDIQQPPVDIQPPP 343 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P P PP PP P P PP Sbjct: 307 PPVDIQQPPVDIQPPPVDIQPPPVDIQQPPVDIQPPPVDIQQPP 350 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 34.7 bits (76), Expect = 0.089 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P PP PP P PP PPP Sbjct: 469 PPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPP 506 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPP 644 PP PPP P P PP PP P PPPP Sbjct: 470 PPPMGMYPPPRGFPPPPFGPPPPFYRGPPP--PRGMPPPP 507 Score = 33.1 bits (72), Expect = 0.27 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 530 PXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP PPP P P PPP P PP PP Sbjct: 451 PPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPP 498 Score = 31.9 bits (69), Expect = 0.63 Identities = 27/118 (22%), Positives = 29/118 (24%), Gaps = 7/118 (5%) Frame = +2 Query: 449 PPXXFRGNXXFXKLEXXXKKIFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXX 628 PP + L + P P PP P PP P P P Sbjct: 405 PPAEKEDQGDYFNLSTPAANMRLPPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGG 464 Query: 629 -----PPPXXPXPPP--XXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 PPP PPP PPP P P PP P Sbjct: 465 MRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPPRQRMPSQGPPQVHYP 522 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPP 644 PP PPP P P PP PP P PP Sbjct: 478 PPRGFPPPPFGPPPPFYRGPPPPRGMPPPPRQRMPSQGPP 517 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 34.7 bits (76), Expect = 0.089 Identities = 21/88 (23%), Positives = 23/88 (26%) Frame = +3 Query: 507 KFLXXXPPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXX 686 +F PP PP P P P P PP PPP PP Sbjct: 766 QFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPPPPPPVARKPSRSNST 825 Query: 687 XXXXXXXXXXXPXQXXPXXPXXXPPPXP 770 + P PPP P Sbjct: 826 SSQRSLELQSPSREEGPSLITAEPPPPP 853 Score = 33.1 bits (72), Expect = 0.27 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 3/65 (4%) Frame = +2 Query: 587 PXXPXXXXPXXPXXPPPXXPXPPPXXP-PPXAXXXXXXXXXXXXXXXPXXP--XXAXXXP 757 P P P P PP P PPP P PP P P P Sbjct: 751 PPLPPKVTPKPPA-PPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEP 809 Query: 758 PPPPP 772 PPPPP Sbjct: 810 PPPPP 814 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 3/45 (6%) Frame = +3 Query: 525 PPXXXXPP---PPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PP PP P P P PP P P PP P P Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAP 792 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P PP P P P PP P P P P PP Sbjct: 759 PKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPP 801 Score = 28.3 bits (60), Expect = 7.7 Identities = 21/76 (27%), Positives = 22/76 (28%) Frame = +2 Query: 542 PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXX 721 P P PP P P PPP P PP P A Sbjct: 749 PAPPLPPKVTPKPPAP-------PQFAPVPPPCAPIPP---MPCSAPLPPAPAPFSAAPH 798 Query: 722 XPXXPXXAXXXPPPPP 769 P P + PPPPP Sbjct: 799 LPPAPNISAEPPPPPP 814 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 5/42 (11%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPP-----PPXPPP 656 PP P P PP PP P P P PP P P Sbjct: 751 PPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAP 792 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 34.3 bits (75), Expect = 0.12 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 324 GGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDG 360 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXG 551 GGG GGGG G G GG G G G Sbjct: 322 GGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNG 356 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 GGG GGGG G G GG G G G G Sbjct: 320 GGGGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDG 362 Score = 29.1 bits (62), Expect = 4.4 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G GG G G G G G G G Sbjct: 326 GGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDGNGDDDDGDGDGDDG 376 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +2 Query: 542 PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPP-PXXPXPPPXXPPPXA 679 PP P PP P P P PP P PP PPP A Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPA 207 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPP 644 P PP P P PP PP P P P PP Sbjct: 171 PFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 32.3 bits (70), Expect = 0.47 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 509 IFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXP 667 I P P P P P P P P PP P PPP P Sbjct: 157 IASQPPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 1/45 (2%) Frame = +2 Query: 542 PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPP-PXXPXPPPXXPPP 673 PP P P P P P P PP P PP P P Sbjct: 164 PPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAP 208 Score = 29.1 bits (62), Expect = 4.4 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P P P PP PPP A P P PPPPP P Sbjct: 164 PPAPPAAPFMAPAAPPAPPPPGAPAAP-----------PAPPFGGPPSAPPPPPAPP 209 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPP-----PXXPXPPPXXPPP 673 PP P P P P P P P PP P P PP PPP Sbjct: 2595 PPFFGPQLPPPDMFPPQMMPPMVPMMLPPMLPLPPPGLPMQPEAPVQPPPLPPP 2648 Score = 32.3 bits (70), Expect = 0.47 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +2 Query: 527 PPXXXPPXPXPP--PXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXP-PPXA 679 PP PP PP P P P P P P P PPP P PP A Sbjct: 2604 PPDMFPPQMMPPMVPMMLPPMLPLPPPGL-PMQPEAPVQPPPLPPPGGPFPPVA 2656 Score = 31.9 bits (69), Expect = 0.63 Identities = 25/94 (26%), Positives = 25/94 (26%), Gaps = 7/94 (7%) Frame = +2 Query: 530 PXXXPPXPXPPPXXXXXXXPXXPXXXXPXX-PXXPP---PXXPXP---PPXXPPPXAXXX 688 P P PP P P P PP P P P PP PP Sbjct: 2561 PQNFPQNVEQPPPQPQMNAAMSPDRRWPIVAPMQPPFFGPQLPPPDMFPPQMMPPMVPMM 2620 Query: 689 XXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P PP PPP P P Sbjct: 2621 LPPMLPLPPPGLPMQPEAPVQPPPLPPPGGPFPP 2654 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 33.9 bits (74), Expect = 0.16 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 7/62 (11%) Frame = +2 Query: 515 GXPXPPXXXP----PXPXPP-PXXXXXXXPXXPXXXXPXXPXXPPPXXP--XPPPXXPPP 673 G P PP P P P PP P P P PPP P PPP PP Sbjct: 384 GGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPPS 443 Query: 674 XA 679 A Sbjct: 444 DA 445 Score = 31.1 bits (67), Expect = 1.1 Identities = 22/88 (25%), Positives = 23/88 (26%) Frame = +2 Query: 530 PXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXX 709 P PP PP P P P P PPP PP Sbjct: 367 PVQRPPGMRPPGAGNGPGGPPPPWSK-------PGGILPGPPPPGPPMLNMAPSIPPWQT 419 Query: 710 XXXXXPXXPXXAXXXPPPPPPXXPXXPF 793 P P PPPPP P+ Sbjct: 420 TPGYIPPPPPGFPQFQPPPPPPPSDAPW 447 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PP P P P P PP P P PPPP P Sbjct: 309 PPAASEPAAFAPAPPPSQAPPP------PKTIPSTLPPPPVP 344 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 33.9 bits (74), Expect = 0.16 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -1 Query: 655 GGGXGG--GGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GG GG G G GG GG G G GGG Sbjct: 209 GGGRGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYGSYGGG 248 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXP-XXPXXPPPXXPXPPPXXPP 670 P PP PP P PP P P P P P PP PP Sbjct: 20 PKPPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPP 70 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 3/52 (5%) Frame = +3 Query: 510 FLXXXPPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXP---PPPXPPP 656 F P P PP P P PP PP P P PP PP Sbjct: 9 FKTKRPVDQATPKPPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPP 60 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPP--XPPP 656 PP P PP P P PP PP P PP PPP Sbjct: 34 PPGTNIPTPPSPNTPPPVTQPP---VTQPPVTQPPVTQPPVTQPPP 76 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 33.9 bits (74), Expect = 0.16 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGGG G GG G G G GGG GG Sbjct: 165 GGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGG 208 Score = 31.5 bits (68), Expect = 0.83 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG GGG G G GG GG G G G GG GG Sbjct: 160 GGRDRGGGYGGGGEGG--YGMGGGDYSGGCGYGSSYGGGGDYGG 201 Score = 30.3 bits (65), Expect = 1.9 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G G G G G G GG G G GG G Sbjct: 165 GGGYGGGGEGGYGMG-----GGDYSGGCGYGSSYGGGGDYGGGPGYGGGQG 210 Score = 28.7 bits (61), Expect = 5.8 Identities = 25/87 (28%), Positives = 25/87 (28%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G G GGG G G G G Sbjct: 138 GRDGGGGG----YRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSY 193 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 194 GGGGDYGGGPGYGGGQGYGSYSGGGGG 220 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 564 PXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P P PP PP P PPPP PP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPP 217 Score = 32.7 bits (71), Expect = 0.36 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 P PPPP P P PP PP P P PP P Sbjct: 190 PMAGMPPPPPPPP------PPGFPGGAPPPPPPPFGAPPPP 224 Score = 28.3 bits (60), Expect = 7.7 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPP 658 P P PP P PPP P P P PPP PPP Sbjct: 188 PSPMAGMPPPPPPPPP------PGFPGGAPPP----PPPPFGAPPP 223 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 33.5 bits (73), Expect = 0.21 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GGG GG G GG G G G G GG GG G Sbjct: 121 AGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGGG 173 Score = 31.9 bits (69), Expect = 0.63 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G GG G G G G G GG Sbjct: 142 GGGQEGGGQGGAQAGGSTSGSSSGGATSGGGGVSGSSGTSIAGG 185 Score = 29.5 bits (63), Expect = 3.3 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = -1 Query: 655 GGGXGGG-----GXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GG G G GG GG G G GG G GG Sbjct: 109 GGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGG 157 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 A GGG GG G GG G G G G GG GG Sbjct: 107 AEGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGG 157 Score = 29.1 bits (62), Expect = 4.4 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXG-XXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G GGG G G G GG G G G G Sbjct: 136 GGGAAGGG-GQEGGGQGGAQAGGSTSGSSSGGATSGGGGVSGSSGTSIAGGG 186 >SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 274 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXP-XPXPPPPXPPP 656 P PPPP P P P P P PPP PPP Sbjct: 51 PQMGMPPPPGPGQPEMPGQPQVTPQTPSPASPGLPFMPPPPPPP 94 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 557 PPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 PPP P P P P P P PP PPP Sbjct: 57 PPPGPGQPEMPGQPQVT-PQTPSPASPGLPFMPPPPPPP 94 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 33.1 bits (72), Expect = 0.27 Identities = 18/50 (36%), Positives = 21/50 (42%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKNFF 503 GG GG G GG GG G G G GGGG GG +++ Sbjct: 213 GGVGGRSVWNGVPGGFG----GGGGVWGNGGGGGGGGGYSGGGSGNPHYY 258 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXG 550 GG GGG GG G G G G GGG G Sbjct: 226 GGFGGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGG 265 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G G GGG G G GG GG GGGG G Sbjct: 227 GFGGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGGSYNSG 270 >SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 33.1 bits (72), Expect = 0.27 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG G G G GG G G G GG G GG Sbjct: 425 GGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGG 468 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 A GGG G G G GG G G G G GG G GG GG Sbjct: 423 ASGGGHKGAGGGSAAGGGTG-SGSTGNGNAG----NGGAGGGGAGGGSTGG 468 Score = 28.3 bits (60), Expect = 7.7 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GG G G GG G G G G GGG G G G G Sbjct: 405 GGSSSGTGASSAGGSSAGASG---GGHKGAGGGSAAGGGTGSGSTGNGNAG 452 Score = 28.3 bits (60), Expect = 7.7 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 657 GGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G G G G G G GG GG G Sbjct: 418 GSSAGASGGGHKGAGGGSAAGG-GTGSGSTGNGNAGNGGAGGGGAG 462 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 33.1 bits (72), Expect = 0.27 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = -2 Query: 672 GGGXXGGGXGXXG-GGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GG G GG G G G GGG GG GG G Sbjct: 155 GGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGG 206 Score = 33.1 bits (72), Expect = 0.27 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG--GXXXXGG 524 GG G GG G GG GG G G GGG G GG Sbjct: 170 GGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGGNDGGRDDGG 215 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 33.1 bits (72), Expect = 0.27 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 PP P P PPPP PPP Sbjct: 54 PPPPPPPPPPPPPPPP 69 Score = 33.1 bits (72), Expect = 0.27 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 PP P P PPPP PPP Sbjct: 55 PPPPPPPPPPPPPPPP 70 Score = 33.1 bits (72), Expect = 0.27 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 PP P P PPPP PPP Sbjct: 56 PPPPPPPPPPPPPPPP 71 Score = 32.3 bits (70), Expect = 0.47 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPP 673 P PPP P PPP PPP Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPPXXPP 670 P P PPP P PPP P Sbjct: 56 PPPPPPPPPPPPPPPPSSSP 75 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 33.1 bits (72), Expect = 0.27 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PPP P P PP PP P P P P Sbjct: 726 PPFKQVPPPYKQVPHPYKQVPPPYKQVPPPYKQVPHPYKQVPAP 769 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXP 623 P PPPP P P PP PP P Sbjct: 190 PWTSVPPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PPP P P P P P P PPP Sbjct: 663 PPYKQVPPPYKQVPHPYKQVPHPYKQVPAPYKQVPLPYKQVPPP 706 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 33.1 bits (72), Expect = 0.27 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPP--PP--XPPP 656 P PPP P P PP P P P PP PP PPP Sbjct: 163 PPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPP 209 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P P PP P P P PPP P PP PP Sbjct: 173 PIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPR--TQPPPIPPIDPPRTQPP 221 Score = 33.1 bits (72), Expect = 0.27 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPP--PP--XPPP 656 P PPP P P PP P P P PP PP PPP Sbjct: 176 PPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPP 222 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP PP PPP P P P P P P P P Sbjct: 183 PIPPID-PPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIFPQPTTPAP 232 Score = 29.5 bits (63), Expect = 3.3 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 4/55 (7%) Frame = +3 Query: 504 KKFLXXXPPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPP--PP--XPPP 656 K + P PP P P PP P P P PP PP PPP Sbjct: 142 KPVMTPTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPP 196 Score = 28.7 bits (61), Expect = 5.8 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P P P P P P PPP P PP PP Sbjct: 160 PIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPR--TQPPPIPPIDPPRTQPP 208 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 33.1 bits (72), Expect = 0.27 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 PP P P PPPP PPP Sbjct: 1307 PPESPPPPPPPPPPPP 1322 Score = 32.3 bits (70), Expect = 0.47 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPP 673 P PPP P PPP PPP Sbjct: 1308 PESPPPPPPPPPPPPPPP 1325 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPP 590 PP PPPP P P P PP Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 588 PXXXXXXPPXXPXPXPPPPXPP 653 P PP P P PPPP PP Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPPXXPPP 673 P P PPP P PPP PP Sbjct: 1308 PESPPPPPPPPPPPPPPPLPP 1328 Score = 29.9 bits (64), Expect = 2.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 P P P PPPP PPP Sbjct: 1308 PESPPPPPPPPPPPPP 1323 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPP 673 P PP P PPP PPP Sbjct: 1307 PPESPPPPPPPPPPPPPP 1324 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 PP P P PPPP P P Sbjct: 1312 PPPPPPPPPPPPPPLP 1327 Score = 29.1 bits (62), Expect(2) = 0.98 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPP 673 P PPP P PPP P P Sbjct: 1313 PPPPPPPPPPPPPLPPTP 1330 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 PP P P PPPP PP Sbjct: 1313 PPPPPPPPPPPPPLPP 1328 Score = 20.6 bits (41), Expect(2) = 0.98 Identities = 7/15 (46%), Positives = 7/15 (46%) Frame = +2 Query: 521 PXPPXXXPPXPXPPP 565 P PP P PPP Sbjct: 1307 PPESPPPPPPPPPPP 1321 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 32.7 bits (71), Expect = 0.36 Identities = 26/95 (27%), Positives = 26/95 (27%), Gaps = 5/95 (5%) Frame = +2 Query: 521 PXPPXXXPPXPXPPP---XXXXXXXPXXPXXXXPXXPXXPP--PXXPXPPPXXPPPXAXX 685 P PP PP PPP P P P P PP P P PP PP Sbjct: 29 PPPP---PPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPA 85 Query: 686 XXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P PP P P P Sbjct: 86 GAIGPPGLPGPNGVNGPPGELGDMGPPGPPGPPGP 120 Score = 32.3 bits (70), Expect = 0.47 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PP PPP P P P PP P P P P PP Sbjct: 31 PPPPYEAPPPPPGP-PGPDGPPGFPGPQGPNGPKGPPGLPGPP 72 Score = 32.3 bits (70), Expect = 0.47 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PP PPPP P P P P P PP PP Sbjct: 33 PPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPP 75 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 2/44 (4%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPP--PPXPP 653 P PP P P P PP P P P PP PP Sbjct: 84 PAGAIGPPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPP 127 >SB_52043| Best HMM Match : Collagen (HMM E-Value=0.77) Length = 97 Score = 32.7 bits (71), Expect = 0.36 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGGG G G GG G GGGG GG Sbjct: 4 GDDGGGGGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDGG 46 >SB_33199| Best HMM Match : Collagen (HMM E-Value=0.77) Length = 134 Score = 32.7 bits (71), Expect = 0.36 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGGG G G GG G GGGG GG Sbjct: 44 GDDGGGGGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDGG 86 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +2 Query: 509 IFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPP 634 +F P PP PP P PP P P P PP Sbjct: 1656 VFHYPAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPP 1697 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PPP P P P P P P PP PP Sbjct: 1662 PPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPP 1697 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 GG GGG G G GG GG G G GGG G Sbjct: 175 GGGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGG 216 Score = 31.5 bits (68), Expect = 0.83 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GG G G G GG G G GGG GG Sbjct: 145 GGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGG 188 Score = 29.5 bits (63), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 5/54 (9%) Frame = -2 Query: 672 GGGXXGGGX-----GXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GGG GGG G GGG G G G G G GG GG Sbjct: 162 GGGSMGGGMMSMAGGGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGG 215 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 32.7 bits (71), Expect = 0.36 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGG G G G GG G GGGG Sbjct: 104 GGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXG 544 GG GGG G GG G G G GGG G G Sbjct: 100 GGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGG 541 GG GGG GGG G G G GG G GG Sbjct: 100 GGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 >SB_43407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 258 Score = 32.7 bits (71), Expect = 0.36 Identities = 19/69 (27%), Positives = 22/69 (31%), Gaps = 5/69 (7%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPP-----PPX 775 P P P P P PP PP + P + PPPP PP Sbjct: 189 PGDPGAPEPPEPDNPPASPPMASLSQDRHSASGNAVTHPTSQENSYTGPPPPPYTSLPPD 248 Query: 776 XPXXPFFFP 802 P P+ P Sbjct: 249 DPPPPYDEP 257 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 32.7 bits (71), Expect = 0.36 Identities = 23/83 (27%), Positives = 23/83 (27%) Frame = -2 Query: 768 GGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGXX 589 GG GG G G G G GGG G G G G Sbjct: 236 GGQGGTSSGGGGYGGETYACLSSTYGKGGDRNQPGNAGGGAGEGSTGGPGGINAGGGGGD 295 Query: 588 GXXXXXXXGGGXGXGGXXXGGXG 520 GG G GG GG G Sbjct: 296 STTDSDDGAGGGGGGGHFSGGAG 318 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 32.7 bits (71), Expect = 0.36 Identities = 26/96 (27%), Positives = 26/96 (27%), Gaps = 12/96 (12%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXX-------PXXPXXPPPXXPXPPPXXPP-PX 676 P PP P P PP P P P PPP PP PP P Sbjct: 246 PPPPVPPPTIPSVPPGSETYVPPGSATYESMDSVNKAPVPPMTPPPAVVTAPPPAPPLPN 305 Query: 677 AXXXXXXXXXXXXXXXPXX----PXXAXXXPPPPPP 772 P P PPPPPP Sbjct: 306 FTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPP 341 Score = 32.3 bits (70), Expect = 0.47 Identities = 18/60 (30%), Positives = 19/60 (31%), Gaps = 3/60 (5%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPPXXP---PPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P PPP P PP PP + P P A PPP P P Sbjct: 245 PPPPPVPPPTIPSVPPGSETYVPPGSATYESMDSVNKAPVPPMTPPPAVVTAPPPAPPLP 304 Score = 32.3 bits (70), Expect = 0.47 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P PP P PP P P PPPP PP Sbjct: 283 PVPPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLPP 319 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP P P P P PP P PPP PPP Sbjct: 298 PPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPP 341 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 4/48 (8%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPP----XXPXPXPPPPXPPP 656 PP PPPP P P PP P P P PPP Sbjct: 329 PPEVLSPPPPPPPSEDFYSMPSSLPMPSPPEDLYDAPATLPSPIMPPP 376 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 1/50 (2%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXP-XXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 PP P P PPP P P P P P P PPP Sbjct: 329 PPEVLSPPPPPPPSEDFYSMPSSLPMPSPPEDLYDAPATLPSPIMPPPPP 378 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 564 PXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P PP PP P P P PPP Sbjct: 283 PVPPMTPPPAVVTAPPPAPPLPNFTSPSPPP 313 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PP P P P P P P P PPPP PP Sbjct: 357 PPSTPAPTPA----PLSSTPCAPFAPPPPPPPPPPP 388 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P P P P P P PP P P P P P Sbjct: 358 PSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAPGSTP 394 Score = 29.9 bits (64), Expect(2) = 0.38 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 596 PXXXXPXXPXXPPPXXPXPPPXXP 667 P P P PPP P PPP P Sbjct: 367 PLSSTPCAPFAPPPPPPPPPPPAP 390 Score = 21.4 bits (43), Expect(2) = 0.38 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 755 PPPPPPXXPXXP 790 PPPPPP P Sbjct: 383 PPPPPPAPGSTP 394 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 32.3 bits (70), Expect = 0.47 Identities = 22/51 (43%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = -1 Query: 655 GGGXGGG-GXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GGG GGG G G G GG GG G G G GGGG G K + Sbjct: 26 GGGHGGGHGYGGGPNGG------GG----GGGGGGGGGGDEDDSGKNGKEY 66 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXG 586 GGG GGG G GG G G G G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGG 53 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 32.3 bits (70), Expect = 0.47 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +2 Query: 551 PXPPPXXXXXXXPXXPXXXXPXXPXXPPPXX---PXPPPXXPPP 673 P PPP P P P PPP P PPP PPP Sbjct: 280 PPPPPPLTGGMLPP-PFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 32.3 bits (70), Expect = 0.47 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPP 644 PPP P P PP PP P PP P Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PPPP P P PP P P P P P P Sbjct: 95 PPPPATPPPPTM--PPTPPPPQTPAPPGPDTPAPPAP 129 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 32.3 bits (70), Expect = 0.47 Identities = 22/84 (26%), Positives = 22/84 (26%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 G P PP PPP P P P PP PPP A Sbjct: 512 GGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGP---PPPGAGQGWGQPPPGAGQGGG 568 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPP 766 P P PPPP Sbjct: 569 PPPPGAGQGGPPPPGAGQEGPPPP 592 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 31.9 bits (69), Expect = 0.63 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG GGG G G GG GG G G GGG GG Sbjct: 424 GGPGGGYEGRGR-GGRGGPRGGGPRGYDGGYGQGGGYEGYSGG 465 >SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) Length = 253 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGG 608 GGG GGGG G G GG Sbjct: 165 GGGGGGGGGGGGRRGG 180 Score = 26.2 bits (55), Expect(2) = 0.68 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -2 Query: 672 GGGXXGGGXGXXGGG 628 GGG GGG G GGG Sbjct: 167 GGGGGGGGGGRRGGG 181 Score = 24.2 bits (50), Expect(2) = 0.68 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 798 KKKGXXGXXGGGGGG 754 +++G G GGGGGG Sbjct: 161 RRRGGGGGGGGGGGG 175 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 31.5 bits (68), Expect = 0.83 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 666 GXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GG G GG G G G G G G GG G G Sbjct: 777 GGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASG 825 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = -2 Query: 669 GGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GG GG G GG G G G G GG G G GG G Sbjct: 777 GGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAG 828 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -2 Query: 666 GXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GG G GG G G G G G G G G G Sbjct: 788 GGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASG 836 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -2 Query: 666 GXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G GG G G G G G G GG G G Sbjct: 792 GGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADG 840 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 31.5 bits (68), Expect = 0.83 Identities = 30/101 (29%), Positives = 31/101 (30%), Gaps = 7/101 (6%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXX-----GGGXG-X 640 G +G G G GGG G G G G G GGG G Sbjct: 244 GMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRG 303 Query: 639 XGGGXXGXXGXXXXGXXGXXXXXXXGG-GXGXGGXXXGGXG 520 GGG G G G GG G G GG G G Sbjct: 304 PGGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPG 344 Score = 29.1 bits (62), Expect = 4.4 Identities = 23/86 (26%), Positives = 24/86 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G +G G G G GG G G G G GG GGG Sbjct: 275 GMGRGPGGGWGRGSGGGWGRMQG--GGMGRGPGGGWGRMQGGMGRGPGGGWGRMQGGGMG 332 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXG 544 G G GGG G G Sbjct: 333 RGPGGGLGRGPGGGWGRMQGGGMGRG 358 Score = 28.3 bits (60), Expect = 7.7 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = -1 Query: 655 GGGXG-GGGXGXGXXGGXXXXXXGGXXXX---GXGXGXGGGGXXXXGG 524 G G G GGG G G GG G G G G GGG GG Sbjct: 251 GWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGG 298 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 31.5 bits (68), Expect = 0.83 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 629 PPPXXPXPPPXXPPPXA 679 PPP P PPP PPP A Sbjct: 79 PPPPPPPPPPPPPPPGA 95 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 610 PPXXXXPXPXXPXPPPXXPPP 672 PP P P P PPP PPP Sbjct: 73 PPPLCAPPPPPPPPPPPPPPP 93 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 609 PPXXPXPXPPPPXPP 653 PP P P PPPP PP Sbjct: 79 PPPPPPPPPPPPPPP 93 Score = 29.9 bits (64), Expect = 2.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 PP P PPPP PPP Sbjct: 74 PPLCAPPPPPPPPPPP 89 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 PP P PPPP PPP Sbjct: 73 PPPLCAPPPPPPPPPP 88 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 P P P PPPP PPP Sbjct: 75 PLCAPPPPPPPPPPPP 90 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +3 Query: 504 KKFLXXXPPXXXXPPPPXPXPXPXXXXP 587 K PP PPPP P P P P Sbjct: 66 KSMAAATPPPLCAPPPPPPPPPPPPPPP 93 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 585 PPXXXXXXPPXXPXPXPPPP 644 PP PP P P PPPP Sbjct: 73 PPPLCAPPPPPPPPPPPPPP 92 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 585 PPXXXXXXPPXXPXPXPPPP 644 PP PP P P PPPP Sbjct: 74 PPLCAPPPPPPPPPPPPPPP 93 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 31.5 bits (68), Expect = 0.83 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 629 PPPXXPXPPPXXPPPXA 679 PPP P PPP PPP A Sbjct: 280 PPPPPPPPPPPPPPPGA 296 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 610 PPXXXXPXPXXPXPPPXXPPP 672 PP P P P PPP PPP Sbjct: 274 PPPLCAPPPPPPPPPPPPPPP 294 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 609 PPXXPXPXPPPPXPP 653 PP P P PPPP PP Sbjct: 280 PPPPPPPPPPPPPPP 294 Score = 29.9 bits (64), Expect = 2.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 PP P PPPP PPP Sbjct: 275 PPLCAPPPPPPPPPPP 290 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 PP P PPPP PPP Sbjct: 274 PPPLCAPPPPPPPPPP 289 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 P P P PPPP PPP Sbjct: 276 PLCAPPPPPPPPPPPP 291 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +3 Query: 504 KKFLXXXPPXXXXPPPPXPXPXPXXXXP 587 K PP PPPP P P P P Sbjct: 267 KSMAAATPPPLCAPPPPPPPPPPPPPPP 294 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 585 PPXXXXXXPPXXPXPXPPPP 644 PP PP P P PPPP Sbjct: 274 PPPLCAPPPPPPPPPPPPPP 293 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 585 PPXXXXXXPPXXPXPXPPPP 644 PP PP P P PPPP Sbjct: 275 PPLCAPPPPPPPPPPPPPPP 294 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 31.5 bits (68), Expect = 0.83 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPP 658 P PP PP P P P P PPP P PPP Sbjct: 1425 PPPPMAFPPMPPAPGQVITHLQHIVHHKILPPPP--PPPAPPCPPP 1468 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP P PP P PP P P P PP PPP Sbjct: 1427 PPMAFPPMPPAPGQVITHLQHIVHHKILPP--PPPPPAPPCPPP 1468 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 31.5 bits (68), Expect = 0.83 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = -1 Query: 655 GGGXG-GGGXGXGXXGGXXXXXXGGXXXX---GXGXGXGGGGXXXXGG 524 G G G GGG G G GG GG G G G GGG GG Sbjct: 7 GWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGG 54 Score = 31.1 bits (67), Expect = 1.1 Identities = 28/87 (32%), Positives = 28/87 (32%), Gaps = 3/87 (3%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXG---GGGXGXGXXGGX 605 G G GGG G G G GGG G GGG G G GG Sbjct: 9 GRGSGGGWGQGPGG----GWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGW 64 Query: 604 XXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG G G GGG GG Sbjct: 65 GRMQGGGM-----GRGPGGGLGRGPGG 86 >SB_58915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 27.1 bits (57), Expect(2) = 0.85 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +2 Query: 587 PXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P P P PPP PPP Sbjct: 137 PNTPSQTLATTPTAPMVTTPAPPPPPPPP 165 Score = 23.0 bits (47), Expect(2) = 0.85 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 755 PPPPPPXXP 781 PPPPPP P Sbjct: 160 PPPPPPLIP 168 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 31.1 bits (67), Expect = 1.1 Identities = 22/94 (23%), Positives = 24/94 (25%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G ++G G GGGG G GG GG Sbjct: 412 GAEEGDNGYSGGGGAGLNSNGRNNKNFGGSRGTGGEGGKSFLAGGAGGRSNQNDVEGGFG 471 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG G Sbjct: 472 GGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGG 505 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 G G GGG G G GG GG GGGG G Sbjct: 469 GFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGGSYNAG 511 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -2 Query: 666 GXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXG 550 G GGG G G G G G G GGG G Sbjct: 468 GGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGG 506 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGG 584 GGG GGGG G G GG GG Sbjct: 3698 GGGYGGGGGGYGGGGGGYGDGTGG 3721 >SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) Length = 439 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P PPP P PPP P PP PP Sbjct: 91 PPPVVTDAPTTVPPPVVTDAPTTVPPPVVTDAPTTVPPPVQPTEPPSTRPP 141 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/51 (27%), Positives = 14/51 (27%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P PPP P PPP P PPP Sbjct: 67 PPPVVTEAPTTVPPPVVTDAPTTVPPPVVTDAPTTVPPPVVTDAPTTVPPP 117 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/51 (27%), Positives = 14/51 (27%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P PPP P PPP P PPP Sbjct: 79 PPPVVTDAPTTVPPPVVTDAPTTVPPPVVTDAPTTVPPPVVTDAPTTVPPP 129 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGG 584 GGG GGGG G G GG GG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGG 584 GGG GGGG G G GG GG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGG 556 GGG GGG G GGG G G G GG Sbjct: 56 GGGGGGGGGGGGGGGGGGGGGGDGDDDDGDDDDDDDDGG 94 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXG 595 GGG GGG G GGG G G G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXG 610 GGG GGG G GGG G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGG 73 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GG G G GG G G GGGG Sbjct: 491 GGGGASGGGGGGGGGGGFSGGACGDFTSGLSPTCGGGG 528 Score = 26.6 bits (56), Expect(2) = 2.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGGGXXG 619 A GGG GGG G GG G Sbjct: 495 ASGGGGGGGGGGGFSGGACG 514 Score = 21.8 bits (44), Expect(2) = 2.3 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 789 GXXGXXGGGGGG 754 G G GGGGGG Sbjct: 491 GGGGASGGGGGG 502 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXG 550 GG GGG G GG G G G GGG G Sbjct: 423 GGSSGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGGG 462 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGG 541 GG G G GG G G G G G G GG Sbjct: 419 GGAFGGSSGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGGG 462 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.1 bits (67), Expect = 1.1 Identities = 22/89 (24%), Positives = 22/89 (24%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 G P P P P P P P P P P P P P P Sbjct: 21 GDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDP-PPNIPIPGNPPPNTPIPGDPPPNTPI 79 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P P PPP P Sbjct: 80 PGDPPPNTPIPGNPPPNTPIPGDPPPNTP 108 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P P PP P P P P PPP P P Sbjct: 60 PGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIP 110 Score = 28.7 bits (61), Expect = 5.8 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P P PP P P P P PPP P P PPP Sbjct: 70 PGDPPPNTPIPGDPPPNTPI--PGNPPPNTPI-PGDPPPNTPIP--GDPPP 115 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 10/48 (20%) Frame = +3 Query: 543 PPPPXPXPXP------XXXXPPXXXXXXPPXXPXPXP----PPPXPPP 656 PPPP P P PP P P P P PPP PPP Sbjct: 282 PPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 1/49 (2%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPP-PXXPXPPPXXPP 670 PP PP P P P P PP P PPP PP Sbjct: 281 PPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 PP PP P P P PPP P PPP Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPP 328 >SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) Length = 556 Score = 30.7 bits (66), Expect = 1.4 Identities = 23/87 (26%), Positives = 23/87 (26%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G G G GGG G G Sbjct: 471 GAIGCDGGGGANVGGDIGGNNGAIGGDNDDGAIGGDDGATVDGDDGAIGGGAIGDGGDNG 530 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG GG G Sbjct: 531 GGDDG--GDDGAGNSDGGGGNDNGGGG 555 >SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) Length = 370 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 GGG GGGG G G G G G G G G G G Sbjct: 260 GGGGGGGGDGDG-DGDGDGDGDGDGDGDGDGDGDGDGDGDGDG 301 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P PPP P PP P PPPP PP Sbjct: 174 PGILAPPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXP 623 PP PPP P P PP PP P Sbjct: 183 PPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GG GGG GGG G G G G GG GG G Sbjct: 1265 GGSSGGGMHGGGGGYGNYGGYGGYGGNPQGGYGFAGYGGQYGGPRGGGSG 1314 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGG 541 GGG GGG G G G G G G GG GG Sbjct: 1269 GGGMHGGGGGYGNYGGYGGYGGNPQGGYGFAGYGGQYGGPRGGG 1312 >SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) Length = 188 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 609 PPXXPXPXPPPPXPP 653 PP P P PPPP PP Sbjct: 32 PPPSPPPSPPPPSPP 46 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 609 PPXXPXPXPPPPXPP 653 PP P P PPPP PP Sbjct: 155 PPPSPPPSPPPPSPP 169 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXG--XGGXXXGG 526 GGG GG G G G G G G GG G GG GG Sbjct: 210 GGGGGSGGYGGGSYGGYGNYGGYSQGGYGGYADNSWSGGYGSYDGGYGNGG 260 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 1/44 (2%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXP-PPPXPP 653 PP PPPP P PP P P PP PP Sbjct: 460 PPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPP 503 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPP 670 PP P PPP P P P PP P PP Sbjct: 456 PPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPP 503 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 585 PPXXXXXXPPXXPXPXPPPPXPP 653 PP PP P PPPP PP Sbjct: 784 PPPEYPPPPPGLARPNPPPPNPP 806 Score = 25.4 bits (53), Expect(2) = 4.9 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPP 673 P PPP P PPP P Sbjct: 781 PTTPPPEYPPPPPGLARP 798 Score = 21.8 bits (44), Expect(2) = 4.9 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 Query: 725 PXXPXXAXXXPPPPPP 772 P P A PPPP P Sbjct: 790 PPPPGLARPNPPPPNP 805 >SB_57911| Best HMM Match : Drf_FH1 (HMM E-Value=2.3) Length = 169 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +1 Query: 520 SXPPXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPPXXPP 669 S PP P PP P P PP P P PP P Sbjct: 28 SRPPSESRPRPPYDDRPPSESRPRPPYDERPPSESRPRPPYERPPSESRP 77 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP P P P P P P P P PPP P P Sbjct: 115 PTPPFSTP-RPRPKAKRIRRLLPTPPPPTPPQSTPKPRRVLPTPPPKPPTP 164 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPP 638 P PP P P P PP P P PP Sbjct: 136 PTPPPPTPPQSTPKPRRVLPTPPPKPPTPRPP 167 >SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GGG G G G G G G G G G G G G G G Sbjct: 17 AGGGGDRGRGRGHCLGHGSGRGGRGGRGGSGRGRGRGRGSGRGRGRGSGQGYG 69 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 P P PP P P P PP P PPPP P Sbjct: 853 PSAPPPLPPRPVGAPPSLPPRPRTRPLPPKSDTP-PPPPRP 892 >SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GG G G G GG G G GGG Sbjct: 338 GGGRGGRGGRPGRGGRGGRGASGGRGRGGGRGGFGGG 374 >SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 GG GGGG GG GG GGGG G Sbjct: 220 GGFGGGGSAMAHPGGGGGYSGGGIEGSETTGSAGGGGSFNSG 261 >SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 955 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 4/40 (10%) Frame = +3 Query: 543 PPPPXPXPX----PXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PPPP P P P PP P P P PP P Sbjct: 533 PPPPVPKPQFDDTPTRAPPPPDMQTNPDTERRPPPLPPAP 572 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 3/45 (6%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXP---PPPXPP 653 P PPP P P P P P P PPP PP Sbjct: 526 PVRPTGPPPPPVPKPQFDDTPTRAPPPPDMQTNPDTERRPPPLPP 570 >SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G G G GGG G GG G G Sbjct: 51 GCGDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGG 101 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P P P PP P P PP PP Sbjct: 265 PPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPP 308 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PP PP P P PP P P P PP P Sbjct: 405 PPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGPGMPPMRP 446 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GGG GGG G G G G G GGG GG GG Sbjct: 346 GGGDPGGGDPGGGDPGGGDHGGGDHG-GGDHGDGDHGGGDHGGGDHGGG 393 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GGG GGG G G G G G GGG GG GG Sbjct: 351 GGGDPGGGDPGGGDHGGGDHGGGDHG-DGDHGGGDHGGGDHGGGDHGGG 398 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKIF 505 GGG GGG G G G G GG G G G G +F Sbjct: 356 GGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGGDHGGGDYGDGDHGDGDLF 411 Score = 28.7 bits (61), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 3/52 (5%) Frame = -2 Query: 672 GGGXXGG---GXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GGG GG G G GGG G G GG GG GG Sbjct: 341 GGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGG 392 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 29.5 bits (63), Expect = 3.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 PP P P PPPP PP Sbjct: 143 PPPPPPPSPPPPCHPP 158 Score = 28.3 bits (60), Expect = 7.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 621 PXPXPPPPXPPP 656 P P PPPP PPP Sbjct: 142 PPPPPPPPSPPP 153 Score = 25.8 bits (54), Expect(2) = 2.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 629 PPPXXPXPPPXXPPP 673 PPP P PPP PPP Sbjct: 142 PPP--PPPPPSPPPP 154 Score = 22.2 bits (45), Expect(2) = 2.9 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 Query: 755 PPPPPPXXPXXPFFFP 802 PPPP P P P P Sbjct: 146 PPPPSPPPPCHPPALP 161 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/52 (30%), Positives = 16/52 (30%), Gaps = 3/52 (5%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXP---XXPPPXXPXPPPXXP 667 P PP PP P P P P P PP P PP P Sbjct: 613 PSPPSRVPPQPETAPKPFPNITPPEVRPSLPGTPPETKTKPPLAPYPPKTSP 664 >SB_42551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 29.5 bits (63), Expect = 3.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 755 PPPPPPXXPXXPFFFP 802 PPPPPP P P F P Sbjct: 90 PPPPPPHTPPTPLFTP 105 >SB_38491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G G G G G G G G Sbjct: 12 GGGGGGGGDGDGDGDG---DGDGDGDGDGDGDGDGDG 45 >SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) Length = 1230 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPP 644 PPP P PP P P P PPP Sbjct: 432 PPPRPYASQFADAPPVSPTTATPPPPPPSQPPP 464 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 P P P P P P PP P P PP P P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPP-TPRPGPPTPRP 1387 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXG 610 GGG GGG G GGG G G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRG 534 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGG 608 GGG GGGG G G GG Sbjct: 514 GGGGGGGGGGGGGGGG 529 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGG 608 GGG GGGG G G GG Sbjct: 517 GGGGGGGGGGGGGRGG 532 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXG 610 GGG GGG G GGG G G Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRG 1023 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGG 608 GGG GGGG G G GG Sbjct: 1006 GGGGGGGGGGGGRRGG 1021 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PP P P P P P PP P P PP PP Sbjct: 423 PPGGGVPSHPPPLPQP----PPSIIPPPTTPLPQTVPTPPRPP 461 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GG GGG G GG GG G GGG Sbjct: 227 GGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGG 262 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGG 541 GG GGG G G G G G G GGG G Sbjct: 224 GGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGGSYCG 266 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 G G GGGG G GG G GGGG G Sbjct: 225 GFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGGSYCGG 267 >SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXG 610 GGG GGG G GGG G G Sbjct: 419 GGGGRGGGGGDGGGGGEGVQG 439 >SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) Length = 491 Score = 29.1 bits (62), Expect = 4.4 Identities = 30/109 (27%), Positives = 32/109 (29%), Gaps = 4/109 (3%) Frame = -2 Query: 801 GKKKGXXGXXG----GGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXG 634 G +G G G GGGGG G G G GGG G Sbjct: 340 GSMQGLAGGGGIQSFGGGGGADLQTLGGGGGVQTLGGQTMQ------GVQSYGGGAGMQS 393 Query: 633 GGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKIFXXKXSN 487 G G G G G GGG G G G G K+ N Sbjct: 394 FGGGGMAGMQFGGMQG---FPSLGGGGGGAGMMAGQMGYKKVCPNNLDN 439 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPP 673 P PPP PPP PPP Sbjct: 461 PIPPPPPMSPPPPTPPPP 478 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 29.1 bits (62), Expect = 4.4 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = +3 Query: 528 PXXXXPP--PPXPXPXPXXXXPP-XXXXXXPPXXPXPXPPP-PXPPP 656 P PP PP P P PP P P PPP P PPP Sbjct: 203 PNSQMPPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPP 249 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 530 PXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPP 658 P PP PPP P P PPP PPP Sbjct: 208 PPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPP 250 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 29.1 bits (62), Expect = 4.4 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 6/61 (9%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXP------XXPXXXXPXXPXXPPPXXPXPPPXXPPPX 676 G P PP P PPP P P P PPP P PP Sbjct: 67 GGPPPPGIAPGIGGPPPSGQYGAPPTSQPYGAPPTSGYPGYQQHPPPPQPSAQSYNAPPP 126 Query: 677 A 679 A Sbjct: 127 A 127 >SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 6/49 (12%) Frame = +3 Query: 525 PPXXXXPPP----PXPXPXPXXXXPPXXXXXXPP--XXPXPXPPPPXPP 653 PP PPP P P P PP P P PPP PP Sbjct: 139 PPGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPAPPPAYPP 187 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 1/45 (2%) Frame = +2 Query: 542 PPXPX-PPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 PP P PPP P P P PPP PPP Sbjct: 139 PPGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPAPPP 183 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PPP P P P P P PPP P Sbjct: 948 PPPKEPTPPPSSKPSPVKEIKPKKPIEKFISRPKPPTPPPVVSP 991 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 PP P P PPPP P P Sbjct: 1917 PPREPTPPPPPPTPLP 1932 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 545 PXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPP 670 P P P P P P P PPP P PPP P Sbjct: 926 PSPEPLPEVDIMRSPT------PTPPPSPPPKEPTPPPSSKP 961 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GG GGG G G GG G G G G GGG Sbjct: 49 GGPRGGGRGGGRGGGGGFKSPRGG---GRGGGRGGG 81 Score = 28.7 bits (61), Expect = 5.8 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGG 541 G G GG G GGG G G G G G G G GG Sbjct: 41 GAGRGGGRGGPRGGGRGGGRG----GGGGFKSPRGGGRGGGRGG 80 >SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) Length = 154 Score = 29.1 bits (62), Expect = 4.4 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXP--PP 673 P P P P PPP P P P PPP P PP P PP Sbjct: 67 PQPTQGFRPYPGPPPALSPQVYRGYP-FQYPGTP--PPPMYPAFPPSFPSSPP 116 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 549 PPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P P PP PP PPPP PPP Sbjct: 244 PHPPSVKPSVPIPPPTKP--PPRVASRRPPPPLPPP 277 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 PP P P P PP PPP Sbjct: 162 PPPQPPPPPLPPPPPP 177 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 2/51 (3%) Frame = +1 Query: 526 PPXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXP--PPXXPPP 672 PP PP P P P PP P P P PP P P Sbjct: 149 PPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYPPQGYPPTGPYP 199 Score = 28.3 bits (60), Expect = 7.7 Identities = 21/84 (25%), Positives = 23/84 (27%) Frame = +2 Query: 551 PXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPX 730 P PP P P P P PPP PP + P Sbjct: 115 PTGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTS---------YPPQPYPA 165 Query: 731 XPXXAXXXPPPPPPXXPXXPFFFP 802 P PP PPP P + P Sbjct: 166 QPYPQQGYPPQPPPQAYPQPGYPP 189 Score = 28.3 bits (60), Expect = 7.7 Identities = 16/53 (30%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXP--PPXXPPP 673 P PP PP P P P PP P P PP PP Sbjct: 142 PTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYPPQGYPP 194 >SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) Length = 245 Score = 29.1 bits (62), Expect = 4.4 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXP--PP 673 P P P P PPP P P P PPP P PP P PP Sbjct: 157 PQPTQGFRPFPGPPPVLSPQVYRGYP-FQYPGTP--PPPMYPAFPPSFPSSPP 206 >SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) Length = 245 Score = 29.1 bits (62), Expect = 4.4 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXP--PP 673 P P P P PPP P P P PPP P PP P PP Sbjct: 157 PQPTQGFRPYPGPPPVLSPQVYRCYP-FQYPGTP--PPPMYPAFPPSFPFSPP 206 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 596 PXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P PPP P P PPP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPP 102 Score = 25.0 bits (52), Expect(2) = 4.6 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 725 PXXPXXAXXXPPPPPPXXP 781 P P PPPPPP P Sbjct: 87 PPPPASNVPAPPPPPPVMP 105 Score = 22.2 bits (45), Expect(2) = 4.6 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +2 Query: 635 PXXPXPPPXXPPPXA 679 P PPP PPP A Sbjct: 77 PAAVIPPPPPPPPPA 91 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 28.3 bits (60), Expect = 7.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 621 PXPXPPPPXPPP 656 P P PPPP PPP Sbjct: 794 PPPPPPPPPPPP 805 Score = 24.6 bits (51), Expect(2) = 4.7 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 Query: 755 PPPPPPXXPXXPFFFP 802 PPPPPP P P Sbjct: 796 PPPPPPPPPPEDLIIP 811 Score = 22.6 bits (46), Expect(2) = 4.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 644 PXPPPXXPPP 673 P PPP PPP Sbjct: 795 PPPPPPPPPP 804 >SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) Length = 198 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/17 (64%), Positives = 11/17 (64%), Gaps = 1/17 (5%) Frame = +3 Query: 609 PPXXPXPXP-PPPXPPP 656 PP P P P PPP PPP Sbjct: 147 PPRTPPPEPTPPPTPPP 163 >SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 28.7 bits (61), Expect = 5.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 632 PPXXPXPPPXXPPPXA 679 PP P PPP PPP A Sbjct: 36 PPFAPLPPPVPPPPPA 51 >SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) Length = 687 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P P P PP P P P PP Sbjct: 325 PPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 368 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P P P PP P P P PP Sbjct: 332 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 375 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P P P PP P P P PP Sbjct: 339 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 382 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P P P PP P P P PP Sbjct: 353 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPP 396 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P P P PP P P P PP Sbjct: 381 PPYEPGRPPHEPGRPPHELGRPPHEPGRPPHEPGRLPHEPGRPP 424 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P P P PP P P P PP Sbjct: 318 PPHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 361 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P P P PP P P P PP Sbjct: 346 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPP 389 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGG 556 GG GGG G G G G G G GGG Sbjct: 354 GGFGGGGGGSEDNGASGGGGGYSGGGSGITWNQAGGGG 391 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GG GGG G GG GG G GGG Sbjct: 357 GGGGGGSEDNGASGGGGGYSGGGSGITWNQAGGGGG 392 >SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 28.7 bits (61), Expect = 5.8 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG GG G G GG G G G GGG GG Sbjct: 328 GGSGGSGTSEGGFGGGGATVAS---RPGGGGGYSGGGLASSGG 367 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP P P P P PP P P PP PPP Sbjct: 2175 PPMGAPPSGPPPMGAPPSGPPPMGTP--PSGHPPMGAPPMGPPP 2216 Score = 28.3 bits (60), Expect = 7.7 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPX-PPPPXPPP 656 P P P P P PP PP P P PP PPP Sbjct: 2156 PARHSPSGPSPLGAPPSVPPPMGA---PPSGPPPMGAPPSGPPP 2196 >SB_51094| Best HMM Match : VWA (HMM E-Value=0) Length = 3544 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG 548 G G GGGG G GG G G G GG Sbjct: 3197 GAGEGGGGGGESLAMTVTGLEAGGYSAGGGGGGAGG 3232 >SB_41312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 357 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGG 608 GGG GGGG G G GG Sbjct: 153 GGGRGGGGGGCGGGGG 168 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P P P PP P P P PP Sbjct: 91 PPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 134 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P P P PP P P P PP Sbjct: 98 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 141 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P P P PP P P P PP Sbjct: 105 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 148 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P P P PP P P P PP Sbjct: 119 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPP 162 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P P P PP P P P PP Sbjct: 147 PPYEPGRPPHEPGRPPHELGRPPHEPGRPPHEPGRLPHEPGRPP 190 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P P P PP P P P PP Sbjct: 84 PPHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 127 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P P P PP P P P PP Sbjct: 112 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPP 155 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 PP P P PPPP PPP Sbjct: 211 PP--PPPPPPPPPPPP 224 >SB_38133| Best HMM Match : TolA (HMM E-Value=0.38) Length = 2114 Score = 25.0 bits (52), Expect(2) = 7.7 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 755 PPPPPPXXPXXP 790 PPPPPP P P Sbjct: 1054 PPPPPPPSPTVP 1065 Score = 21.4 bits (43), Expect(2) = 7.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 743 AXXXPPPPPP 772 A PPPPPP Sbjct: 1051 AAVPPPPPPP 1060 >SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) Length = 1049 Score = 28.3 bits (60), Expect = 7.7 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -1 Query: 655 GGGXGGG-GXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG G G G G G G G G G G GGGG Sbjct: 241 GGGDGDGDGDGDGDGDGDGDGDGDGDGDGGVG-GGGGGG 278 >SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) Length = 129 Score = 28.3 bits (60), Expect = 7.7 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGG 631 G G GGGG G GC G G G GG G GG Sbjct: 76 GCGGCEGGGGSGGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGG 128 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/43 (30%), Positives = 13/43 (30%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P PP P P P PP P P P PP Sbjct: 206 PRSGPLPPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPP 248 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPPXXPPPXA 679 P P PPP P PPP PP A Sbjct: 526 PPSPPAPPPK-PAPPPRSPPAAA 547 >SB_40892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 28.3 bits (60), Expect = 7.7 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GGG G GGG G G G GGG G GG Sbjct: 156 GGGSDHDGDDAAGGGGSDDDGYDAAGGGGSDDDGDDGGGSYDDGDDGGG 204 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PPPP P P P PP P P PPP P Sbjct: 511 PPPPPPASPPPPL--PAEEDNSPP--PLPAGPPPDEP 543 >SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP P P P P P P P P P PPP Sbjct: 45 PPATALCPTPCYGPVPHPLLRPCVPPPATALVPHPLPRPCAPPP 88 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,838,704 Number of Sequences: 59808 Number of extensions: 471541 Number of successful extensions: 12191 Number of sequences better than 10.0: 174 Number of HSP's better than 10.0 without gapping: 1155 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4362 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2227723674 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -