BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_A09 (805 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p pro... 57 2e-08 AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA... 57 2e-08 AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB... 57 2e-08 BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p pro... 50 5e-06 AY075448-1|AAL68261.2| 218|Drosophila melanogaster RE09269p pro... 50 5e-06 AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-P... 50 5e-06 X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin pr... 49 7e-06 AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA... 49 7e-06 AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 p... 48 2e-05 AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB,... 48 2e-05 AE014298-2797|AAF48914.2| 193|Drosophila melanogaster CG14191-P... 47 3e-05 AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p pro... 47 3e-05 AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA... 47 3e-05 DQ539309-1|ABG02830.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539308-1|ABG02829.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539307-1|ABG02828.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539306-1|ABG02827.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539305-1|ABG02826.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539304-1|ABG02825.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539303-1|ABG02824.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539302-1|ABG02823.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539301-1|ABG02822.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539300-1|ABG02821.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539299-1|ABG02820.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539298-1|ABG02819.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539297-1|ABG02818.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539296-1|ABG02817.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539295-1|ABG02816.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539294-1|ABG02815.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539293-1|ABG02814.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539292-1|ABG02813.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539291-1|ABG02812.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539290-1|ABG02811.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539289-1|ABG02810.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539288-1|ABG02809.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539287-1|ABG02808.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539286-1|ABG02807.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539285-1|ABG02806.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539284-1|ABG02805.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539283-1|ABG02804.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539282-1|ABG02803.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 DQ539281-1|ABG02802.1| 342|Drosophila melanogaster CG17108 prot... 46 5e-05 BT030113-1|ABN49252.1| 342|Drosophila melanogaster IP06991p pro... 46 5e-05 BT011144-1|AAR82812.1| 356|Drosophila melanogaster GH24939p pro... 46 5e-05 BT001738-1|AAN71493.1| 331|Drosophila melanogaster RE72617p pro... 46 5e-05 AE014134-1932|AAF52992.1| 342|Drosophila melanogaster CG17108-P... 46 5e-05 U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding pr... 42 8e-05 L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding pr... 42 8e-05 M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protei... 42 8e-05 BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p pro... 46 8e-05 BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p pro... 46 8e-05 AJ271041-1|CAB66004.1| 286|Drosophila melanogaster Gly-rich pro... 46 8e-05 AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA... 46 8e-05 X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. 45 1e-04 BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p pro... 45 1e-04 AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA... 45 1e-04 AE013599-1244|AAS64915.1| 253|Drosophila melanogaster CG13214-P... 45 1e-04 U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino pro... 44 2e-04 BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p pro... 44 2e-04 BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p pro... 44 2e-04 AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA... 44 2e-04 AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p pro... 44 3e-04 AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p pro... 44 3e-04 AE014298-9|AAX52465.1| 193|Drosophila melanogaster CG13376-PA p... 44 3e-04 AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA... 44 3e-04 AE014296-3444|AAF51657.1| 98|Drosophila melanogaster CG11458-P... 43 4e-04 X73134-1|CAA51651.1| 127|Drosophila melanogaster GCR 20 protein. 42 7e-04 AY113557-1|AAM29562.1| 93|Drosophila melanogaster RH06401p pro... 42 7e-04 AY070976-1|AAL48598.1| 127|Drosophila melanogaster RE07460p pro... 42 7e-04 AE014298-2542|AAF48711.1| 133|Drosophila melanogaster CG5172-PA... 42 7e-04 AE014298-2541|AAS65393.1| 95|Drosophila melanogaster CG5172-PB... 42 7e-04 AE014297-1701|AAF54959.1| 127|Drosophila melanogaster CG9757-PA... 42 7e-04 AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-P... 42 7e-04 X62636-1|CAA44502.1| 326|Drosophila melanogaster hrp36.1 protein. 42 0.001 X59691-1|CAA42212.1| 386|Drosophila melanogaster P11 (hnRNP pro... 42 0.001 X54803-1|CAA38574.1| 386|Drosophila melanogaster Hrb87F protein. 42 0.001 BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p pro... 42 0.001 AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p pro... 42 0.001 AY071088-1|AAL48710.1| 173|Drosophila melanogaster RE15531p pro... 42 0.001 AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p pro... 42 0.001 AE014298-2545|AAF48713.1| 173|Drosophila melanogaster CG10598-P... 42 0.001 AE014298-2544|AAN09437.1| 230|Drosophila melanogaster CG10598-P... 42 0.001 AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC... 42 0.001 AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB... 42 0.001 AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD... 42 0.001 AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA... 42 0.001 BT021407-1|AAX33555.1| 720|Drosophila melanogaster LD06749p pro... 42 0.001 BT012315-1|AAS77440.1| 385|Drosophila melanogaster LD32727p pro... 42 0.001 AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p pro... 42 0.001 AF162774-1|AAF68853.2| 720|Drosophila melanogaster Nopp140-like... 42 0.001 AE014297-1716|AAF54967.1| 385|Drosophila melanogaster CG12749-P... 42 0.001 AE014297-1715|AAN13574.1| 325|Drosophila melanogaster CG12749-P... 42 0.001 AE014296-3628|AAF51788.3| 720|Drosophila melanogaster CG7421-PA... 42 0.001 AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA,... 42 0.001 AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB,... 42 0.001 AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD,... 42 0.001 AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC,... 42 0.001 AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-P... 41 0.002 BT022701-1|AAY55117.1| 157|Drosophila melanogaster IP07196p pro... 40 0.003 AE014297-1019|AAN13441.1| 157|Drosophila melanogaster CG31415-P... 40 0.003 AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p pro... 40 0.004 AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC... 40 0.004 AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB... 40 0.004 AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA... 40 0.004 BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p pro... 40 0.005 BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p pro... 40 0.005 BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p pro... 40 0.005 AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p pro... 40 0.005 AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA,... 40 0.005 AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB,... 40 0.005 AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA... 40 0.005 BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p pro... 39 0.007 BT003283-1|AAO25040.1| 178|Drosophila melanogaster HL05737p pro... 39 0.007 BT001384-1|AAN71139.1| 178|Drosophila melanogaster GH03391p pro... 39 0.007 AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB... 39 0.007 AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA... 39 0.007 AE014297-1707|AAS65146.1| 178|Drosophila melanogaster CG16901-P... 39 0.007 AE014297-1706|AAF54963.2| 344|Drosophila melanogaster CG16901-P... 39 0.007 AY118781-1|AAM50641.1| 117|Drosophila melanogaster GH13168p pro... 39 0.009 AE014297-3096|AAF55954.1| 117|Drosophila melanogaster CG5778-PA... 39 0.009 AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA... 39 0.009 M74121-1|AAC41573.1| 1293|Drosophila melanogaster maleless prote... 38 0.012 BT015282-1|AAT94511.1| 1250|Drosophila melanogaster LD04601p pro... 38 0.012 BT010267-1|AAQ23585.1| 936|Drosophila melanogaster RE21725p pro... 38 0.012 BT003785-1|AAO41468.1| 936|Drosophila melanogaster LD44547p pro... 38 0.012 AF255733-1|AAF71288.1| 1250|Drosophila melanogaster DNA topoisom... 38 0.012 AE014134-3114|AAF53813.2| 1250|Drosophila melanogaster CG10123-P... 38 0.012 AE013599-124|AAM68335.1| 936|Drosophila melanogaster CG11680-PC... 38 0.012 AE013599-123|AAF57297.1| 1293|Drosophila melanogaster CG11680-PA... 38 0.012 BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p pro... 38 0.016 AY075564-1|AAL68371.1| 161|Drosophila melanogaster RH68528p pro... 38 0.016 AE014134-1930|AAF52990.2| 161|Drosophila melanogaster CG7296-PA... 38 0.016 U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptid... 38 0.021 U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro... 38 0.021 M85049-1|AAA19661.1| 1638|Drosophila melanogaster brahma protein... 38 0.021 BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro... 38 0.021 BT009972-1|AAQ22441.1| 1634|Drosophila melanogaster RE61274p pro... 38 0.021 BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p pro... 38 0.021 AY095048-1|AAM11376.1| 1638|Drosophila melanogaster LD36356p pro... 38 0.021 AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p pro... 38 0.021 AE014298-2543|AAF48712.2| 237|Drosophila melanogaster CG12997-P... 38 0.021 AE014296-2605|AAF49557.1| 1638|Drosophila melanogaster CG5942-PB... 38 0.021 AE014296-2604|AAF49558.3| 1638|Drosophila melanogaster CG5942-PA... 38 0.021 AE014296-2603|AAN11774.1| 1634|Drosophila melanogaster CG5942-PD... 38 0.021 AE014296-2602|AAN11773.1| 1634|Drosophila melanogaster CG5942-PC... 38 0.021 AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB... 38 0.021 AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA... 38 0.021 AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-P... 38 0.021 AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-P... 38 0.021 AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-P... 38 0.021 AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-P... 38 0.021 AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-P... 38 0.021 X71974-1|CAA50794.1| 196|Drosophila melanogaster GCR 17 protein. 37 0.028 AY113490-1|AAM29495.1| 158|Drosophila melanogaster RE47308p pro... 37 0.028 AM294881-1|CAL26867.1| 158|Drosophila melanogaster CG10853 prot... 37 0.028 AM294880-1|CAL26866.1| 158|Drosophila melanogaster CG10853 prot... 37 0.028 AM294879-1|CAL26865.1| 158|Drosophila melanogaster CG10853 prot... 37 0.028 AM294875-1|CAL26861.1| 158|Drosophila melanogaster CG10853 prot... 37 0.028 AM294874-1|CAL26860.1| 158|Drosophila melanogaster CG10853 prot... 37 0.028 AF067153-1|AAC18395.1| 1171|Drosophila melanogaster PIP82 protei... 37 0.028 AE014298-1899|AAF48264.2| 158|Drosophila melanogaster CG1987-PA... 37 0.028 AE014298-1194|AAF46386.3| 1195|Drosophila melanogaster CG11219-P... 37 0.028 X58183-1|CAA41170.1| 386|Drosophila melanogaster heterogeneous ... 37 0.037 BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p pro... 37 0.037 AY118420-1|AAM48449.1| 250|Drosophila melanogaster RE74758p pro... 37 0.037 AY058341-1|AAL13570.1| 1024|Drosophila melanogaster GH11706p pro... 37 0.037 AE014297-1806|AAF55026.1| 1024|Drosophila melanogaster CG14355-P... 37 0.037 AE014296-2355|AAF49762.2| 1155|Drosophila melanogaster CG32138-P... 37 0.037 AE014296-2354|AAF49761.2| 1165|Drosophila melanogaster CG32138-P... 37 0.037 AE014296-1850|AAF50135.2| 250|Drosophila melanogaster CG12523-P... 37 0.037 AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-P... 37 0.037 AY075468-1|AAL68280.1| 127|Drosophila melanogaster RE28280p pro... 36 0.049 AY052130-1|AAK93554.1| 455|Drosophila melanogaster SD08037p pro... 36 0.049 AE014298-3143|AAF50813.1| 183|Drosophila melanogaster CG10918-P... 36 0.049 AE014297-3872|AAF56525.1| 454|Drosophila melanogaster CG5913-PA... 36 0.049 AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-P... 36 0.049 AE014134-1931|AAF52991.1| 127|Drosophila melanogaster CG7294-PA... 36 0.049 X71976-1|CAA50796.1| 188|Drosophila melanogaster GCR 1 protein ... 36 0.065 AY119132-1|AAM50992.1| 188|Drosophila melanogaster RE35358p pro... 36 0.065 AY119041-1|AAM50901.1| 393|Drosophila melanogaster LP06455p pro... 36 0.065 AE014298-1193|AAF46385.1| 679|Drosophila melanogaster CG33181-P... 36 0.065 AE014297-4805|AAF57194.1| 188|Drosophila melanogaster CG2150-PA... 36 0.065 AE014297-416|AAF51905.3| 393|Drosophila melanogaster CG10303-PA... 36 0.065 AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-P... 36 0.065 AY058599-1|AAL13828.1| 773|Drosophila melanogaster LD29226p pro... 36 0.086 AM294878-1|CAL26864.1| 158|Drosophila melanogaster CG10853 prot... 36 0.086 AM294877-1|CAL26863.1| 158|Drosophila melanogaster CG10853 prot... 36 0.086 AM294876-1|CAL26862.1| 158|Drosophila melanogaster CG10853 prot... 36 0.086 AJ243904-1|CAB64937.1| 773|Drosophila melanogaster SF1 protein ... 36 0.086 AE014296-862|AAF47912.1| 707|Drosophila melanogaster CG13722-PA... 36 0.086 AE013599-3146|AAF46686.2| 1215|Drosophila melanogaster CG4266-PA... 36 0.086 AE014297-426|AAF51896.2| 171|Drosophila melanogaster CG15597-PA... 35 0.11 AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-P... 35 0.15 AE014134-2469|AAS64704.1| 1853|Drosophila melanogaster CG32972-P... 35 0.15 AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. 35 0.15 X62638-1|CAA44504.1| 345|Drosophila melanogaster hrp40.2 protein. 34 0.20 BT029607-1|ABL75666.1| 337|Drosophila melanogaster IP17050p pro... 34 0.20 AM294872-1|CAL26858.1| 158|Drosophila melanogaster CG10853 prot... 34 0.20 AE014298-2877|AAF48974.1| 348|Drosophila melanogaster CG14218-P... 34 0.20 AE014298-1168|AAF46366.1| 926|Drosophila melanogaster CG10555-P... 34 0.20 M23221-1|AAA28540.1| 2038|Drosophila melanogaster fsh protein. 34 0.26 M15762-1|AAA70424.1| 50|Drosophila melanogaster unknown protei... 34 0.26 BT011110-1|AAR82777.1| 1777|Drosophila melanogaster LD32107p pro... 34 0.26 AY119164-1|AAM51024.1| 192|Drosophila melanogaster RH23514p pro... 34 0.26 AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p pro... 34 0.26 AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p pro... 34 0.26 AM412919-1|CAL85542.1| 181|Drosophila melanogaster CG16743 prot... 34 0.26 AM412918-1|CAL85541.1| 178|Drosophila melanogaster CG16743 prot... 34 0.26 AM412917-1|CAL85540.1| 181|Drosophila melanogaster CG16743 prot... 34 0.26 AE014298-1311|AAF46472.2| 1837|Drosophila melanogaster CG12124-P... 34 0.26 AE014298-1107|AAF46312.3| 2038|Drosophila melanogaster CG2252-PB... 34 0.26 AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA... 34 0.26 AE014134-1996|AAF53039.1| 192|Drosophila melanogaster CG16743-P... 34 0.26 AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-P... 34 0.26 AE013599-399|AAM68891.2| 409|Drosophila melanogaster CG11112-PB... 34 0.26 X97197-1|CAA65831.1| 366|Drosophila melanogaster spliceosomal p... 33 0.35 BT023489-1|AAY84889.1| 347|Drosophila melanogaster RE50839p pro... 33 0.35 BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p pro... 33 0.35 BT001672-1|AAN71427.1| 315|Drosophila melanogaster RE50346p pro... 33 0.35 AY129464-1|AAM76206.1| 981|Drosophila melanogaster SD10723p pro... 33 0.35 AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p pro... 33 0.35 AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p pro... 33 0.35 AY051892-1|AAK93316.1| 349|Drosophila melanogaster LD38046p pro... 33 0.35 AE014298-2744|AAF48863.1| 1895|Drosophila melanogaster CG15040-P... 33 0.35 AE014298-2546|AAF48714.1| 250|Drosophila melanogaster CG10597-P... 33 0.35 AE014298-1457|AAN09261.3| 2309|Drosophila melanogaster CG17255-P... 33 0.35 AE014298-1456|AAF46591.4| 2309|Drosophila melanogaster CG17255-P... 33 0.35 AE014298-1424|AAF46566.2| 349|Drosophila melanogaster CG2961-PA... 33 0.35 AE014298-857|AAF46136.1| 347|Drosophila melanogaster CG3780-PA ... 33 0.35 AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-P... 33 0.35 AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-P... 33 0.35 AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA... 33 0.35 AY069509-1|AAL39654.1| 481|Drosophila melanogaster LD22957p pro... 28 0.38 AF260583-1|AAG13285.1| 481|Drosophila melanogaster cyclin D pro... 28 0.38 AE014298-2283|AAF48537.1| 481|Drosophila melanogaster CG9096-PC... 28 0.38 AE014298-2282|AAN09375.1| 481|Drosophila melanogaster CG9096-PB... 28 0.38 AE014298-2281|AAN09374.1| 481|Drosophila melanogaster CG9096-PA... 28 0.38 U41808-1|AAC47016.1| 452|Drosophila melanogaster Cyclin D protein. 28 0.38 X15586-1|CAA33611.1| 1443|Drosophila melanogaster protein ( D.me... 33 0.46 BT011093-1|AAR82759.1| 236|Drosophila melanogaster RE40656p pro... 33 0.46 AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p pro... 33 0.46 AE014298-2723|AAX52506.1| 991|Drosophila melanogaster CG32547-P... 33 0.46 AE014298-2533|AAF48705.1| 209|Drosophila melanogaster CG5070-PA... 33 0.46 AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA... 33 0.46 AE014296-2989|AAF49282.3| 1412|Drosophila melanogaster CG8127-PB... 33 0.46 AE013599-1058|AAF58816.2| 2376|Drosophila melanogaster CG18408-P... 33 0.46 AB053478-1|BAB62017.1| 2376|Drosophila melanogaster DCAPL1 protein. 33 0.46 M83931-1|AAB04680.1| 1595|Drosophila melanogaster son of sevenle... 33 0.60 M77501-1|AAA28904.1| 1596|Drosophila melanogaster son of sevenle... 33 0.60 BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p pro... 33 0.60 AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p pro... 33 0.60 AY071607-1|AAL49229.1| 174|Drosophila melanogaster RE65554p pro... 33 0.60 AY071177-1|AAL48799.1| 212|Drosophila melanogaster RE23041p pro... 33 0.60 AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA... 33 0.60 AE014134-2404|AAF53336.2| 1596|Drosophila melanogaster CG7793-PA... 33 0.60 AE013599-2046|AAF58146.2| 212|Drosophila melanogaster CG8160-PA... 33 0.60 BT023503-1|AAY84903.1| 1327|Drosophila melanogaster LD20030p pro... 32 0.80 BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p pro... 32 0.80 AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p pro... 32 0.80 AY075437-1|AAL68252.1| 155|Drosophila melanogaster LP09837p pro... 32 0.80 AY069099-1|AAL39244.1| 562|Drosophila melanogaster GH11670p pro... 32 0.80 AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 p... 32 0.80 AF314193-1|AAK00302.1| 3109|Drosophila melanogaster Toutatis pro... 32 0.80 AF142631-1|AAF00596.1| 490|Drosophila melanogaster hnRNP K prot... 32 0.80 AF116572-1|AAD31170.1| 1327|Drosophila melanogaster ribonuclease... 32 0.80 AE014298-979|AAF46221.2| 1027|Drosophila melanogaster CG14431-PA... 32 0.80 AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA... 32 0.80 AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB... 32 0.80 AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC... 32 0.80 AE014296-1574|AAF50325.2| 562|Drosophila melanogaster CG32031-P... 32 0.80 AE014296-723|AAF47815.1| 155|Drosophila melanogaster CG10853-PA... 32 0.80 AE013599-2045|AAF58147.1| 113|Drosophila melanogaster CG8157-PA... 32 0.80 AE013599-1322|AAF58638.2| 3080|Drosophila melanogaster CG10897-P... 32 0.80 AE013599-540|AAF59169.1| 1327|Drosophila melanogaster CG8730-PA ... 32 0.80 BT029145-1|ABJ17079.1| 428|Drosophila melanogaster RT01021p pro... 32 1.1 BT016087-1|AAV36972.1| 749|Drosophila melanogaster LD41296p pro... 32 1.1 BT003578-1|AAO39582.1| 739|Drosophila melanogaster LD24631p pro... 32 1.1 BT003516-1|AAO39520.1| 153|Drosophila melanogaster RE25364p pro... 32 1.1 BT001450-1|AAN71205.1| 719|Drosophila melanogaster GH27257p pro... 32 1.1 AY121649-1|AAM51976.1| 950|Drosophila melanogaster LD23647p pro... 32 1.1 AY119224-1|AAM51084.1| 469|Drosophila melanogaster SD16903p pro... 32 1.1 AY118423-1|AAM48452.1| 263|Drosophila melanogaster RH04014p pro... 32 1.1 AY094783-1|AAM11136.1| 118|Drosophila melanogaster LD12750p pro... 32 1.1 AY089613-1|AAL90351.1| 798|Drosophila melanogaster RE28061p pro... 32 1.1 AY071379-1|AAL49001.1| 288|Drosophila melanogaster RE40518p pro... 32 1.1 AY051669-1|AAK93093.1| 457|Drosophila melanogaster LD22190p pro... 32 1.1 AY051568-1|AAK92992.1| 263|Drosophila melanogaster GH21518p pro... 32 1.1 AM294871-1|CAL26857.1| 148|Drosophila melanogaster CG10853 prot... 32 1.1 AJ002520-1|CAC20093.1| 749|Drosophila melanogaster DALAO protei... 32 1.1 AF348329-1|AAK31343.1| 749|Drosophila melanogaster Brahma-assoc... 32 1.1 AF145594-1|AAD38569.1| 721|Drosophila melanogaster BcDNA.GH0191... 32 1.1 AF086820-1|AAC36333.1| 428|Drosophila melanogaster paired-like ... 32 1.1 AE014298-2608|AAF48762.1| 428|Drosophila melanogaster CG6269-PA... 32 1.1 AE014298-1712|AAF48112.1| 118|Drosophila melanogaster CG1840-PA... 32 1.1 AE014298-1284|AAF46450.1| 749|Drosophila melanogaster CG7055-PA... 32 1.1 AE014297-4122|AAF56703.2| 1183|Drosophila melanogaster CG6599-PA... 32 1.1 AE014297-3967|AAF56600.1| 288|Drosophila melanogaster CG5468-PA... 32 1.1 AE014297-2841|AAF55795.1| 263|Drosophila melanogaster CG4000-PA... 32 1.1 AE014297-2377|AAF55442.2| 153|Drosophila melanogaster CG14327-P... 32 1.1 AE014297-778|AAF54262.1| 798|Drosophila melanogaster CG9748-PA ... 32 1.1 AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA... 32 1.1 AE014134-2238|AAF53220.2| 950|Drosophila melanogaster CG5787-PA... 32 1.1 AE013599-2734|AAF57660.2| 1271|Drosophila melanogaster CG30122-P... 32 1.1 BT003569-1|AAO39573.1| 745|Drosophila melanogaster LD44990p pro... 31 1.4 BT001437-1|AAN71192.1| 195|Drosophila melanogaster GH24648p pro... 31 1.4 AY113614-1|AAM29619.1| 121|Drosophila melanogaster RH62530p pro... 31 1.4 AY094731-1|AAM11084.1| 708|Drosophila melanogaster GH25793p pro... 31 1.4 AY060415-1|AAL25454.1| 463|Drosophila melanogaster LD37240p pro... 31 1.4 AL009195-3|CAA15702.1| 463|Drosophila melanogaster EG:30B8.5,FB... 31 1.4 AF275629-1|AAF78762.1| 508|Drosophila melanogaster bancal prote... 31 1.4 AE014298-1977|AAF48333.2| 1103|Drosophila melanogaster CG32611-P... 31 1.4 AE014298-1796|AAF48189.3| 1470|Drosophila melanogaster CG17762-P... 31 1.4 AE014298-1795|AAF48187.3| 1470|Drosophila melanogaster CG17762-P... 31 1.4 AE014298-1794|AAF48188.3| 1173|Drosophila melanogaster CG17762-P... 31 1.4 AE014298-1793|AAF48190.3| 1173|Drosophila melanogaster CG17762-P... 31 1.4 AE014298-367|AAF45758.1| 463|Drosophila melanogaster CG3218-PA ... 31 1.4 AE014296-776|AAN11589.1| 575|Drosophila melanogaster CG32260-PA... 31 1.4 AE014134-1714|AAS64673.2| 1701|Drosophila melanogaster CG33300-P... 31 1.4 AE013599-3336|AAM68207.1| 751|Drosophila melanogaster CG13503-P... 31 1.4 AE013599-3335|AAM68206.1| 751|Drosophila melanogaster CG13503-P... 31 1.4 AE013599-3334|AAM68205.1| 751|Drosophila melanogaster CG13503-P... 31 1.4 AE013599-3333|AAF46800.2| 751|Drosophila melanogaster CG13503-P... 31 1.4 AE013599-3332|AAM68204.1| 708|Drosophila melanogaster CG13503-P... 31 1.4 AE013599-3331|AAM68208.2| 761|Drosophila melanogaster CG13503-P... 31 1.4 AE013599-3039|AAS64908.1| 315|Drosophila melanogaster CG13425-P... 31 1.4 AE013599-3038|AAM68390.2| 413|Drosophila melanogaster CG13425-P... 31 1.4 AE013599-3036|AAF57450.2| 496|Drosophila melanogaster CG13425-P... 31 1.4 AE013599-3035|AAM68389.2| 502|Drosophila melanogaster CG13425-P... 31 1.4 AE013599-1232|AAF58699.1| 121|Drosophila melanogaster CG9080-PA... 31 1.4 BT010114-1|AAQ22583.1| 515|Drosophila melanogaster GH02426p pro... 25 1.4 AE014297-3395|AAX52972.1| 515|Drosophila melanogaster CG33111-P... 25 1.4 AE014297-3394|AAS65199.1| 515|Drosophila melanogaster CG33111-P... 25 1.4 AE014297-3393|AAF56193.2| 515|Drosophila melanogaster CG33111-P... 25 1.4 X52846-1|CAA37037.1| 575|Drosophila melanogaster protein ( Dros... 31 1.8 BT022491-1|AAY54907.1| 173|Drosophila melanogaster IP07937p pro... 31 1.8 BT015209-1|AAT94438.1| 575|Drosophila melanogaster RE56857p pro... 31 1.8 BT011476-1|AAR99134.1| 719|Drosophila melanogaster RE11923p pro... 31 1.8 BT001716-1|AAN71471.1| 578|Drosophila melanogaster RE68337p pro... 31 1.8 AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p pro... 31 1.8 AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-P... 31 1.8 AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-P... 31 1.8 AE014297-472|AAN13360.2| 1091|Drosophila melanogaster CG15186-PB... 31 1.8 AE014297-471|AAS65115.1| 923|Drosophila melanogaster CG15186-PC... 31 1.8 AE014297-470|AAF54118.2| 1072|Drosophila melanogaster CG15186-PA... 31 1.8 AE014297-394|AAG22212.1| 578|Drosophila melanogaster CG10279-PF... 31 1.8 AE014297-393|AAN14332.1| 578|Drosophila melanogaster CG10279-PC... 31 1.8 AE014297-392|AAF51926.2| 578|Drosophila melanogaster CG10279-PB... 31 1.8 AE014297-391|AAF51927.2| 578|Drosophila melanogaster CG10279-PE... 31 1.8 AE014297-390|AAN14331.1| 575|Drosophila melanogaster CG10279-PD... 31 1.8 AE014297-389|AAG22213.2| 719|Drosophila melanogaster CG10279-PA... 31 1.8 BT022134-1|AAY51529.1| 543|Drosophila melanogaster IP08802p pro... 26 2.4 AE014134-2970|AAF53700.1| 530|Drosophila melanogaster CG10348-P... 26 2.4 X76210-1|CAA53803.1| 389|Drosophila melanogaster homeotic ultra... 31 2.4 X59772-1|CAB36921.1| 850|Drosophila melanogaster ovo protein pr... 31 2.4 X05723-1|CAA29194.1| 389|Drosophila melanogaster Ultrabithorax ... 31 2.4 U54982-2|AAC16666.1| 1262|Drosophila melanogaster stn-B protein. 31 2.4 U31961-13|AAA84410.1| 346|Drosophila melanogaster UBXIVA protein. 31 2.4 U31961-12|AAA84409.1| 363|Drosophila melanogaster UBXIIA protein. 31 2.4 U31961-11|AAA84408.1| 380|Drosophila melanogaster UBXIA protein. 31 2.4 U31961-10|AAA84411.1| 372|Drosophila melanogaster UBXIIB protein. 31 2.4 U31961-9|AAA84412.1| 389|Drosophila melanogaster UBXIB protein. 31 2.4 U18130-1|AAC46512.1| 1047|Drosophila melanogaster masquerade pro... 31 2.4 U11383-1|AAB60216.1| 1028|Drosophila melanogaster Ovo-1028aa pro... 31 2.4 BT025138-1|ABE73309.1| 175|Drosophila melanogaster IP06825p pro... 31 2.4 BT023751-1|AAZ41759.1| 1594|Drosophila melanogaster RH56202p pro... 31 2.4 BT011172-1|AAR88533.1| 1262|Drosophila melanogaster RH38069p pro... 31 2.4 BT010241-1|AAQ23559.1| 380|Drosophila melanogaster RE43738p pro... 31 2.4 BT003322-1|AAO25082.1| 575|Drosophila melanogaster AT02511p pro... 31 2.4 BT001597-1|AAN71352.1| 1047|Drosophila melanogaster RE29416p pro... 31 2.4 AY119649-1|AAM50303.1| 975|Drosophila melanogaster RE46053p pro... 31 2.4 AY119556-1|AAM50210.1| 1272|Drosophila melanogaster GH28840p pro... 31 2.4 AY094838-1|AAM11191.1| 1351|Drosophila melanogaster LD47350p pro... 31 2.4 AY070547-1|AAL48018.1| 335|Drosophila melanogaster LD27487p pro... 31 2.4 AY070499-1|AAL47970.1| 428|Drosophila melanogaster GH07841p pro... 31 2.4 AY069664-1|AAL39809.1| 600|Drosophila melanogaster LD44138p pro... 31 2.4 AY052044-1|AAK93468.1| 581|Drosophila melanogaster LP06006p pro... 31 2.4 AJ430589-1|CAD23207.1| 1222|Drosophila melanogaster ovoA protein... 31 2.4 AJ430588-1|CAD23206.1| 1354|Drosophila melanogaster shavenbaby p... 31 2.4 AE014298-3231|ABI31012.1| 1260|Drosophila melanogaster CG12473-P... 31 2.4 AE014298-3230|EAA46059.2| 1260|Drosophila melanogaster CG12473-P... 31 2.4 AE014298-1554|AAF48000.3| 3539|Drosophila melanogaster CG11122-P... 31 2.4 AE014298-1473|AAF46608.1| 2090|Drosophila melanogaster CG9817-PA... 31 2.4 AE014298-1420|AAF46562.2| 376|Drosophila melanogaster CG2962-PA... 31 2.4 AE014298-702|AAF46002.2| 975|Drosophila melanogaster CG6824-PA,... 31 2.4 AE014298-701|ABC67174.1| 1028|Drosophila melanogaster CG6824-PD,... 31 2.4 AE014298-700|AAF46003.2| 1222|Drosophila melanogaster CG6824-PC,... 31 2.4 AE014298-699|AAF46001.2| 1351|Drosophila melanogaster CG6824-PB,... 31 2.4 AE014297-2494|AAN13768.1| 600|Drosophila melanogaster CG7129-PB... 31 2.4 AE014297-2493|AAF55531.1| 600|Drosophila melanogaster CG7129-PA... 31 2.4 AE014297-2261|AAF55355.2| 389|Drosophila melanogaster CG10388-P... 31 2.4 AE014297-2260|AAN13719.1| 372|Drosophila melanogaster CG10388-P... 31 2.4 AE014297-2259|AAS65158.1| 355|Drosophila melanogaster CG10388-P... 31 2.4 AE014297-2258|AAN13718.1| 380|Drosophila melanogaster CG10388-P... 31 2.4 AE014297-2257|AAN13717.1| 363|Drosophila melanogaster CG10388-P... 31 2.4 AE014297-2256|AAF55356.1| 346|Drosophila melanogaster CG10388-P... 31 2.4 AE014296-854|AAF47906.1| 172|Drosophila melanogaster CG15023-PA... 31 2.4 AE014296-779|AAF47850.1| 1047|Drosophila melanogaster CG15002-PB... 31 2.4 AE014134-2984|AAF53715.3| 1377|Drosophila melanogaster CG10600-P... 31 2.4 AE013599-2343|AAS64829.1| 575|Drosophila melanogaster CG15920-P... 31 2.4 AE013599-2342|AAF57953.1| 620|Drosophila melanogaster CG15920-P... 31 2.4 AE013599-1819|AAS64855.1| 433|Drosophila melanogaster CG8118-PC... 31 2.4 AE013599-1817|AAF58300.2| 1594|Drosophila melanogaster CG8118-PB... 31 2.4 AE013599-1816|AAF58299.1| 1594|Drosophila melanogaster CG8118-PA... 31 2.4 X12836-1|CAA31321.1| 463|Drosophila melanogaster K10 protein pr... 30 3.2 L35153-1|AAA64457.1| 857|Drosophila melanogaster polycomblike n... 30 3.2 DQ285021-1|ABB90104.1| 110|Drosophila melanogaster G-rich selen... 30 3.2 BT016106-1|AAV36991.1| 840|Drosophila melanogaster LD20133p pro... 30 3.2 BT011467-1|AAR99125.1| 568|Drosophila melanogaster RE23052p pro... 30 3.2 AY525769-1|AAS48651.1| 1407|Drosophila melanogaster ADAM metallo... 30 3.2 AY075585-1|AAL68389.1| 1043|Drosophila melanogaster SD09488p pro... 30 3.2 AY069803-1|AAL39948.1| 856|Drosophila melanogaster SD04280p pro... 30 3.2 AY069304-1|AAL39449.1| 587|Drosophila melanogaster HL07962p pro... 30 3.2 AY060611-1|AAL28159.1| 108|Drosophila melanogaster GH03581p pro... 30 3.2 AY060241-1|AAL25280.1| 143|Drosophila melanogaster GH05991p pro... 30 3.2 AF396454-1|AAK72981.1| 110|Drosophila melanogaster G-rich selen... 30 3.2 AE014298-3176|AAN09565.1| 856|Drosophila melanogaster CG14619-P... 30 3.2 AE014298-3175|AAN09564.1| 856|Drosophila melanogaster CG14619-P... 30 3.2 AE014298-3174|AAF50952.2| 856|Drosophila melanogaster CG14619-P... 30 3.2 AE014298-2119|AAN09658.1| 143|Drosophila melanogaster CG9106-PB... 30 3.2 AE014298-2118|AAF48436.1| 143|Drosophila melanogaster CG9106-PA... 30 3.2 AE014298-1711|AAF48111.2| 110|Drosophila melanogaster CG1844-PA... 30 3.2 AE014298-1675|AAF48083.2| 587|Drosophila melanogaster CG1841-PB... 30 3.2 AE014298-1674|AAN09296.1| 587|Drosophila melanogaster CG1841-PA... 30 3.2 AE014298-1529|AAF47983.2| 2602|Drosophila melanogaster CG2174-PA... 30 3.2 AE014298-1528|ABI30975.1| 2693|Drosophila melanogaster CG2174-PB... 30 3.2 AE014298-962|AAF46206.1| 230|Drosophila melanogaster CG4547-PA ... 30 3.2 AE014297-1886|AAZ83995.1| 1407|Drosophila melanogaster CG7649-PB... 30 3.2 AE013599-2620|AAF57748.2| 1043|Drosophila melanogaster CG5109-PA... 30 3.2 AY095057-1|AAM11385.1| 258|Drosophila melanogaster LD46359p pro... 29 3.3 AJ249466-1|CAB60724.1| 258|Drosophila melanogaster DXl6 protein... 29 3.3 AF232774-1|AAF43414.1| 258|Drosophila melanogaster SR family sp... 29 3.3 AE014134-1188|AAF52454.1| 258|Drosophila melanogaster CG10203-P... 29 3.3 AE014298-2110|AAN09656.1| 968|Drosophila melanogaster CG15028-P... 25 3.8 AE014298-2111|AAF48430.1| 858|Drosophila melanogaster CG15028-P... 25 3.8 M25545-4|AAA28621.1| 361|Drosophila melanogaster protein ( D.me... 30 4.3 M25545-3|AAA28624.1| 365|Drosophila melanogaster protein ( D.me... 30 4.3 M25545-2|AAA28623.1| 360|Drosophila melanogaster protein ( D.me... 30 4.3 M25545-1|AAA28622.1| 364|Drosophila melanogaster protein ( D.me... 30 4.3 M15766-1|AAA70426.1| 365|Drosophila melanogaster unknown protei... 30 4.3 K02620-1|AAA28967.1| 510|Drosophila melanogaster protein ( D.me... 30 4.3 BT003571-1|AAO39575.1| 285|Drosophila melanogaster LD41821p pro... 30 4.3 BT001726-1|AAN71481.1| 440|Drosophila melanogaster RE69884p pro... 30 4.3 BT001610-1|AAN71365.1| 279|Drosophila melanogaster RE31819p pro... 30 4.3 AY084171-1|AAL89909.1| 286|Drosophila melanogaster RE40851p pro... 30 4.3 AY061448-1|AAL28996.1| 361|Drosophila melanogaster LD38464p pro... 30 4.3 AM294873-1|CAL26859.1| 155|Drosophila melanogaster CG10853 prot... 30 4.3 AM294870-1|CAL26856.1| 155|Drosophila melanogaster CG10853 prot... 30 4.3 AL031583-7|CAB41346.1| 359|Drosophila melanogaster EG:34F3.10 p... 30 4.3 AE014298-111|AAF45553.2| 359|Drosophila melanogaster CG13358-PA... 30 4.3 AE014297-4248|AAN14144.1| 361|Drosophila melanogaster CG9983-PF... 30 4.3 AE014297-4247|AAN14143.1| 361|Drosophila melanogaster CG9983-PD... 30 4.3 AE014297-4246|AAN14142.1| 365|Drosophila melanogaster CG9983-PC... 30 4.3 AE014297-4245|AAF56801.1| 365|Drosophila melanogaster CG9983-PB... 30 4.3 AE014297-4244|AAN14141.1| 360|Drosophila melanogaster CG9983-PE... 30 4.3 AE014297-4243|AAF56800.2| 364|Drosophila melanogaster CG9983-PA... 30 4.3 AE014297-3971|AAN14080.1| 279|Drosophila melanogaster CG6447-PB... 30 4.3 AE014297-3970|AAF56603.2| 285|Drosophila melanogaster CG6447-PA... 30 4.3 AE014297-3969|AAF56602.1| 286|Drosophila melanogaster CG6478-PA... 30 4.3 AE014296-852|AAF47904.2| 242|Drosophila melanogaster CG11345-PA... 30 4.3 AE013599-1671|AAF58402.1| 440|Drosophila melanogaster CG4663-PA... 30 4.3 AY051622-1|AAK93046.1| 456|Drosophila melanogaster GH27042p pro... 26 5.2 AE014298-950|AAF46198.2| 456|Drosophila melanogaster CG3135-PA ... 26 5.2 X76208-1|CAA53800.1| 518|Drosophila melanogaster protein 33-spe... 29 5.6 K02621-1|AAA28968.1| 531|Drosophila melanogaster protein ( D.me... 29 5.6 BT024238-1|ABC86300.1| 385|Drosophila melanogaster LD04512p pro... 29 5.6 BT016162-1|AAV37047.1| 702|Drosophila melanogaster AT08270p pro... 29 5.6 BT016116-1|AAV37001.1| 875|Drosophila melanogaster LD10035p pro... 29 5.6 BT015294-1|AAT94523.1| 1596|Drosophila melanogaster GH01796p pro... 29 5.6 AY118647-1|AAM50016.1| 1226|Drosophila melanogaster SD05267p pro... 29 5.6 AY061625-1|AAL29173.1| 444|Drosophila melanogaster SD10251p pro... 29 5.6 AF099909-1|AAD13219.1| 875|Drosophila melanogaster topoisomeras... 29 5.6 AE014298-2787|AAF48900.2| 2030|Drosophila melanogaster CG32542-P... 29 5.6 AE014298-867|AAF46144.1| 875|Drosophila melanogaster CG3458-PA ... 29 5.6 AE014297-2780|AAF55756.1| 556|Drosophila melanogaster CG4360-PA... 29 5.6 AE014297-1995|AAS65155.1| 518|Drosophila melanogaster CG4898-PK... 29 5.6 AE014297-1933|AAF55130.1| 537|Drosophila melanogaster CG3984-PA... 29 5.6 AE014296-2615|AAF49551.3| 1226|Drosophila melanogaster CG5841-PA... 29 5.6 AE014296-2310|AAF49795.2| 3843|Drosophila melanogaster CG7002-PA... 29 5.6 AE014296-1088|AAF50683.1| 239|Drosophila melanogaster CG12330-P... 29 5.6 AE014296-654|AAN11564.1| 710|Drosophila melanogaster CG12076-PB... 29 5.6 AE014296-653|AAF47768.2| 721|Drosophila melanogaster CG12076-PA... 29 5.6 AE013599-2521|AAF57825.3| 702|Drosophila melanogaster CG11423-P... 29 5.6 AB035891-1|BAA88518.1| 3843|Drosophila melanogaster hemolectin p... 29 5.6 AE014297-1087|AAF54491.1| 695|Drosophila melanogaster CG12809-P... 23 6.1 EF108315-1|ABL09495.1| 528|Drosophila melanogaster serine-pepti... 29 6.7 AY061619-1|AAL29167.1| 428|Drosophila melanogaster SD08423p pro... 26 6.8 AE014298-1932|AAF48294.1| 428|Drosophila melanogaster CG12175-P... 26 6.8 AY069245-1|AAL39390.1| 197|Drosophila melanogaster GM01964p pro... 26 7.4 DQ991915-1|ABJ09588.1| 2176|Drosophila melanogaster eyes shut pr... 29 7.4 DQ780942-1|ABH07112.1| 2165|Drosophila melanogaster spacemaker p... 29 7.4 BT011100-1|AAR82766.1| 342|Drosophila melanogaster RE12587p pro... 29 7.4 BT003575-1|AAO39579.1| 994|Drosophila melanogaster LD33058p pro... 29 7.4 AY118297-1|AAM48326.1| 659|Drosophila melanogaster GH07242p pro... 29 7.4 AY094951-1|AAM11304.1| 394|Drosophila melanogaster RH68811p pro... 29 7.4 AY069684-1|AAL39829.1| 238|Drosophila melanogaster LD45549p pro... 29 7.4 AE014298-1767|AAF48163.2| 319|Drosophila melanogaster CG15731-P... 29 7.4 AE014298-478|AAN09091.2| 627|Drosophila melanogaster CG3588-PC,... 29 7.4 AE014298-477|AAZ52489.1| 655|Drosophila melanogaster CG3588-PD,... 29 7.4 AE014298-476|AAN09092.1| 655|Drosophila melanogaster CG3588-PA,... 29 7.4 AE014297-2769|AAF55745.3| 1314|Drosophila melanogaster CG34139-P... 29 7.4 >AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p protein. Length = 846 Score = 57.2 bits (132), Expect = 2e-08 Identities = 28/90 (31%), Positives = 28/90 (31%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P PP P P P P P P P P PP P PPP PP Sbjct: 131 PPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPP 190 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P A PPPPP P Sbjct: 191 PAPTKVEPPPPPAPAEVEPPPPPAPTELEP 220 Score = 54.8 bits (126), Expect = 1e-07 Identities = 28/87 (32%), Positives = 28/87 (32%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P PP PP P PP P P P P PP PPP PPP Sbjct: 143 PAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPP--PPPAPTKVEPPP 200 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P PPPPP P Sbjct: 201 PPAPAEVEPPPPPAPTELEPPPPPAPP 227 Score = 50.8 bits (116), Expect = 2e-06 Identities = 28/87 (32%), Positives = 28/87 (32%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P PP P P P P P P P P PP P PPP PP Sbjct: 110 PAPPGVESP-PGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPP--APPTIKPPPPPA 166 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P PPPPPP P Sbjct: 167 PPTVEPPPPPPPAPPTVEPPPPPPPAP 193 Score = 44.4 bits (100), Expect = 2e-04 Identities = 26/92 (28%), Positives = 27/92 (29%) Frame = +2 Query: 506 KIFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXX 685 K+ P P P PPP P P PPP PPP PP Sbjct: 91 KVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVP 150 Query: 686 XXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P PPPPPP P Sbjct: 151 PPPPAPPTIKPPPPPAP-PTVEPPPPPPPAPP 181 Score = 43.2 bits (97), Expect = 4e-04 Identities = 26/85 (30%), Positives = 26/85 (30%), Gaps = 3/85 (3%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPP---PPXPPPXXXXXXXXXXXXX 695 PP PPPP P PP PP P P PP PP PPP Sbjct: 133 PPHTIEPPPPPAPPTLVPPPPPAPPTIKPP--PPPAPPTVEPPPPPPPAPPTVEPPPPPP 190 Query: 696 XXXXXXXXPXQXXPXXPXXXPPPXP 770 P P PPP P Sbjct: 191 PAPTKVEPPPPPAPAEVEPPPPPAP 215 Score = 42.7 bits (96), Expect = 6e-04 Identities = 24/86 (27%), Positives = 24/86 (27%), Gaps = 2/86 (2%) Frame = +2 Query: 521 PXPPXX--XPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 P P PP P PP P P P P P P PPP P Sbjct: 153 PPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPP 212 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPP 772 P P PPP PP Sbjct: 213 PAPTELEPPPPPAPPKVELPPPPAPP 238 Score = 40.7 bits (91), Expect = 0.002 Identities = 29/99 (29%), Positives = 29/99 (29%), Gaps = 5/99 (5%) Frame = +2 Query: 521 PXPPXXXPPXPX-PPPXXXXXXXPXXPXXXXPXXPXXPP-PXXPXPPPXX---PPPXAXX 685 P PP PP P P P P P P P P PPP PPP A Sbjct: 87 PAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPP 146 Query: 686 XXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXPFFFP 802 P A PPPP P P P Sbjct: 147 TLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEP 185 Score = 37.9 bits (84), Expect = 0.016 Identities = 27/93 (29%), Positives = 27/93 (29%), Gaps = 9/93 (9%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXP------XPPPP---XPPPXXXXXXX 677 PP PPPP P PP P P P PPPP PPP Sbjct: 89 PPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTL 148 Query: 678 XXXXXXXXXXXXXXPXQXXPXXPXXXPPPXPXP 776 P P P PPP P P Sbjct: 149 VPPPPPAPPTIKPPP---PPAPPTVEPPPPPPP 178 Score = 36.7 bits (81), Expect = 0.037 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 10/63 (15%) Frame = +2 Query: 521 PXPPXXXPPXPXPP-PXXXXXXXPXXPXXXXPXXPXXP----PPXXPXPP-----PXXPP 670 P PP PP P PP P P P P P P PP P PP P P Sbjct: 178 PAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPPAP 237 Query: 671 PXA 679 P A Sbjct: 238 PKA 240 Score = 35.5 bits (78), Expect = 0.086 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXA 679 P P P P P P P P P P PP PPP P A Sbjct: 190 PPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPPAPPKAEA 242 Score = 30.7 bits (66), Expect = 2.4 Identities = 21/87 (24%), Positives = 21/87 (24%), Gaps = 3/87 (3%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXXX 704 P P PP P P PP P PP PP Sbjct: 81 PEPVQVPAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPP 140 Query: 705 XXXXXP---XQXXPXXPXXXPPPXPXP 776 P P P PPP P P Sbjct: 141 PPPAPPTLVPPPPPAPPTIKPPPPPAP 167 >AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA, isoform A protein. Length = 1109 Score = 57.2 bits (132), Expect = 2e-08 Identities = 28/90 (31%), Positives = 28/90 (31%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P PP P P P P P P P P PP P PPP PP Sbjct: 394 PPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPP 453 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P A PPPPP P Sbjct: 454 PAPTKVEPPPPPAPAEVEPPPPPAPTELEP 483 Score = 54.8 bits (126), Expect = 1e-07 Identities = 28/87 (32%), Positives = 28/87 (32%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P PP PP P PP P P P P PP PPP PPP Sbjct: 406 PAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPP--PPPAPTKVEPPP 463 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P PPPPP P Sbjct: 464 PPAPAEVEPPPPPAPTELEPPPPPAPP 490 Score = 50.8 bits (116), Expect = 2e-06 Identities = 28/87 (32%), Positives = 28/87 (32%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P PP P P P P P P P P PP P PPP PP Sbjct: 373 PAPPGVESP-PGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPP--APPTIKPPPPPA 429 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P PPPPPP P Sbjct: 430 PPTVEPPPPPPPAPPTVEPPPPPPPAP 456 Score = 44.4 bits (100), Expect = 2e-04 Identities = 26/92 (28%), Positives = 27/92 (29%) Frame = +2 Query: 506 KIFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXX 685 K+ P P P PPP P P PPP PPP PP Sbjct: 354 KVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVP 413 Query: 686 XXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P PPPPPP P Sbjct: 414 PPPPAPPTIKPPPPPAP-PTVEPPPPPPPAPP 444 Score = 43.2 bits (97), Expect = 4e-04 Identities = 26/85 (30%), Positives = 26/85 (30%), Gaps = 3/85 (3%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPP---PPXPPPXXXXXXXXXXXXX 695 PP PPPP P PP PP P P PP PP PPP Sbjct: 396 PPHTIEPPPPPAPPTLVPPPPPAPPTIKPP--PPPAPPTVEPPPPPPPAPPTVEPPPPPP 453 Query: 696 XXXXXXXXPXQXXPXXPXXXPPPXP 770 P P PPP P Sbjct: 454 PAPTKVEPPPPPAPAEVEPPPPPAP 478 Score = 42.7 bits (96), Expect = 6e-04 Identities = 24/86 (27%), Positives = 24/86 (27%), Gaps = 2/86 (2%) Frame = +2 Query: 521 PXPPXX--XPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 P P PP P PP P P P P P P PPP P Sbjct: 416 PPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPP 475 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPP 772 P P PPP PP Sbjct: 476 PAPTELEPPPPPAPPKVELPPPPAPP 501 Score = 40.7 bits (91), Expect = 0.002 Identities = 29/99 (29%), Positives = 29/99 (29%), Gaps = 5/99 (5%) Frame = +2 Query: 521 PXPPXXXPPXPX-PPPXXXXXXXPXXPXXXXPXXPXXPP-PXXPXPPPXX---PPPXAXX 685 P PP PP P P P P P P P P PPP PPP A Sbjct: 350 PAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPP 409 Query: 686 XXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXPFFFP 802 P A PPPP P P P Sbjct: 410 TLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEP 448 Score = 37.9 bits (84), Expect = 0.016 Identities = 27/93 (29%), Positives = 27/93 (29%), Gaps = 9/93 (9%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXP------XPPPP---XPPPXXXXXXX 677 PP PPPP P PP P P P PPPP PPP Sbjct: 352 PPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTL 411 Query: 678 XXXXXXXXXXXXXXPXQXXPXXPXXXPPPXPXP 776 P P P PPP P P Sbjct: 412 VPPPPPAPPTIKPPP---PPAPPTVEPPPPPPP 441 Score = 36.7 bits (81), Expect = 0.037 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 10/63 (15%) Frame = +2 Query: 521 PXPPXXXPPXPXPP-PXXXXXXXPXXPXXXXPXXPXXP----PPXXPXPP-----PXXPP 670 P PP PP P PP P P P P P P PP P PP P P Sbjct: 441 PAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPPAP 500 Query: 671 PXA 679 P A Sbjct: 501 PKA 503 Score = 35.5 bits (78), Expect = 0.086 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXA 679 P P P P P P P P P P PP PPP P A Sbjct: 453 PPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPPAPPKAEA 505 Score = 30.7 bits (66), Expect = 2.4 Identities = 21/87 (24%), Positives = 21/87 (24%), Gaps = 3/87 (3%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXXX 704 P P PP P P PP P PP PP Sbjct: 344 PEPVQVPAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPP 403 Query: 705 XXXXXP---XQXXPXXPXXXPPPXPXP 776 P P P PPP P P Sbjct: 404 PPPAPPTLVPPPPPAPPTIKPPPPPAP 430 >AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB, isoform B protein. Length = 1150 Score = 57.2 bits (132), Expect = 2e-08 Identities = 28/90 (31%), Positives = 28/90 (31%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P PP P P P P P P P P PP P PPP PP Sbjct: 394 PPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPP 453 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P A PPPPP P Sbjct: 454 PAPTKVEPPPPPAPAEVEPPPPPAPTELEP 483 Score = 54.8 bits (126), Expect = 1e-07 Identities = 28/87 (32%), Positives = 28/87 (32%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P PP PP P PP P P P P PP PPP PPP Sbjct: 406 PAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPP--PPPAPTKVEPPP 463 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P PPPPP P Sbjct: 464 PPAPAEVEPPPPPAPTELEPPPPPAPP 490 Score = 50.8 bits (116), Expect = 2e-06 Identities = 28/87 (32%), Positives = 28/87 (32%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P PP P P P P P P P P PP P PPP PP Sbjct: 373 PAPPGVESP-PGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPP--APPTIKPPPPPA 429 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P PPPPPP P Sbjct: 430 PPTVEPPPPPPPAPPTVEPPPPPPPAP 456 Score = 44.4 bits (100), Expect = 2e-04 Identities = 26/92 (28%), Positives = 27/92 (29%) Frame = +2 Query: 506 KIFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXX 685 K+ P P P PPP P P PPP PPP PP Sbjct: 354 KVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVP 413 Query: 686 XXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P PPPPPP P Sbjct: 414 PPPPAPPTIKPPPPPAP-PTVEPPPPPPPAPP 444 Score = 43.2 bits (97), Expect = 4e-04 Identities = 26/85 (30%), Positives = 26/85 (30%), Gaps = 3/85 (3%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPP---PPXPPPXXXXXXXXXXXXX 695 PP PPPP P PP PP P P PP PP PPP Sbjct: 396 PPHTIEPPPPPAPPTLVPPPPPAPPTIKPP--PPPAPPTVEPPPPPPPAPPTVEPPPPPP 453 Query: 696 XXXXXXXXPXQXXPXXPXXXPPPXP 770 P P PPP P Sbjct: 454 PAPTKVEPPPPPAPAEVEPPPPPAP 478 Score = 42.7 bits (96), Expect = 6e-04 Identities = 24/86 (27%), Positives = 24/86 (27%), Gaps = 2/86 (2%) Frame = +2 Query: 521 PXPPXX--XPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 P P PP P PP P P P P P P PPP P Sbjct: 416 PPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPP 475 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPP 772 P P PPP PP Sbjct: 476 PAPTELEPPPPPAPPKVELPPPPAPP 501 Score = 40.7 bits (91), Expect = 0.002 Identities = 29/99 (29%), Positives = 29/99 (29%), Gaps = 5/99 (5%) Frame = +2 Query: 521 PXPPXXXPPXPX-PPPXXXXXXXPXXPXXXXPXXPXXPP-PXXPXPPPXX---PPPXAXX 685 P PP PP P P P P P P P P PPP PPP A Sbjct: 350 PAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPP 409 Query: 686 XXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXPFFFP 802 P A PPPP P P P Sbjct: 410 TLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEP 448 Score = 37.9 bits (84), Expect = 0.016 Identities = 27/93 (29%), Positives = 27/93 (29%), Gaps = 9/93 (9%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXP------XPPPP---XPPPXXXXXXX 677 PP PPPP P PP P P P PPPP PPP Sbjct: 352 PPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTL 411 Query: 678 XXXXXXXXXXXXXXPXQXXPXXPXXXPPPXPXP 776 P P P PPP P P Sbjct: 412 VPPPPPAPPTIKPPP---PPAPPTVEPPPPPPP 441 Score = 36.7 bits (81), Expect = 0.037 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 10/63 (15%) Frame = +2 Query: 521 PXPPXXXPPXPXPP-PXXXXXXXPXXPXXXXPXXPXXP----PPXXPXPP-----PXXPP 670 P PP PP P PP P P P P P P PP P PP P P Sbjct: 441 PAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPPAP 500 Query: 671 PXA 679 P A Sbjct: 501 PKA 503 Score = 35.5 bits (78), Expect = 0.086 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXA 679 P P P P P P P P P P PP PPP P A Sbjct: 453 PPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPPAPPKAEA 505 Score = 30.7 bits (66), Expect = 2.4 Identities = 21/87 (24%), Positives = 21/87 (24%), Gaps = 3/87 (3%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXXX 704 P P PP P P PP P PP PP Sbjct: 344 PEPVQVPAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPP 403 Query: 705 XXXXXP---XQXXPXXPXXXPPPXPXP 776 P P P PPP P P Sbjct: 404 PPPAPPTLVPPPPPAPPTIKPPPPPAP 430 >BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p protein. Length = 538 Score = 49.6 bits (113), Expect = 5e-06 Identities = 32/92 (34%), Positives = 32/92 (34%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGG G G G G A GG GGG G GGG G G Sbjct: 301 GFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGYGGQGGAGGG--YGGGGGRGGGGAPGAPG 358 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 G GGG G GG G G P Sbjct: 359 APGSPGGGGFGGQGGGGGFGGGGGRGGAPGAP 390 Score = 48.8 bits (111), Expect = 9e-06 Identities = 32/92 (34%), Positives = 32/92 (34%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GG G G G G A GG GGG G GGG G G Sbjct: 236 GQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGGYGGGGGGGRGGGGAPGAPG 295 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 G G GGG G GG G G P Sbjct: 296 SPGGGGFG---GQGGGGGFGGGGGRGGAPGAP 324 Score = 46.8 bits (106), Expect = 3e-05 Identities = 31/96 (32%), Positives = 32/96 (33%), Gaps = 4/96 (4%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGG----GXGXXG 634 G G G GGGG G G G + GGG GG G G G Sbjct: 220 GGAPGGPGAPGGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGGYGG 279 Query: 633 GGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GG G G G G GG G GG GG Sbjct: 280 GGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGGG 315 Score = 44.8 bits (101), Expect = 1e-04 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 1/97 (1%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX-AXGGGXXGGGXGXXGGGX 625 G G G GGGGG G G G A GGG G G G GG Sbjct: 163 GYSGGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGA 222 Query: 624 XGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 G G G G GG G G G G P Sbjct: 223 PGGPGAPGGGGFGGQGGGGGYGGAGGGAGRGGSPGGP 259 Score = 44.4 bits (100), Expect = 2e-04 Identities = 32/95 (33%), Positives = 32/95 (33%), Gaps = 1/95 (1%) Frame = -2 Query: 801 GKKKGXXGXXGG-GGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGX 625 G G G GG GGGG G G A GGG GG G GGG Sbjct: 186 GSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQGG--GGGY 243 Query: 624 XGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G GGG G G GG G Sbjct: 244 GGAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGGYG 278 Score = 43.6 bits (98), Expect = 3e-04 Identities = 28/88 (31%), Positives = 29/88 (32%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGG G G + GGG GG G GGG G G Sbjct: 289 GAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGY-GGQGGAGGGYGGGGG 347 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G GG GG Sbjct: 348 RGGGGAPGAPGAPGSPGGGGFGGQGGGG 375 Score = 42.7 bits (96), Expect = 6e-04 Identities = 31/97 (31%), Positives = 32/97 (32%), Gaps = 1/97 (1%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGG-GX 625 G G G G GGGG + G G G GG GGG G GG G Sbjct: 162 GGYSGGPGGQGAGGGGGGGSGYG--GGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGR 219 Query: 624 XGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 G G G GGG G G G G P Sbjct: 220 GGAPGGPGAPGGGGFGGQGGGGGYGGAGGGAGRGGSP 256 Score = 42.7 bits (96), Expect = 6e-04 Identities = 31/100 (31%), Positives = 32/100 (32%), Gaps = 4/100 (4%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXG--GGXGXXGG- 631 G G G G GGG G G + GGG G GG G GG Sbjct: 351 GGAPGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGFGGQGGGGGYGGG 410 Query: 630 -GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 G G G G GGG G GG G G P Sbjct: 411 AGRGGAPGAPGSPGGGGFGGQGGGGGFGAGGGRGGAGGAP 450 Score = 41.5 bits (93), Expect = 0.001 Identities = 30/92 (32%), Positives = 30/92 (32%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GG G G G G G A GG GG G G G G G Sbjct: 209 GGYGSGGGSGRGGAPGGPGAPGGGGFGGQGGGGGYGGAGGGAGRGGSPG--GPGSPGGGG 266 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 G G GGG G GG G G P Sbjct: 267 FGGQGGAGGGYGGGGGGGRG-GGGAPGAPGSP 297 Score = 41.5 bits (93), Expect = 0.001 Identities = 29/92 (31%), Positives = 29/92 (31%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GG GGG G G G GG GGG GGG G G Sbjct: 330 GGYGGQGGAGGGYGGGG-GRGGGGAPGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPG 388 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 G GGG G G G G P Sbjct: 389 APGSPGGGGFGGQGGGGGYGGGAGRGGAPGAP 420 Score = 41.1 bits (92), Expect = 0.002 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG GGGG G G G GG G G GGGG GG Sbjct: 174 GGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGG 216 Score = 41.1 bits (92), Expect = 0.002 Identities = 29/98 (29%), Positives = 31/98 (31%), Gaps = 2/98 (2%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G + G G G GGG G G + GGG GG G G G Sbjct: 381 GGRGGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGGGGFGAG 440 Query: 621 GXXG--XXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 G G G G GGG G G G G P Sbjct: 441 GGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGGRPGGP 478 Score = 40.7 bits (91), Expect = 0.002 Identities = 29/92 (31%), Positives = 29/92 (31%), Gaps = 2/92 (2%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXG--GGXXGGGXGXXGGGXXGX 616 G G GGG GG G G G A G G GGG G GGG Sbjct: 185 GGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQGGGGGYG 244 Query: 615 XGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GG G GG G G Sbjct: 245 GAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGG 276 Score = 40.7 bits (91), Expect = 0.002 Identities = 24/77 (31%), Positives = 24/77 (31%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G G G GGG GGGG G G Sbjct: 334 GQGGAGGGYGGGGGRGGGGAPGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSP 393 Query: 595 XXGGXXXXGXGXGXGGG 545 GG G G G GGG Sbjct: 394 GGGGFGGQGGGGGYGGG 410 Score = 40.3 bits (90), Expect = 0.003 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG GG G G G GG G G G G GGGG GG Sbjct: 166 GGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGG 208 Score = 39.5 bits (88), Expect = 0.005 Identities = 33/102 (32%), Positives = 34/102 (33%), Gaps = 6/102 (5%) Frame = -2 Query: 801 GKKKGXXGXXGGGG-GGXXXAXXGCXGXXXXXXXXXXXXXGX-AXGGGXXGG--GXGXXG 634 G G G GGGG GG A G G + GGG GG G G G Sbjct: 253 GGSPGGPGSPGGGGFGGQGGAGGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFG 312 Query: 633 GGXXGXXGXXXXGXXGXXXXXXXGGGXG--XGGXXXGGXGXP 514 GG G G GG G GG GG G P Sbjct: 313 GGGGRGGAPGAPGSPGGGGYGGQGGAGGGYGGGGGRGGGGAP 354 Score = 39.5 bits (88), Expect = 0.005 Identities = 28/98 (28%), Positives = 28/98 (28%), Gaps = 2/98 (2%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXG--GGXXGGGXGXXGGG 628 G G G GGGG G G G G G GGG G GG Sbjct: 384 GGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGGGGFGAGGGR 443 Query: 627 XXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 G G GG G G GG G P Sbjct: 444 GGAGGAPGGPGSPGGPGYGGGAGGPGGAGGRPGGPGLP 481 Score = 38.7 bits (86), Expect = 0.009 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GG GG G G G G G G G GG G GG GG G Sbjct: 161 GGGYSGGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGG 210 Score = 32.3 bits (70), Expect = 0.80 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = -1 Query: 655 GGGXGGGGXGX-GXXGGXXXXXXGGXXXXGXGXGXGG--GGXXXXGG 524 G G GGGG G G GG GG G G G GG GG GG Sbjct: 186 GSGFGGGGAG-GGSGGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPGG 231 Score = 32.3 bits (70), Expect = 0.80 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GGGG G G + GG GGG G GG Sbjct: 414 GGAPGAPGSPGGGGFGGQGGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGG 473 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G GG G G G Sbjct: 474 RPGG---PGLPGNQYVPPAAGGGAPGSPGRPGSG 504 Score = 31.9 bits (69), Expect = 1.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G G GGGG Sbjct: 3 GGGPGGGGAGGFGGGNNGLGGFANGRPIAPGGGGGGGG 40 Score = 31.5 bits (68), Expect = 1.4 Identities = 22/83 (26%), Positives = 22/83 (26%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GGG G G GGG GG G G G Sbjct: 400 GQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGGGGFGAGGGRGGAGGAPGGPGSPGGP 459 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G GG G Sbjct: 460 GYGGGAGGPGGAGGRPGGPGLPG 482 >AY075448-1|AAL68261.2| 218|Drosophila melanogaster RE09269p protein. Length = 218 Score = 49.6 bits (113), Expect = 5e-06 Identities = 31/94 (32%), Positives = 31/94 (32%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGG G G G A GGG GG G GGG G G Sbjct: 76 GGGGGYGGGGYGGGGYGGGGHGGGSTIKIIKVITDSGAGGGGYGGGYGGGHGGGYGGGYG 135 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKI 508 G G G GG GG G KI Sbjct: 136 GGSSGGYSGGHGGGWSSGGGYGGGGYGGGGNVKI 169 Score = 32.7 bits (71), Expect = 0.60 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GG G G G G G GG G GG GG G Sbjct: 45 GGGGAGGSALSSGWSSGGGGGGYSGGYSGGHGGGGGYGGGGYGGGGYGGGG 95 Score = 32.3 bits (70), Expect = 0.80 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGGG G GG GG G G G GG G GG Sbjct: 57 GWSSGGGGGGYS--GGYSGGHGGGGGYGGGGYGGGGYGGGGHGG 98 Score = 32.3 bits (70), Expect = 0.80 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG G G G GG GG G G G GGG Sbjct: 62 GGGGGYSGGYSGGHGGGGGYGGGGYGGGGYGGGGHGGG 99 Score = 31.1 bits (67), Expect = 1.8 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXG 544 G GGG G GG G G G G GGG G G Sbjct: 57 GWSSGGGGGGYSGGYSGGHGGGGGYGGGGYGGGGYGGGGHGGG 99 Score = 30.7 bits (66), Expect = 2.4 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -1 Query: 652 GGXGGGG-XGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGGG G G GG G G GGGG GG Sbjct: 42 GFLGGGGAGGSALSSGWSSGGGGGGYSGGYSGGHGGGGGYGGGG 85 Score = 30.7 bits (66), Expect = 2.4 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXG 529 G GGG G GG G G G G GGG G GG G Sbjct: 57 GWSSGGGGGGYSGGYSGGHG----GGGGYGGGGYGGGGYGGGGHGGG 99 Score = 29.1 bits (62), Expect = 7.4 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 8/61 (13%) Frame = -2 Query: 678 AXGGGXXGGGXG--------XXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGX 523 A G GGG G GGG G G G G GGG G GG GG Sbjct: 39 AHAGFLGGGGAGGSALSSGWSSGGGGGGYSGGYSGGHGG--GGGYGGGGYGGGGYGGGGH 96 Query: 522 G 520 G Sbjct: 97 G 97 >AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-PA, isoform A protein. Length = 610 Score = 49.6 bits (113), Expect = 5e-06 Identities = 32/92 (34%), Positives = 32/92 (34%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGG G G G G A GG GGG G GGG G G Sbjct: 373 GFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGYGGQGGAGGG--YGGGGGRGGGGAPGAPG 430 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 G GGG G GG G G P Sbjct: 431 APGSPGGGGFGGQGGGGGFGGGGGRGGAPGAP 462 Score = 48.8 bits (111), Expect = 9e-06 Identities = 32/92 (34%), Positives = 32/92 (34%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GG G G G G A GG GGG G GGG G G Sbjct: 308 GQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGGYGGGGGGGRGGGGAPGAPG 367 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 G G GGG G GG G G P Sbjct: 368 SPGGGGFG---GQGGGGGFGGGGGRGGAPGAP 396 Score = 46.8 bits (106), Expect = 3e-05 Identities = 31/96 (32%), Positives = 32/96 (33%), Gaps = 4/96 (4%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGG----GXGXXG 634 G G G GGGG G G G + GGG GG G G G Sbjct: 292 GGAPGGPGAPGGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGGYGG 351 Query: 633 GGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GG G G G G GG G GG GG Sbjct: 352 GGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGGG 387 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG GGGG G G GG GG G G G GGGG GG Sbjct: 45 GGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGG 88 Score = 44.8 bits (101), Expect = 1e-04 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 1/97 (1%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX-AXGGGXXGGGXGXXGGGX 625 G G G GGGGG G G G A GGG G G G GG Sbjct: 235 GYSGGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGA 294 Query: 624 XGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 G G G G GG G G G G P Sbjct: 295 PGGPGAPGGGGFGGQGGGGGYGGAGGGAGRGGSPGGP 331 Score = 44.4 bits (100), Expect = 2e-04 Identities = 32/95 (33%), Positives = 32/95 (33%), Gaps = 1/95 (1%) Frame = -2 Query: 801 GKKKGXXGXXGG-GGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGX 625 G G G GG GGGG G G A GGG GG G GGG Sbjct: 258 GSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQGG--GGGY 315 Query: 624 XGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G GGG G G GG G Sbjct: 316 GGAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGGYG 350 Score = 43.6 bits (98), Expect = 3e-04 Identities = 28/88 (31%), Positives = 29/88 (32%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGG G G + GGG GG G GGG G G Sbjct: 361 GAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGY-GGQGGAGGGYGGGGG 419 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G GG GG Sbjct: 420 RGGGGAPGAPGAPGSPGGGGFGGQGGGG 447 Score = 42.7 bits (96), Expect = 6e-04 Identities = 31/97 (31%), Positives = 32/97 (32%), Gaps = 1/97 (1%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGG-GX 625 G G G G GGGG + G G G GG GGG G GG G Sbjct: 234 GGYSGGPGGQGAGGGGGGGSGYG--GGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGR 291 Query: 624 XGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 G G G GGG G G G G P Sbjct: 292 GGAPGGPGAPGGGGFGGQGGGGGYGGAGGGAGRGGSP 328 Score = 42.7 bits (96), Expect = 6e-04 Identities = 31/100 (31%), Positives = 32/100 (32%), Gaps = 4/100 (4%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXG--GGXGXXGG- 631 G G G G GGG G G + GGG G GG G GG Sbjct: 423 GGAPGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGFGGQGGGGGYGGG 482 Query: 630 -GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 G G G G GGG G GG G G P Sbjct: 483 AGRGGAPGAPGSPGGGGFGGQGGGGGFGAGGGRGGAGGAP 522 Score = 41.5 bits (93), Expect = 0.001 Identities = 30/92 (32%), Positives = 30/92 (32%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GG G G G G G A GG GG G G G G G Sbjct: 281 GGYGSGGGSGRGGAPGGPGAPGGGGFGGQGGGGGYGGAGGGAGRGGSPG--GPGSPGGGG 338 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 G G GGG G GG G G P Sbjct: 339 FGGQGGAGGGYGGGGGGGRG-GGGAPGAPGSP 369 Score = 41.5 bits (93), Expect = 0.001 Identities = 29/92 (31%), Positives = 29/92 (31%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GG GGG G G G GG GGG GGG G G Sbjct: 402 GGYGGQGGAGGGYGGGG-GRGGGGAPGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPG 460 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 G GGG G G G G P Sbjct: 461 APGSPGGGGFGGQGGGGGYGGGAGRGGAPGAP 492 Score = 41.1 bits (92), Expect = 0.002 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG GGGG G G G GG G G GGGG GG Sbjct: 246 GGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGG 288 Score = 41.1 bits (92), Expect = 0.002 Identities = 29/98 (29%), Positives = 31/98 (31%), Gaps = 2/98 (2%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G + G G G GGG G G + GGG GG G G G Sbjct: 453 GGRGGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGGGGFGAG 512 Query: 621 GXXG--XXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 G G G G GGG G G G G P Sbjct: 513 GGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGGRPGGP 550 Score = 40.7 bits (91), Expect = 0.002 Identities = 29/92 (31%), Positives = 29/92 (31%), Gaps = 2/92 (2%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXG--GGXXGGGXGXXGGGXXGX 616 G G GGG GG G G G A G G GGG G GGG Sbjct: 257 GGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQGGGGGYG 316 Query: 615 XGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GG G GG G G Sbjct: 317 GAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGG 348 Score = 40.7 bits (91), Expect = 0.002 Identities = 24/77 (31%), Positives = 24/77 (31%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G G G GGG GGGG G G Sbjct: 406 GQGGAGGGYGGGGGRGGGGAPGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSP 465 Query: 595 XXGGXXXXGXGXGXGGG 545 GG G G G GGG Sbjct: 466 GGGGFGGQGGGGGYGGG 482 Score = 40.3 bits (90), Expect = 0.003 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG GG G G G GG G G G G GGGG GG Sbjct: 238 GGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGG 280 Score = 39.5 bits (88), Expect = 0.005 Identities = 33/102 (32%), Positives = 34/102 (33%), Gaps = 6/102 (5%) Frame = -2 Query: 801 GKKKGXXGXXGGGG-GGXXXAXXGCXGXXXXXXXXXXXXXGX-AXGGGXXGG--GXGXXG 634 G G G GGGG GG A G G + GGG GG G G G Sbjct: 325 GGSPGGPGSPGGGGFGGQGGAGGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFG 384 Query: 633 GGXXGXXGXXXXGXXGXXXXXXXGGGXG--XGGXXXGGXGXP 514 GG G G GG G GG GG G P Sbjct: 385 GGGGRGGAPGAPGSPGGGGYGGQGGAGGGYGGGGGRGGGGAP 426 Score = 39.5 bits (88), Expect = 0.005 Identities = 28/98 (28%), Positives = 28/98 (28%), Gaps = 2/98 (2%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXG--GGXXGGGXGXXGGG 628 G G G GGGG G G G G G GGG G GG Sbjct: 456 GGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGGGGFGAGGGR 515 Query: 627 XXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 G G GG G G GG G P Sbjct: 516 GGAGGAPGGPGSPGGPGYGGGAGGPGGAGGRPGGPGLP 553 Score = 38.7 bits (86), Expect = 0.009 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GG GG G G G G G G G GG G GG GG G Sbjct: 233 GGGYSGGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGG 282 Score = 36.3 bits (80), Expect = 0.049 Identities = 29/93 (31%), Positives = 30/93 (32%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GG GGG G G GGG GG G GGG G G Sbjct: 39 GLQGPGGGFGGGGGFGGGGAGGGYGG-----------GGGGGPAGGFGGGPGGGGAGGFG 87 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPK 511 G G G G GG GG P+ Sbjct: 88 GGNNGLGGFANGRPIAPGGGGGG---GGAPAPR 117 Score = 35.5 bits (78), Expect = 0.086 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G GGG G G G G G G GG GG G Sbjct: 37 GAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFG 87 Score = 34.7 bits (76), Expect = 0.15 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG G G GGG G G G G GG G G GG G Sbjct: 30 ASAGGSPGAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGG 82 Score = 33.9 bits (74), Expect = 0.26 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 G G G G G G GG GG G G G GG GG F Sbjct: 37 GAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGF 86 Score = 32.3 bits (70), Expect = 0.80 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = -1 Query: 655 GGGXGGGGXGX-GXXGGXXXXXXGGXXXXGXGXGXGG--GGXXXXGG 524 G G GGGG G G GG GG G G G GG GG GG Sbjct: 258 GSGFGGGGAG-GGSGGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPGG 303 Score = 32.3 bits (70), Expect = 0.80 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GGGG G G + GG GGG G GG Sbjct: 486 GGAPGAPGSPGGGGFGGQGGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGG 545 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G GG G G G Sbjct: 546 RPGG---PGLPGNQYVPPAAGGGAPGSPGRPGSG 576 Score = 31.5 bits (68), Expect = 1.4 Identities = 22/83 (26%), Positives = 22/83 (26%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GGG G G GGG GG G G G Sbjct: 472 GQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGGGGFGAGGGRGGAGGAPGGPGSPGGP 531 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G GG G Sbjct: 532 GYGGGAGGPGGAGGRPGGPGLPG 554 >X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin protein. Length = 147 Score = 49.2 bits (112), Expect = 7e-06 Identities = 31/93 (33%), Positives = 33/93 (35%) Frame = -2 Query: 798 KKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXG 619 + +G G GGGGGG G G GGG GG G GG G Sbjct: 14 QSRGGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRG-----GGGDRGGRGGFGGGRGGG 68 Query: 618 XXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G GGG G GG GG G Sbjct: 69 GRGGGGGGGRGAFGGRGGGGGRGGGGRGGGGRG 101 Score = 48.4 bits (110), Expect = 1e-05 Identities = 32/90 (35%), Positives = 32/90 (35%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G GGG GGG G GGG G G Sbjct: 28 GFRGRGGGGGGGG-----GGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFG 82 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG G G Sbjct: 83 GRGGGG-GRGGGGRGGGGRGGGGRGGGAGG 111 Score = 45.6 bits (103), Expect = 8e-05 Identities = 29/83 (34%), Positives = 29/83 (34%), Gaps = 1/83 (1%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GGG G G G G G Sbjct: 33 GGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFGGRGGGGGRGG 92 Query: 591 XGXXXXXXXGGGXGXG-GXXXGG 526 G GGG G G G GG Sbjct: 93 GGRGGGGRGGGGRGGGAGGFKGG 115 Score = 43.2 bits (97), Expect = 4e-04 Identities = 31/96 (32%), Positives = 32/96 (33%), Gaps = 3/96 (3%) Frame = -1 Query: 802 RKKKRXXXXGXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXX-GGGXGGGGXG 626 R + R G G GGG G G G GGG GGGG G Sbjct: 12 RIQSRGGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRG 71 Query: 625 XGXXG--GXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G G G GG G G G GG G GG Sbjct: 72 GGGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGG 107 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/78 (32%), Positives = 25/78 (32%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GGG G G G GGG GGG G GG Sbjct: 31 GRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFGGRGGGGGR 90 Query: 595 XXGGXXXXGXGXGXGGGG 542 GG G G G GGG Sbjct: 91 GGGGRGGGGRGGGGRGGG 108 Score = 38.3 bits (85), Expect = 0.012 Identities = 26/78 (33%), Positives = 26/78 (33%), Gaps = 2/78 (2%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGG--XGXGXXGGXXXX 596 G GGG G G G G GGG GG G G G GG Sbjct: 34 GGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFGGRGGGGGRGGG 93 Query: 595 XXGGXXXXGXGXGXGGGG 542 GG G G G G GG Sbjct: 94 GRGGGGRGGGGRGGGAGG 111 >AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA protein. Length = 344 Score = 49.2 bits (112), Expect = 7e-06 Identities = 30/92 (32%), Positives = 30/92 (32%) Frame = -2 Query: 795 KKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGX 616 K G GGGGGG G GGG GG G GG G Sbjct: 3 KPGFSPRGGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGG 62 Query: 615 XGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G GGG G GG GG G Sbjct: 63 RGGGGGGGRGAFGGRGGGGGRGGGGRGGGGRG 94 Score = 48.4 bits (110), Expect = 1e-05 Identities = 32/90 (35%), Positives = 32/90 (35%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G GGG GGG G GGG G G Sbjct: 21 GFRGRGGGGGGGG-----GGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFG 75 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG G G Sbjct: 76 GRGGGG-GRGGGGRGGGGRGGGGRGGGAGG 104 Score = 45.6 bits (103), Expect = 8e-05 Identities = 29/83 (34%), Positives = 29/83 (34%), Gaps = 1/83 (1%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GGG G G G G G Sbjct: 26 GGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFGGRGGGGGRGG 85 Query: 591 XGXXXXXXXGGGXGXG-GXXXGG 526 G GGG G G G GG Sbjct: 86 GGRGGGGRGGGGRGGGAGGFKGG 108 Score = 42.7 bits (96), Expect = 6e-04 Identities = 29/86 (33%), Positives = 29/86 (33%), Gaps = 2/86 (2%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXG--GXX 602 G G GGG G G G GGG GGGG G G G G Sbjct: 15 GGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAF 74 Query: 601 XXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG G G G GG G GG Sbjct: 75 GGRGGGGGRGGGGRGGGGRGGGGRGG 100 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/78 (32%), Positives = 25/78 (32%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GGG G G G GGG GGG G GG Sbjct: 24 GRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFGGRGGGGGR 83 Query: 595 XXGGXXXXGXGXGXGGGG 542 GG G G G GGG Sbjct: 84 GGGGRGGGGRGGGGRGGG 101 Score = 38.3 bits (85), Expect = 0.012 Identities = 26/78 (33%), Positives = 26/78 (33%), Gaps = 2/78 (2%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGG--XGXGXXGGXXXX 596 G GGG G G G G GGG GG G G G GG Sbjct: 27 GGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFGGRGGGGGRGGG 86 Query: 595 XXGGXXXXGXGXGXGGGG 542 GG G G G G GG Sbjct: 87 GRGGGGRGGGGRGGGAGG 104 Score = 30.3 bits (65), Expect = 3.2 Identities = 23/61 (37%), Positives = 24/61 (39%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G +G G GGGGGG A G G G GGG GGG G GG Sbjct: 55 GGGRGGGGRGGGGGGG-RGAFGGRGG-------GGGRGGGGRGGGGRGGGGRGGGAGGFK 106 Query: 621 G 619 G Sbjct: 107 G 107 >AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 protein. Length = 809 Score = 48.0 bits (109), Expect = 2e-05 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P PPPP P P P P PP P P PPPP PP Sbjct: 639 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPP 681 Score = 39.9 bits (89), Expect = 0.004 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +2 Query: 530 PXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP P PPP P P P PP P PPP PPP Sbjct: 639 PSYPPPPPPPPPP------PPPQTCCAPVRPPYAPPVRPLPPPPPPPP 680 Score = 39.9 bits (89), Expect = 0.004 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 542 PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 PP P PPP P P P P PPP P P P P Sbjct: 645 PPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYPYTP 688 Score = 35.5 bits (78), Expect = 0.086 Identities = 20/58 (34%), Positives = 21/58 (36%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXPF 793 P PPP P PPP PPP P P PPPPPP P+ Sbjct: 639 PSYPPPPPPPPPP--PPPQTCCAPVRP--------PYAPPVRPLPPPPPPPPPVPYPY 686 Score = 33.9 bits (74), Expect = 0.26 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +1 Query: 526 PPXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPPXXPPP 672 P PP PP P P PP P P P PPP P P Sbjct: 639 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPP--VRPLPPPPPPPPPVPYP 685 Score = 32.7 bits (71), Expect = 0.60 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GG G G GGG G G GG G GG GG G Sbjct: 445 GGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGGGGG 495 >AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB, isoform B protein. Length = 887 Score = 48.0 bits (109), Expect = 2e-05 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P PPPP P P P P PP P P PPPP PP Sbjct: 779 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPP 821 Score = 39.9 bits (89), Expect = 0.004 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +2 Query: 530 PXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP P PPP P P P PP P PPP PPP Sbjct: 779 PSYPPPPPPPPPP------PPPQTCCAPVRPPYAPPVRPLPPPPPPPP 820 Score = 39.9 bits (89), Expect = 0.004 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 542 PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 PP P PPP P P P P PPP P P P P Sbjct: 785 PPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYPYTP 828 Score = 35.5 bits (78), Expect = 0.086 Identities = 20/58 (34%), Positives = 21/58 (36%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXPF 793 P PPP P PPP PPP P P PPPPPP P+ Sbjct: 779 PSYPPPPPPPPPP--PPPQTCCAPVRP--------PYAPPVRPLPPPPPPPPPVPYPY 826 Score = 33.9 bits (74), Expect = 0.26 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +1 Query: 526 PPXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPPXXPPP 672 P PP PP P P PP P P P PPP P P Sbjct: 779 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPP--VRPLPPPPPPPPPVPYP 825 Score = 29.1 bits (62), Expect = 7.4 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GG G G GGG G G GG G GG G G Sbjct: 582 GGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGG 632 >AE014298-2797|AAF48914.2| 193|Drosophila melanogaster CG14191-PA protein. Length = 193 Score = 47.2 bits (107), Expect = 3e-05 Identities = 31/90 (34%), Positives = 31/90 (34%), Gaps = 2/90 (2%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGG G G G A GGG GG G GGG G G Sbjct: 51 GGGGGYGGGGYGGGGYGGGGHGGGSTIKIIKVITDSGAGGGGYGGGYGGGHGGGYGGGYG 110 Query: 609 XXXXG--XXGXXXXXXXGGGXGXGGXXXGG 526 G G GGG G GG GG Sbjct: 111 GGSSGGYSGGHGGGWSSGGGYGGGGYGSGG 140 Score = 37.5 bits (83), Expect = 0.021 Identities = 29/95 (30%), Positives = 29/95 (30%), Gaps = 1/95 (1%) Frame = -2 Query: 801 GKKKGXXGXXGGGGG-GXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGX 625 G G G GGGGG G G G G GGG GGG Sbjct: 41 GYSGGYSGGHGGGGGYGGGGYGGGGYGGGGHGGGSTIKIIKVITDSGAGGGG---YGGGY 97 Query: 624 XGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G G GG G Sbjct: 98 GGGHGGGYGGGYGGGSSGGYSGGHGGGWSSGGGYG 132 Score = 36.7 bits (81), Expect = 0.037 Identities = 29/88 (32%), Positives = 30/88 (34%), Gaps = 4/88 (4%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXX-WXGXXXXXXXXXXXXXXXXXXGXXGGGXGG---GGXGXGXXGG 608 G G GGG G G + G G GGG GG GG G G GG Sbjct: 49 GHGGGGGYGGGGYGGGGYGGGGHGGGSTIKIIKVITDSGAGGGGYGGGYGGGHGGGYGGG 108 Query: 607 XXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG G G G GG GG Sbjct: 109 YGGGSSGG-YSGGHGGGWSSGGGYGGGG 135 Score = 32.7 bits (71), Expect = 0.60 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GG G G G G G GG G GG GG G Sbjct: 20 GGGGAGGSALSSGWSSGGGGGGYSGGYSGGHGGGGGYGGGGYGGGGYGGGG 70 Score = 32.3 bits (70), Expect = 0.80 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGGG G GG GG G G G GG G GG Sbjct: 32 GWSSGGGGGGYS--GGYSGGHGGGGGYGGGGYGGGGYGGGGHGG 73 Score = 32.3 bits (70), Expect = 0.80 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG G G G GG GG G G G GGG Sbjct: 37 GGGGGYSGGYSGGHGGGGGYGGGGYGGGGYGGGGHGGG 74 Score = 31.1 bits (67), Expect = 1.8 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXG 544 G GGG G GG G G G G GGG G G Sbjct: 32 GWSSGGGGGGYSGGYSGGHGGGGGYGGGGYGGGGYGGGGHGGG 74 Score = 30.7 bits (66), Expect = 2.4 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -1 Query: 652 GGXGGGG-XGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGGG G G GG G G GGGG GG Sbjct: 17 GFLGGGGAGGSALSSGWSSGGGGGGYSGGYSGGHGGGGGYGGGG 60 Score = 30.7 bits (66), Expect = 2.4 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXG 529 G GGG G GG G G G G GGG G GG G Sbjct: 32 GWSSGGGGGGYSGGYSGGHG----GGGGYGGGGYGGGGYGGGGHGGG 74 Score = 29.1 bits (62), Expect = 7.4 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 8/61 (13%) Frame = -2 Query: 678 AXGGGXXGGGXG--------XXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGX 523 A G GGG G GGG G G G G GGG G GG GG Sbjct: 14 AHAGFLGGGGAGGSALSSGWSSGGGGGGYSGGYSGGHGG--GGGYGGGGYGGGGYGGGGH 71 Query: 522 G 520 G Sbjct: 72 G 72 >AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p protein. Length = 420 Score = 46.8 bits (106), Expect = 3e-05 Identities = 29/97 (29%), Positives = 32/97 (32%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXX 691 +G P PP PP P P P P P P P P P P P P P P + Sbjct: 222 YGPPPPPP--PPKPQPTPGYGPPTPPPGPGPAQP-APQPPRPQPPRPQPPRPQPGSEYLP 278 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXPFFFP 802 P P PPPP P P + P Sbjct: 279 PPGENEVTPTQP-QPTAPVPEYGPPPPAPPAGPTYQP 314 Score = 46.4 bits (105), Expect = 5e-05 Identities = 28/92 (30%), Positives = 28/92 (30%), Gaps = 5/92 (5%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXP-XXXXPXXPXXPPPXXPXPPP----XXPPPXAXX 685 P PP PP P P P P P P PPP P P P PPP Sbjct: 172 PQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPP 231 Query: 686 XXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P A P PP P P Sbjct: 232 KPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPP 263 Score = 45.6 bits (103), Expect = 8e-05 Identities = 25/86 (29%), Positives = 25/86 (29%), Gaps = 2/86 (2%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPP--PXPPPXXXXXXXXXXXXXX 698 P PPPP P P P P P P P P P P PPP Sbjct: 71 PQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPP 130 Query: 699 XXXXXXXPXQXXPXXPXXXPPPXPXP 776 P P PPP P P Sbjct: 131 PQPTPSAPAPPPSYGPPQTPPPRPPP 156 Score = 44.4 bits (100), Expect = 2e-04 Identities = 27/93 (29%), Positives = 28/93 (30%), Gaps = 3/93 (3%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXX 691 +G P P PP P P P P P P P P P P P PP Sbjct: 144 YGPPQTP---PPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPR 200 Query: 692 XXXXXXXXXXXP---XXPXXAXXXPPPPPPXXP 781 P P PPPPPP P Sbjct: 201 PTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKP 233 Score = 42.7 bits (96), Expect = 6e-04 Identities = 24/84 (28%), Positives = 24/84 (28%), Gaps = 1/84 (1%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXXXX 707 P P P P P P PP P P PPPP PPP Sbjct: 189 PEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGP 248 Query: 708 XXXXPXQXXP-XXPXXXPPPXPXP 776 P P P PP P P Sbjct: 249 GPAQPAPQPPRPQPPRPQPPRPQP 272 Score = 42.3 bits (95), Expect = 7e-04 Identities = 27/89 (30%), Positives = 27/89 (30%), Gaps = 2/89 (2%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP--XXPXPPPXXPPPXAXXXXX 694 P PP PP P P P P P P PPP P PP PPP Sbjct: 79 PPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPP------- 131 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P PPP PP P Sbjct: 132 --QPTPSAPAPPPSYGPPQTPPPRPPPQP 158 Score = 41.9 bits (94), Expect = 0.001 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P P PP PP P P P PP P PP PP Sbjct: 133 PTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQ--PQPPAPQPPSPPSPQPGPE 190 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXPXXPFFFP 802 P PPPPPP P + P Sbjct: 191 YLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGP 224 Score = 41.5 bits (93), Expect = 0.001 Identities = 27/96 (28%), Positives = 28/96 (29%), Gaps = 11/96 (11%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXX---PXXXXPXXPXXPPPXXPXP--------PPXXPPP 673 PP PP P P P P P P P P P P P PP PP Sbjct: 121 PPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQPP 180 Query: 674 XAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P + PPPPPP P Sbjct: 181 SPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRP 216 Score = 41.1 bits (92), Expect = 0.002 Identities = 26/86 (30%), Positives = 26/86 (30%), Gaps = 2/86 (2%) Frame = +3 Query: 525 PPXXXXP--PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXX 698 PP P PPP P P P P PP P P PPP P P Sbjct: 116 PPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPR-PPPQPTPSAPAPSYGPPQPQP 174 Query: 699 XXXXXXXPXQXXPXXPXXXPPPXPXP 776 P P P PP P P Sbjct: 175 PAPQPPSPPSPQP-GPEYLPPDQPKP 199 Score = 41.1 bits (92), Expect = 0.002 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PP P PP P P P P P P P PPPP P Sbjct: 174 PPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRP 216 Score = 40.7 bits (91), Expect = 0.002 Identities = 28/102 (27%), Positives = 29/102 (28%), Gaps = 8/102 (7%) Frame = +2 Query: 521 PXPPXXXPPXPXP-----PPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXX 685 P PP PP P P PP P P P PPP P P P Sbjct: 260 PQPPRPQPPRPQPGSEYLPPPGENEVTPTQPQPTAPVPEYGPPPPAPPAGPTYQPRPPAP 319 Query: 686 XXXXXXXXXXXXXPXXPXXA---XXXPPPPPPXXPXXPFFFP 802 P P A P PP P P P + P Sbjct: 320 PAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPPAPTYQP 361 Score = 39.9 bits (89), Expect = 0.004 Identities = 25/92 (27%), Positives = 26/92 (28%), Gaps = 2/92 (2%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPPXXXXXXXP--XXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXX 685 +G P PP P P P P P P P P P P PPP PP Sbjct: 93 YGPPQTQPPRPP-PQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPP 151 Query: 686 XXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P P PP P Sbjct: 152 PRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPP 183 Score = 39.9 bits (89), Expect = 0.004 Identities = 23/83 (27%), Positives = 23/83 (27%), Gaps = 1/83 (1%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP-PPXXXXXXXXXXXXXXX 701 PP PP P P P PP P P P PP P PP Sbjct: 224 PPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPPRPQPGSEYLPPPGEN 283 Query: 702 XXXXXXPXQXXPXXPXXXPPPXP 770 P P PPP P Sbjct: 284 EVTPTQPQPTAPVPEYGPPPPAP 306 Score = 39.5 bits (88), Expect = 0.005 Identities = 24/80 (30%), Positives = 24/80 (30%), Gaps = 2/80 (2%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPP--PXPPPXXXXXXXXXXXXXXXXXXXX 716 P PP P P P P PP P P P P P PPP Sbjct: 172 PQPPAPQP-PSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPP 230 Query: 717 XPXQXXPXXPXXXPPPXPXP 776 Q P PPP P P Sbjct: 231 PKPQPTPGYGPPTPPPGPGP 250 Score = 39.5 bits (88), Expect = 0.005 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P PPPP P P P P P P P PP PPP Sbjct: 203 PSRPQPPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPP 246 Score = 38.3 bits (85), Expect = 0.012 Identities = 22/79 (27%), Positives = 22/79 (27%), Gaps = 2/79 (2%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP--PXXXXXXXXXXXXXXXXXXXXX 719 P P P PP PP P P PP P P P Sbjct: 57 PGPAPSAPAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPP 116 Query: 720 PXQXXPXXPXXXPPPXPXP 776 P P P PPP P P Sbjct: 117 PSYGPPQTPPPRPPPQPTP 135 Score = 37.1 bits (82), Expect = 0.028 Identities = 22/82 (26%), Positives = 22/82 (26%), Gaps = 1/82 (1%) Frame = +2 Query: 530 PXXXPPXPXPP-PXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXX 706 P PP P PP P P P P P P P PPP Sbjct: 165 PSYGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGP 224 Query: 707 XXXXXXPXXPXXAXXXPPPPPP 772 P PP PPP Sbjct: 225 PPPPPPPKPQPTPGYGPPTPPP 246 Score = 36.3 bits (80), Expect = 0.049 Identities = 24/87 (27%), Positives = 24/87 (27%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P PP PP PPP P P P PP P PPP P Sbjct: 114 PPPPSYGPPQT-PPPRPPPQPTPSAPAPPPSYGPPQTPP--PRPPPQPTPSAPAPSYGPP 170 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P P PP P Sbjct: 171 QPQPPAPQPPSPPSPQPGPEYLPPDQP 197 Score = 34.7 bits (76), Expect = 0.15 Identities = 24/89 (26%), Positives = 25/89 (28%), Gaps = 6/89 (6%) Frame = +2 Query: 542 PPXPXPPPXXXXXXXPXX----PXXXXPXXPXXPPPXXPXPPPX--XPPPXAXXXXXXXX 703 P P PPP P P PP P PPP P P A Sbjct: 37 PSVPFPPPGSGNGIEDSGIGPGPAPSAPAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPP 96 Query: 704 XXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P + PPPP P P Sbjct: 97 QTQPPRPPPQPTPSAPAPPPPSYGPPQTP 125 Score = 33.1 bits (72), Expect = 0.46 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP PP P P P P P P P P P PPP Sbjct: 346 PRPPS--PPAPPAPTYQPQPPAPPAPAPGPTYQPRPPAPPAPTPEYGPPPP 394 Score = 32.7 bits (71), Expect = 0.60 Identities = 23/86 (26%), Positives = 23/86 (26%), Gaps = 5/86 (5%) Frame = +2 Query: 530 PXXXPPXPXP---PP--XXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 P P P P PP P P P PP P PP P P A Sbjct: 57 PGPAPSAPAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPP 116 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPP 772 P P P PPP Sbjct: 117 PSYGPPQTPPPRPPPQPTPSAPAPPP 142 Score = 32.7 bits (71), Expect = 0.60 Identities = 24/89 (26%), Positives = 24/89 (26%), Gaps = 5/89 (5%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P P P P PPP P P PPP P P P PP Sbjct: 199 PRPTPSRPQPPPPPPPRPQPTPGYGP-------PPPPPPPKPQPTPGYGPPTPPPGPGPA 251 Query: 701 XXXXXXXXPXXPXXAXXXPPP-----PPP 772 P P P P PPP Sbjct: 252 QPAPQPPRPQPPRPQPPRPQPGSEYLPPP 280 Score = 31.5 bits (68), Expect = 1.4 Identities = 22/90 (24%), Positives = 23/90 (25%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXX 691 +G P P P P P P P P P P P P P P A Sbjct: 299 YGPPPPAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAPPAPAP-GPTYQPRPPSPPAPPAP 357 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P PP PP P Sbjct: 358 TYQPQPPAPPAPAPGPTYQPRPPAPPAPTP 387 Score = 31.1 bits (67), Expect = 1.8 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P PP P P P P P P P PP PP Sbjct: 326 PTYQPRPPAPPAPAPGPTYQPRPPSPPAPPAPTYQPQPPAPP 367 Score = 29.9 bits (64), Expect = 4.3 Identities = 21/83 (25%), Positives = 21/83 (25%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P P P P P P P P P P P P P P A Sbjct: 316 PPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPPAPTYQPQPPAPPA----PAP 371 Query: 701 XXXXXXXXPXXPXXAXXXPPPPP 769 P P PPPP Sbjct: 372 GPTYQPRPPAPPAPTPEYGPPPP 394 >AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA protein. Length = 420 Score = 46.8 bits (106), Expect = 3e-05 Identities = 29/97 (29%), Positives = 32/97 (32%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXX 691 +G P PP PP P P P P P P P P P P P P P P + Sbjct: 222 YGPPPPPP--PPKPQPTPGYGPPTPPPGPGPAQP-APQPPRPQPPRPQPPRPQPGSEYLP 278 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXPFFFP 802 P P PPPP P P + P Sbjct: 279 PPGENEVTPTQP-QPTAPVPEYGPPPPAPPAGPTYQP 314 Score = 46.4 bits (105), Expect = 5e-05 Identities = 28/92 (30%), Positives = 28/92 (30%), Gaps = 5/92 (5%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXP-XXXXPXXPXXPPPXXPXPPP----XXPPPXAXX 685 P PP PP P P P P P P PPP P P P PPP Sbjct: 172 PQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPP 231 Query: 686 XXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P A P PP P P Sbjct: 232 KPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPP 263 Score = 45.6 bits (103), Expect = 8e-05 Identities = 25/86 (29%), Positives = 25/86 (29%), Gaps = 2/86 (2%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPP--PXPPPXXXXXXXXXXXXXX 698 P PPPP P P P P P P P P P P PPP Sbjct: 71 PQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPP 130 Query: 699 XXXXXXXPXQXXPXXPXXXPPPXPXP 776 P P PPP P P Sbjct: 131 PQPTPSAPAPPPSYGPPQTPPPRPPP 156 Score = 44.4 bits (100), Expect = 2e-04 Identities = 27/93 (29%), Positives = 28/93 (30%), Gaps = 3/93 (3%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXX 691 +G P P PP P P P P P P P P P P P PP Sbjct: 144 YGPPQTP---PPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPR 200 Query: 692 XXXXXXXXXXXP---XXPXXAXXXPPPPPPXXP 781 P P PPPPPP P Sbjct: 201 PTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKP 233 Score = 42.7 bits (96), Expect = 6e-04 Identities = 24/84 (28%), Positives = 24/84 (28%), Gaps = 1/84 (1%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXXXX 707 P P P P P P PP P P PPPP PPP Sbjct: 189 PEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGP 248 Query: 708 XXXXPXQXXP-XXPXXXPPPXPXP 776 P P P PP P P Sbjct: 249 GPAQPAPQPPRPQPPRPQPPRPQP 272 Score = 42.3 bits (95), Expect = 7e-04 Identities = 27/89 (30%), Positives = 27/89 (30%), Gaps = 2/89 (2%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP--XXPXPPPXXPPPXAXXXXX 694 P PP PP P P P P P P PPP P PP PPP Sbjct: 79 PPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPP------- 131 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P PPP PP P Sbjct: 132 --QPTPSAPAPPPSYGPPQTPPPRPPPQP 158 Score = 41.9 bits (94), Expect = 0.001 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P P PP PP P P P PP P PP PP Sbjct: 133 PTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQ--PQPPAPQPPSPPSPQPGPE 190 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXPXXPFFFP 802 P PPPPPP P + P Sbjct: 191 YLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGP 224 Score = 41.5 bits (93), Expect = 0.001 Identities = 27/96 (28%), Positives = 28/96 (29%), Gaps = 11/96 (11%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXX---PXXXXPXXPXXPPPXXPXP--------PPXXPPP 673 PP PP P P P P P P P P P P P PP PP Sbjct: 121 PPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQPP 180 Query: 674 XAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P + PPPPPP P Sbjct: 181 SPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRP 216 Score = 41.1 bits (92), Expect = 0.002 Identities = 26/86 (30%), Positives = 26/86 (30%), Gaps = 2/86 (2%) Frame = +3 Query: 525 PPXXXXP--PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXX 698 PP P PPP P P P P PP P P PPP P P Sbjct: 116 PPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPR-PPPQPTPSAPAPSYGPPQPQP 174 Query: 699 XXXXXXXPXQXXPXXPXXXPPPXPXP 776 P P P PP P P Sbjct: 175 PAPQPPSPPSPQP-GPEYLPPDQPKP 199 Score = 41.1 bits (92), Expect = 0.002 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PP P PP P P P P P P P PPPP P Sbjct: 174 PPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRP 216 Score = 40.7 bits (91), Expect = 0.002 Identities = 28/102 (27%), Positives = 29/102 (28%), Gaps = 8/102 (7%) Frame = +2 Query: 521 PXPPXXXPPXPXP-----PPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXX 685 P PP PP P P PP P P P PPP P P P Sbjct: 260 PQPPRPQPPRPQPGSEYLPPPGENEVTPTQPQPTAPVPEYGPPPPAPPAGPTYQPRPPAP 319 Query: 686 XXXXXXXXXXXXXPXXPXXA---XXXPPPPPPXXPXXPFFFP 802 P P A P PP P P P + P Sbjct: 320 PAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPPAPTYQP 361 Score = 39.9 bits (89), Expect = 0.004 Identities = 25/92 (27%), Positives = 26/92 (28%), Gaps = 2/92 (2%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPPXXXXXXXP--XXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXX 685 +G P PP P P P P P P P P P P PPP PP Sbjct: 93 YGPPQTQPPRPP-PQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPP 151 Query: 686 XXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P P PP P Sbjct: 152 PRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPP 183 Score = 39.9 bits (89), Expect = 0.004 Identities = 23/83 (27%), Positives = 23/83 (27%), Gaps = 1/83 (1%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP-PPXXXXXXXXXXXXXXX 701 PP PP P P P PP P P P PP P PP Sbjct: 224 PPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPPRPQPGSEYLPPPGEN 283 Query: 702 XXXXXXPXQXXPXXPXXXPPPXP 770 P P PPP P Sbjct: 284 EVTPTQPQPTAPVPEYGPPPPAP 306 Score = 39.5 bits (88), Expect = 0.005 Identities = 24/80 (30%), Positives = 24/80 (30%), Gaps = 2/80 (2%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPP--PXPPPXXXXXXXXXXXXXXXXXXXX 716 P PP P P P P PP P P P P P PPP Sbjct: 172 PQPPAPQP-PSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPP 230 Query: 717 XPXQXXPXXPXXXPPPXPXP 776 Q P PPP P P Sbjct: 231 PKPQPTPGYGPPTPPPGPGP 250 Score = 39.5 bits (88), Expect = 0.005 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P PPPP P P P P P P P PP PPP Sbjct: 203 PSRPQPPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPP 246 Score = 38.3 bits (85), Expect = 0.012 Identities = 22/79 (27%), Positives = 22/79 (27%), Gaps = 2/79 (2%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP--PXXXXXXXXXXXXXXXXXXXXX 719 P P P PP PP P P PP P P P Sbjct: 57 PGPAPSAPAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPP 116 Query: 720 PXQXXPXXPXXXPPPXPXP 776 P P P PPP P P Sbjct: 117 PSYGPPQTPPPRPPPQPTP 135 Score = 37.1 bits (82), Expect = 0.028 Identities = 22/82 (26%), Positives = 22/82 (26%), Gaps = 1/82 (1%) Frame = +2 Query: 530 PXXXPPXPXPP-PXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXX 706 P PP P PP P P P P P P P PPP Sbjct: 165 PSYGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGP 224 Query: 707 XXXXXXPXXPXXAXXXPPPPPP 772 P PP PPP Sbjct: 225 PPPPPPPKPQPTPGYGPPTPPP 246 Score = 36.3 bits (80), Expect = 0.049 Identities = 24/87 (27%), Positives = 24/87 (27%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P PP PP PPP P P P PP P PPP P Sbjct: 114 PPPPSYGPPQT-PPPRPPPQPTPSAPAPPPSYGPPQTPP--PRPPPQPTPSAPAPSYGPP 170 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P P PP P Sbjct: 171 QPQPPAPQPPSPPSPQPGPEYLPPDQP 197 Score = 34.7 bits (76), Expect = 0.15 Identities = 24/89 (26%), Positives = 25/89 (28%), Gaps = 6/89 (6%) Frame = +2 Query: 542 PPXPXPPPXXXXXXXPXX----PXXXXPXXPXXPPPXXPXPPPX--XPPPXAXXXXXXXX 703 P P PPP P P PP P PPP P P A Sbjct: 37 PSVPFPPPGSGNGIEDSGIGPGPAPSAPAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPP 96 Query: 704 XXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P + PPPP P P Sbjct: 97 QTQPPRPPPQPTPSAPAPPPPSYGPPQTP 125 Score = 33.1 bits (72), Expect = 0.46 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP PP P P P P P P P P P PPP Sbjct: 346 PRPPS--PPAPPAPTYQPQPPAPPAPAPGPTYQPRPPAPPAPTPEYGPPPP 394 Score = 32.7 bits (71), Expect = 0.60 Identities = 23/86 (26%), Positives = 23/86 (26%), Gaps = 5/86 (5%) Frame = +2 Query: 530 PXXXPPXPXP---PP--XXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 P P P P PP P P P PP P PP P P A Sbjct: 57 PGPAPSAPAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPP 116 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPP 772 P P P PPP Sbjct: 117 PSYGPPQTPPPRPPPQPTPSAPAPPP 142 Score = 32.7 bits (71), Expect = 0.60 Identities = 24/89 (26%), Positives = 24/89 (26%), Gaps = 5/89 (5%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P P P P PPP P P PPP P P P PP Sbjct: 199 PRPTPSRPQPPPPPPPRPQPTPGYGP-------PPPPPPPKPQPTPGYGPPTPPPGPGPA 251 Query: 701 XXXXXXXXPXXPXXAXXXPPP-----PPP 772 P P P P PPP Sbjct: 252 QPAPQPPRPQPPRPQPPRPQPGSEYLPPP 280 Score = 31.5 bits (68), Expect = 1.4 Identities = 22/90 (24%), Positives = 23/90 (25%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXX 691 +G P P P P P P P P P P P P P P A Sbjct: 299 YGPPPPAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAPPAPAP-GPTYQPRPPSPPAPPAP 357 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P PP PP P Sbjct: 358 TYQPQPPAPPAPAPGPTYQPRPPAPPAPTP 387 Score = 31.1 bits (67), Expect = 1.8 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P PP P P P P P P P PP PP Sbjct: 326 PTYQPRPPAPPAPAPGPTYQPRPPSPPAPPAPTYQPQPPAPP 367 Score = 29.9 bits (64), Expect = 4.3 Identities = 21/83 (25%), Positives = 21/83 (25%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P P P P P P P P P P P P P P A Sbjct: 316 PPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPPAPTYQPQPPAPPA----PAP 371 Query: 701 XXXXXXXXPXXPXXAXXXPPPPP 769 P P PPPP Sbjct: 372 GPTYQPRPPAPPAPTPEYGPPPP 394 >DQ539309-1|ABG02830.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539308-1|ABG02829.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539307-1|ABG02828.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539306-1|ABG02827.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539305-1|ABG02826.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539304-1|ABG02825.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539303-1|ABG02824.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539302-1|ABG02823.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539301-1|ABG02822.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539300-1|ABG02821.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539299-1|ABG02820.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539298-1|ABG02819.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539297-1|ABG02818.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539296-1|ABG02817.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539295-1|ABG02816.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539294-1|ABG02815.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539293-1|ABG02814.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539292-1|ABG02813.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539291-1|ABG02812.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539290-1|ABG02811.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539289-1|ABG02810.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539288-1|ABG02809.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539287-1|ABG02808.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539286-1|ABG02807.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539285-1|ABG02806.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539284-1|ABG02805.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539283-1|ABG02804.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539282-1|ABG02803.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >DQ539281-1|ABG02802.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >BT030113-1|ABN49252.1| 342|Drosophila melanogaster IP06991p protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >BT011144-1|AAR82812.1| 356|Drosophila melanogaster GH24939p protein. Length = 356 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 186 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 245 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 246 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 275 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 256 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 310 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 311 -GIGPAVSLGGGPGGGGSYGGGYG 333 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 149 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 208 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 209 SGSSASSSVGVIGGGHGGGGHGGGGFG 235 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 65 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 124 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 125 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 159 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 237 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 283 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 118 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 173 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 174 GGGPGF------GGGIGGGGGHSGGGG 194 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 106 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 164 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 165 GHSGGGSGIGGGPGFGGGIGGGGG 188 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 227 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 286 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 287 GGGGGFKGGYGGGGGGGGGGGGG 309 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 31 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 90 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 91 DLGLGGGGVGGGPFAGGHAGGGVISGGG 118 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 197 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 256 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 257 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 290 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 297 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 334 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 28 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 82 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 298 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 335 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 32 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 91 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 92 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 131 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 218 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 274 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 275 FGGGLSHKHKGHGGGGGFKGGYGGGGG 301 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 222 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 272 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 273 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 302 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 59 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 102 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 63 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 107 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 302 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 337 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 56 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 96 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 63 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 111 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 37 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 80 >BT001738-1|AAN71493.1| 331|Drosophila melanogaster RE72617p protein. Length = 331 Score = 46.4 bits (105), Expect = 5e-05 Identities = 33/91 (36%), Positives = 34/91 (37%) Frame = -2 Query: 792 KGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXX 613 +G G GGGGGG G G GGG GGG G GGG G Sbjct: 9 RGGGGGGGGGGGGFRGRGGGGGG-----------------GGGGFGGGRGRGGGGDRGGR 51 Query: 612 GXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G GGG G GG GG G Sbjct: 52 GGFGGGR-GAFGGRGGGGGRGGGGRGGGGRG 81 Score = 39.5 bits (88), Expect = 0.005 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GG GGGG G G G GG G G G GGGG Sbjct: 10 GGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGG 46 Score = 39.1 bits (87), Expect = 0.007 Identities = 24/78 (30%), Positives = 24/78 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GGG G G G GG GGG G GG Sbjct: 11 GGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGAFGGRGGGGGR 70 Query: 595 XXGGXXXXGXGXGXGGGG 542 GG G G G GGG Sbjct: 71 GGGGRGGGGRGGGGRGGG 88 Score = 38.7 bits (86), Expect = 0.009 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = -1 Query: 655 GGGXGGGGXGXGXXG-GXXXXXXGGXXXXGXGXGXGG--GGXXXXGG 524 GGG GGGG G G G G GG G G G GG GG GG Sbjct: 10 GGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGG 56 Score = 37.9 bits (84), Expect = 0.016 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGGG G G A GG GGG G G G G G Sbjct: 26 GGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGR 85 Query: 600 XGXXG 586 G G Sbjct: 86 GGGAG 90 Score = 36.7 bits (81), Expect = 0.037 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGG-XXXXGXGXGXGGGGXXXXGG 524 GGG GG G G G GG GG G G GGGG GG Sbjct: 30 GGGGGGFGGGRGRGGGGDRGGRGGFGGGRGAFGGRGGGGGRGGGG 74 Score = 36.3 bits (80), Expect = 0.049 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 GGG GGG G G GG GG G G GG G G Sbjct: 15 GGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGG 57 Score = 33.5 bits (73), Expect = 0.35 Identities = 22/64 (34%), Positives = 22/64 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GGG G G G G GGG GGGG G G GG Sbjct: 33 GGGFGGGRGRGGGGDR-GGRGGFGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGGGAGG 91 Query: 595 XXGG 584 GG Sbjct: 92 FKGG 95 Score = 32.3 bits (70), Expect = 0.80 Identities = 20/69 (28%), Positives = 20/69 (28%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GGG G G GGG GGGG G G GG Sbjct: 27 GGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRG 86 Query: 595 XXGGXXXXG 569 G G Sbjct: 87 GGAGGFKGG 95 >AE014134-1932|AAF52992.1| 342|Drosophila melanogaster CG17108-PA protein. Length = 342 Score = 46.4 bits (105), Expect = 5e-05 Identities = 29/90 (32%), Positives = 31/90 (34%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G + G G GGG GGGG G G GG Sbjct: 172 GGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFG 231 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG G G G GG G GG +F Sbjct: 232 PGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G G GGG GG G GGG G G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGY----- 296 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 297 -GIGPAVSLGGGPGGGGSYGGGYG 319 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G G GGG G G GGG GG G GGG G Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGG 194 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 195 SGSSASSSVGVIGGGHGGGGHGGGGFG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX---AXGGGXXGGGXGXXGG 631 GK G G G G GG G G A GG GGG GG Sbjct: 51 GKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGG 110 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G G G G GG GG G Sbjct: 111 GFGGGPGFGSGGHSG--GGIGDGPGFGSGGYSGGGGG 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG GGGG G G GG GG G G G G GG GG K+ Sbjct: 223 GGGGGGGFGPGG-GGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Score = 39.5 bits (88), Expect = 0.005 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG GGG G GGG G Sbjct: 104 GHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFG----SGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GG GG G Sbjct: 160 GGGPGF------GGGIGGGGGHSGGGG 180 Score = 39.1 bits (87), Expect = 0.007 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GG + G G G GGG G G G GG G G G Sbjct: 92 GGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGI-GDGPGFGSGGYSGGGGGIGGGG 150 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G GG GG G Sbjct: 151 GHSGGGSGIGGGPGFGGGIGGGGG 174 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G GGG GGG G G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G G GGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGG 295 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG G G G G G G G G G Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGG 76 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G GG G G GG Sbjct: 77 DLGLGGGGVGGGPFAGGHAGGGVISGGG 104 Score = 36.3 bits (80), Expect = 0.049 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GG G + G GGG G G G G G Sbjct: 183 GGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIG 242 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG G Sbjct: 243 GGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G GG G G G GG Sbjct: 283 GGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG GGG G GG G G GGG G GG GG G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLG 68 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGG 545 GGG GGGG G G G GG G G G GGG Sbjct: 284 GGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 10/100 (10%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXX------GCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGG 631 G G GGGGGG A G G G G G GG G G Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 630 ---GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 78 LGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPG 117 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGG GG G G G G GGG G G G G G Sbjct: 204 GVIGGGHGG---GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGH 260 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G G GG G Sbjct: 261 FGGGLSHKHKGHGGGGGFKGGYGGGGG 287 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGGG G G G G GGG G G G G Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPGGG---------GFGPGIGGGGGGFGPGIGGGSGG 258 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG GG GG G Sbjct: 259 GHFGGGLSHKHKGHGGGGGFKGGYGGGGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G G G G G G GG GG Sbjct: 45 GGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGG 88 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GGG G G G G G G GG GG GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGG 93 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G G G Sbjct: 288 GGGGGGGGYGIG-PAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGG G G GG G G G G G GG GG Sbjct: 42 GAIGGGDGGGKLGGGYGSGGHGSGGLGSG-GFGSGGDLGLGG 82 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G G G G G G G GG Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHAGG 97 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXG 527 GGG GGG G GG G G G G GG G Sbjct: 23 GGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 >U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 4/48 (8%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXG----XGXGGGGXXXXGG 524 GGG GGGG G G GG GG G G G GGGG GG Sbjct: 212 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGG 259 Score = 39.5 bits (88), Expect = 0.005 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -2 Query: 672 GGGXXGGGXGXXG-GGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXG 529 GGG GGG G G GG G G G G GGG G GG G Sbjct: 212 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGG 260 Score = 39.1 bits (87), Expect = 0.007 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGG G GG GG G G G GGGG Sbjct: 237 GGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGG 274 Score = 37.9 bits (84), Expect = 0.016 Identities = 33/99 (33%), Positives = 34/99 (34%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGGG G G G GGG GGG GGG G G Sbjct: 212 GGGGGGGGGGRGGFGGRRG------------GGGGGGGGGGGGGRFDRGGGGGGNGG--- 256 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXGXPKIFXXKXSNF 484 G G GGG G GG G K +NF Sbjct: 257 -GGGGRYDRGGGGGGGGGGGNVQPRDGDWKCNSCNNTNF 294 Score = 34.7 bits (76), Expect(2) = 8e-05 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GG G GGG G G G G GG GG G Sbjct: 315 GGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGG 365 Score = 32.7 bits (71), Expect = 0.60 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 677 RXGGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGG 540 R GGG GGG G G GG G G GG GG Sbjct: 228 RRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGG 273 Score = 31.5 bits (68), Expect = 1.4 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG GGGG G G GG G GGG GG F Sbjct: 320 GGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRF 369 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -3 Query: 677 RXGGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 + GGG GGG G G G GG G G GG G GG Sbjct: 211 KGGGGG-GGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGG 260 Score = 30.7 bits (66), Expect = 2.4 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXG-XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GGG G G G GG GG GG G Sbjct: 312 GSSGGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGG 363 Score = 30.7 bits (66), Expect = 2.4 Identities = 24/85 (28%), Positives = 25/85 (29%), Gaps = 1/85 (1%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWX-GXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXX 599 G G GGG G G + G GGG GGGG G Sbjct: 315 GGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNG 374 Query: 598 XXXGGXXXXGXGXGXGGGGXXXXGG 524 GG G G GG GG Sbjct: 375 GGRGG-RGGGGGNRRDGGPMRNDGG 398 Score = 30.3 bits (65), Expect(2) = 8e-05 Identities = 17/50 (34%), Positives = 19/50 (38%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGG 652 G ++G G GGGGGG G G G GGG GG Sbjct: 226 GGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGGG 275 Score = 30.3 bits (65), Expect = 3.2 Identities = 22/87 (25%), Positives = 22/87 (25%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGGG G G G G G GGG G Sbjct: 312 GSSGGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFND 371 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GG GG G Sbjct: 372 NNGGGRGGRGGGGGNRRDGGPMRNDGG 398 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 666 GXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG G G G G G G GG G Sbjct: 56 GSGGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGG 104 Score = 29.9 bits (64), Expect = 4.3 Identities = 20/61 (32%), Positives = 21/61 (34%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G + G G GGGGGG G G GGG G G GGG Sbjct: 220 GGRGGFGGRRGGGGGG-----GGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGG 274 Query: 621 G 619 G Sbjct: 275 G 275 Score = 28.7 bits (61), Expect = 9.8 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKI 508 G G GGG GG G GGG G GG G G I Sbjct: 61 GNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGGGGGGSGGNDMI 115 >L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 4/48 (8%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXG----XGXGGGGXXXXGG 524 GGG GGGG G G GG GG G G G GGGG GG Sbjct: 212 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGG 259 Score = 39.5 bits (88), Expect = 0.005 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -2 Query: 672 GGGXXGGGXGXXG-GGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXG 529 GGG GGG G G GG G G G G GGG G GG G Sbjct: 212 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGG 260 Score = 39.1 bits (87), Expect = 0.007 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGG G GG GG G G G GGGG Sbjct: 237 GGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGG 274 Score = 37.9 bits (84), Expect = 0.016 Identities = 33/99 (33%), Positives = 34/99 (34%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGGG G G G GGG GGG GGG G G Sbjct: 212 GGGGGGGGGGRGGFGGRRG------------GGGGGGGGGGGGGRFDRGGGGGGNGG--- 256 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXGXPKIFXXKXSNF 484 G G GGG G GG G K +NF Sbjct: 257 -GGGGRYDRGGGGGGGGGGGNVQPRDGDWKCNSCNNTNF 294 Score = 34.7 bits (76), Expect(2) = 8e-05 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GG G GGG G G G G GG GG G Sbjct: 315 GGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGG 365 Score = 32.7 bits (71), Expect = 0.60 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 677 RXGGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGG 540 R GGG GGG G G GG G G GG GG Sbjct: 228 RRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGG 273 Score = 31.5 bits (68), Expect = 1.4 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG GGGG G G GG G GGG GG F Sbjct: 320 GGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRF 369 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -3 Query: 677 RXGGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 + GGG GGG G G G GG G G GG G GG Sbjct: 211 KGGGGG-GGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGG 260 Score = 30.7 bits (66), Expect = 2.4 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXG-XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GGG G G G GG GG GG G Sbjct: 312 GSSGGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGG 363 Score = 30.7 bits (66), Expect = 2.4 Identities = 24/85 (28%), Positives = 25/85 (29%), Gaps = 1/85 (1%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWX-GXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXX 599 G G GGG G G + G GGG GGGG G Sbjct: 315 GGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNG 374 Query: 598 XXXGGXXXXGXGXGXGGGGXXXXGG 524 GG G G GG GG Sbjct: 375 GGRGG-RGGGGGNRRDGGPMRNDGG 398 Score = 30.3 bits (65), Expect(2) = 8e-05 Identities = 17/50 (34%), Positives = 19/50 (38%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGG 652 G ++G G GGGGGG G G G GGG GG Sbjct: 226 GGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGGG 275 Score = 30.3 bits (65), Expect = 3.2 Identities = 22/87 (25%), Positives = 22/87 (25%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGGG G G G G G GGG G Sbjct: 312 GSSGGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFND 371 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GG GG G Sbjct: 372 NNGGGRGGRGGGGGNRRDGGPMRNDGG 398 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 666 GXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG G G G G G G GG G Sbjct: 56 GSGGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGG 104 Score = 29.9 bits (64), Expect = 4.3 Identities = 20/61 (32%), Positives = 21/61 (34%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G + G G GGGGGG G G GGG G G GGG Sbjct: 220 GGRGGFGGRRGGGGGG-----GGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGG 274 Query: 621 G 619 G Sbjct: 275 G 275 Score = 28.7 bits (61), Expect = 9.8 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKI 508 G G GGG GG G GGG G GG G G I Sbjct: 61 GNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGGGGGGSGGNDMI 115 >M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protein protein. Length = 365 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 4/48 (8%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXG----XGXGGGGXXXXGG 524 GGG GGGG G G GG GG G G G GGGG GG Sbjct: 174 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGG 221 Score = 39.5 bits (88), Expect = 0.005 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -2 Query: 672 GGGXXGGGXGXXG-GGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXG 529 GGG GGG G G GG G G G G GGG G GG G Sbjct: 174 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGG 222 Score = 39.1 bits (87), Expect = 0.007 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGG G GG GG G G G GGGG Sbjct: 199 GGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGG 236 Score = 37.9 bits (84), Expect = 0.016 Identities = 33/99 (33%), Positives = 34/99 (34%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGGG G G G GGG GGG GGG G G Sbjct: 174 GGGGGGGGGGRGGFGGRRG------------GGGGGGGGGGGGGRFDRGGGGGGNGG--- 218 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXGXPKIFXXKXSNF 484 G G GGG G GG G K +NF Sbjct: 219 -GGGGRYDRGGGGGGGGGGGNVQPRDGEWKCNSCNNTNF 256 Score = 34.7 bits (76), Expect(2) = 8e-05 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GG G GGG G G G G GG GG G Sbjct: 277 GGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGG 327 Score = 32.7 bits (71), Expect = 0.60 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 677 RXGGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGG 540 R GGG GGG G G GG G G GG GG Sbjct: 190 RRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGG 235 Score = 31.5 bits (68), Expect = 1.4 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG GGGG G G GG G GGG GG F Sbjct: 282 GGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRF 331 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -3 Query: 677 RXGGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 + GGG GGG G G G GG G G GG G GG Sbjct: 173 KGGGGG-GGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGG 222 Score = 30.7 bits (66), Expect = 2.4 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXG-XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GGG G G G GG GG GG G Sbjct: 274 GSSGGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGG 325 Score = 30.3 bits (65), Expect(2) = 8e-05 Identities = 17/50 (34%), Positives = 19/50 (38%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGG 652 G ++G G GGGGGG G G G GGG GG Sbjct: 188 GGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGGG 237 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 666 GXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG G G G G G G GG G Sbjct: 18 GSGGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGG 66 Score = 29.9 bits (64), Expect = 4.3 Identities = 20/61 (32%), Positives = 21/61 (34%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G + G G GGGGGG G G GGG G G GGG Sbjct: 182 GGRGGFGGRRGGGGGG-----GGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGG 236 Query: 621 G 619 G Sbjct: 237 G 237 Score = 29.9 bits (64), Expect = 4.3 Identities = 21/75 (28%), Positives = 21/75 (28%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXXXX 590 G GG G G G GG GGG G G GG Sbjct: 274 GSSGGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFND 333 Query: 589 GGXXXXGXGXGXGGG 545 G G G GGG Sbjct: 334 NNGGGRG-GRGGGGG 347 Score = 28.7 bits (61), Expect = 9.8 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKI 508 G G GGG GG G GGG G GG G G I Sbjct: 23 GNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGGGGGGSGGNDMI 77 >BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p protein. Length = 286 Score = 45.6 bits (103), Expect = 8e-05 Identities = 27/76 (35%), Positives = 27/76 (35%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXXXX 590 G GGG G G G G GGG GGG G G GG Sbjct: 51 GFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGVGGGGGGGFGGGFGGGSGGGSGGGFG 110 Query: 589 GGXXXXGXGXGXGGGG 542 GG G G G GGGG Sbjct: 111 GGGSIGGFGGGGGGGG 126 Score = 44.4 bits (100), Expect = 2e-04 Identities = 32/94 (34%), Positives = 32/94 (34%), Gaps = 4/94 (4%) Frame = -2 Query: 789 GXXGXXGGG-GGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXX---GGGXX 622 G G GGG GGG G G G GG GGG G GGG Sbjct: 31 GSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGVGGGGG 90 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG GG G Sbjct: 91 GGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGG 124 Score = 43.6 bits (98), Expect = 3e-04 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GG G GGG G G G GGG G GG GG G Sbjct: 29 GGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGG 79 Score = 42.7 bits (96), Expect = 6e-04 Identities = 28/84 (33%), Positives = 29/84 (34%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGG + G G GG GGG G GG G G G Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGF--------GGGIGGGFGGGFGGGSGGGGFSSGGG 78 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 79 GGFSSGVGGGGGGGFGGGFGGGSG 102 Score = 42.7 bits (96), Expect = 6e-04 Identities = 32/97 (32%), Positives = 32/97 (32%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGG-GGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGX 625 G G G GGG GGG G G G GG G G GGG Sbjct: 31 GSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGVGGGGG 90 Query: 624 XGXXGXXXXGXXGXXXXXXXGGG--XGXGGXXXGGXG 520 G G G G GGG G GG GG G Sbjct: 91 GGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGG 127 Score = 41.9 bits (94), Expect = 0.001 Identities = 26/83 (31%), Positives = 26/83 (31%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G G G GG GGGG G G GG Sbjct: 45 GGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGVGGGGGGGFGGGFGGGSGGG 104 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G GGGG G Sbjct: 105 SGGGFGGGGSIGGFGGGGGGGGG 127 Score = 39.9 bits (89), Expect = 0.004 Identities = 30/92 (32%), Positives = 30/92 (32%), Gaps = 4/92 (4%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXXXX 590 G GGG G G G G GGG GGGG G GG Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGVG 86 Query: 589 GGXXXX---GXGXGXGGG-GXXXXGGXXXKNF 506 GG G G G GGG G GG F Sbjct: 87 GGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGF 118 Score = 36.3 bits (80), Expect = 0.049 Identities = 26/87 (29%), Positives = 27/87 (31%), Gaps = 3/87 (3%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXX---WXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGX 605 G G GGG G G + G G G GGGG G GG Sbjct: 41 GGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGVGGGGGGGFGGGFGGG 100 Query: 604 XXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG G G GGG GG Sbjct: 101 SGGGSGGGFGGGGSIGGFGGGGGGGGG 127 Score = 29.9 bits (64), Expect = 4.3 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Frame = -3 Query: 677 RXGGGXXGGGXGXXGXGXXXXGG--XXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 R GGG GG G G GG G G G G GG GG Sbjct: 25 RPGGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGG 77 >BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p protein. Length = 286 Score = 45.6 bits (103), Expect = 8e-05 Identities = 27/83 (32%), Positives = 27/83 (32%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G G G GGG GGGG G G GG Sbjct: 45 GGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGG 104 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G GGGG G Sbjct: 105 SGGGFGGGGSIGGFGGGGGGGGG 127 Score = 44.4 bits (100), Expect = 2e-04 Identities = 32/94 (34%), Positives = 32/94 (34%), Gaps = 4/94 (4%) Frame = -2 Query: 789 GXXGXXGGG-GGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXX---GGGXX 622 G G GGG GGG G G G GG GGG G GGG Sbjct: 31 GSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGG 90 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG GG G Sbjct: 91 GGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGG 124 Score = 43.6 bits (98), Expect = 3e-04 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GG G GGG G G G GGG G GG GG G Sbjct: 29 GGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGG 79 Score = 42.7 bits (96), Expect = 6e-04 Identities = 28/84 (33%), Positives = 29/84 (34%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGG + G G GG GGG G GG G G G Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGF--------GGGIGGGFGGGFGGGSGGGGFSSGGG 78 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 79 GGFSSGGGGGGGGGFGGGFGGGSG 102 Score = 42.7 bits (96), Expect = 6e-04 Identities = 32/97 (32%), Positives = 32/97 (32%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGG-GGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGX 625 G G G GGG GGG G G G GG G G GGG Sbjct: 31 GSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGG 90 Query: 624 XGXXGXXXXGXXGXXXXXXXGGG--XGXGGXXXGGXG 520 G G G G GGG G GG GG G Sbjct: 91 GGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGG 127 Score = 39.9 bits (89), Expect = 0.004 Identities = 30/92 (32%), Positives = 30/92 (32%), Gaps = 4/92 (4%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXXXX 590 G GGG G G G G GGG GGGG G GG Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGG 86 Query: 589 GGXXXX---GXGXGXGGG-GXXXXGGXXXKNF 506 GG G G G GGG G GG F Sbjct: 87 GGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGF 118 Score = 39.9 bits (89), Expect = 0.004 Identities = 27/87 (31%), Positives = 28/87 (32%), Gaps = 3/87 (3%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXX---WXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGX 605 G G GGG G G + G GGG GGGG G GG Sbjct: 41 GGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGG 100 Query: 604 XXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG G G GGG GG Sbjct: 101 SGGGSGGGFGGGGSIGGFGGGGGGGGG 127 Score = 29.9 bits (64), Expect = 4.3 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Frame = -3 Query: 677 RXGGGXXGGGXGXXGXGXXXXGG--XXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 R GGG GG G G GG G G G G GG GG Sbjct: 25 RPGGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGG 77 >AJ271041-1|CAB66004.1| 286|Drosophila melanogaster Gly-rich protein protein. Length = 286 Score = 45.6 bits (103), Expect = 8e-05 Identities = 27/76 (35%), Positives = 27/76 (35%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXXXX 590 G GGG G G G G GGG GGG G G GG Sbjct: 51 GFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFG 110 Query: 589 GGXXXXGXGXGXGGGG 542 GG G G G GGGG Sbjct: 111 GGGSIGGFGGGGGGGG 126 Score = 44.4 bits (100), Expect = 2e-04 Identities = 32/94 (34%), Positives = 32/94 (34%), Gaps = 4/94 (4%) Frame = -2 Query: 789 GXXGXXGGG-GGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXX---GGGXX 622 G G GGG GGG G G G GG GGG G GGG Sbjct: 31 GSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGG 90 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG GG G Sbjct: 91 GGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGG 124 Score = 43.6 bits (98), Expect = 3e-04 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GG G GGG G G G GGG G GG GG G Sbjct: 29 GGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGG 79 Score = 42.7 bits (96), Expect = 6e-04 Identities = 28/84 (33%), Positives = 29/84 (34%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGG + G G GG GGG G GG G G G Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGF--------GGGIGGGFGGGFGGGSGGGGFSSGGG 78 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 79 GGFSSGGGGGGGGGFGGGFGGGSG 102 Score = 39.9 bits (89), Expect = 0.004 Identities = 30/92 (32%), Positives = 30/92 (32%), Gaps = 4/92 (4%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXXXX 590 G GGG G G G G GGG GGGG G GG Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGG 86 Query: 589 GGXXXX---GXGXGXGGG-GXXXXGGXXXKNF 506 GG G G G GGG G GG F Sbjct: 87 GGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGF 118 Score = 29.9 bits (64), Expect = 4.3 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Frame = -3 Query: 677 RXGGGXXGGGXGXXGXGXXXXGG--XXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 R GGG GG G G GG G G G G GG GG Sbjct: 25 RPGGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGG 77 >AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA protein. Length = 286 Score = 45.6 bits (103), Expect = 8e-05 Identities = 27/83 (32%), Positives = 27/83 (32%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GG G G G GGG GGGG G G GG Sbjct: 45 GGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGG 104 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 GG G G GGGG G Sbjct: 105 SGGGFGGGGSIGGFGGGGGGGGG 127 Score = 44.4 bits (100), Expect = 2e-04 Identities = 32/94 (34%), Positives = 32/94 (34%), Gaps = 4/94 (4%) Frame = -2 Query: 789 GXXGXXGGG-GGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXX---GGGXX 622 G G GGG GGG G G G GG GGG G GGG Sbjct: 31 GSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGG 90 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG GG GG G Sbjct: 91 GGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGG 124 Score = 43.6 bits (98), Expect = 3e-04 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GG G GGG G G G GGG G GG GG G Sbjct: 29 GGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGG 79 Score = 42.7 bits (96), Expect = 6e-04 Identities = 28/84 (33%), Positives = 29/84 (34%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGG + G G GG GGG G GG G G G Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGF--------GGGIGGGFGGGFGGGSGGGGFSSGGG 78 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 79 GGFSSGGGGGGGGGFGGGFGGGSG 102 Score = 42.7 bits (96), Expect = 6e-04 Identities = 32/97 (32%), Positives = 32/97 (32%), Gaps = 3/97 (3%) Frame = -2 Query: 801 GKKKGXXGXXGGG-GGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGX 625 G G G GGG GGG G G G GG G G GGG Sbjct: 31 GSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGG 90 Query: 624 XGXXGXXXXGXXGXXXXXXXGGG--XGXGGXXXGGXG 520 G G G G GGG G GG GG G Sbjct: 91 GGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGG 127 Score = 39.9 bits (89), Expect = 0.004 Identities = 30/92 (32%), Positives = 30/92 (32%), Gaps = 4/92 (4%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXXXX 590 G GGG G G G G GGG GGGG G GG Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGG 86 Query: 589 GGXXXX---GXGXGXGGG-GXXXXGGXXXKNF 506 GG G G G GGG G GG F Sbjct: 87 GGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGF 118 Score = 39.9 bits (89), Expect = 0.004 Identities = 27/87 (31%), Positives = 28/87 (32%), Gaps = 3/87 (3%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXX---WXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGX 605 G G GGG G G + G GGG GGGG G GG Sbjct: 41 GGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGG 100 Query: 604 XXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG G G GGG GG Sbjct: 101 SGGGSGGGFGGGGSIGGFGGGGGGGGG 127 Score = 29.9 bits (64), Expect = 4.3 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Frame = -3 Query: 677 RXGGGXXGGGXGXXGXGXXXXGG--XXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 R GGG GG G G GG G G G G GG GG Sbjct: 25 RPGGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGG 77 >X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. Length = 239 Score = 45.2 bits (102), Expect = 1e-04 Identities = 31/91 (34%), Positives = 31/91 (34%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G KK GGGGGG G G GGG GGG G GGG Sbjct: 161 GAKKAFTNNRGGGGGGGGFGGRGGRGG--------------GRGGGGRGGGGGRGGGGFR 206 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXG 529 G G G G GG G GG G Sbjct: 207 GGAGRNGGGGGGGGGFNRGRGGGGGGGGGRG 237 Score = 42.7 bits (96), Expect = 6e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG GGGG G G GG GG G G GGGG GG Sbjct: 8 GGGGGGGRGFGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGG 50 Score = 41.9 bits (94), Expect = 0.001 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 G G GGGG G G GG GG G G G GGGG Sbjct: 14 GRGFGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGG 51 Score = 39.5 bits (88), Expect = 0.005 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G GG G G G G GG GG GG G Sbjct: 171 GGGGGGGGFGGRGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGG 221 Score = 38.3 bits (85), Expect = 0.012 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -1 Query: 655 GGGXGGGGX--GXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 GGG GGGG G G GG GG G G GGGG G Sbjct: 191 GGGRGGGGGRGGGGFRGGAGRNGGGGGGGGGFNRGRGGGGGGGGG 235 Score = 37.5 bits (83), Expect = 0.021 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGGG G G G GG G G G GGG GG Sbjct: 186 GGGRGGGGRG-GGGGRGGGGFRGGAGRNGGGGGGGGGFNRGRGG 228 Score = 36.7 bits (81), Expect = 0.037 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GG GGG G GGG G G G GGG G GG GG Sbjct: 8 GGGGGGGRGFGGGGGGRGFG-GGGGGRGGGGGRGGGGGFGRGGGGRGG 54 Score = 36.7 bits (81), Expect = 0.037 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXG---GXXXGGXG 520 GG G G G GGG G G G G GGG G G G GG G Sbjct: 180 GGRGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGGFNRGRGGGGGG 232 Score = 35.9 bits (79), Expect = 0.065 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GGG GG G G GG GG G G GG G GG F Sbjct: 173 GGGGGGFGGRGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGGF 222 Score = 35.5 bits (78), Expect = 0.086 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GG G G G G GG G G G GGG Sbjct: 18 GGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGG 55 Score = 34.7 bits (76), Expect = 0.15 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 GGG G GG G G GG G G GGGG G Sbjct: 195 GGGGGRGGGGFRGGAGRNGGGGGGGGGFNRGRGGGGGGGGGRG 237 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXG 586 GGG GGG G GGG G G G G Sbjct: 29 GGGGRGGGGGRGGGGGFGRGGGGRGGGRG 57 Score = 31.9 bits (69), Expect = 1.1 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGG---XGXGGXXXGGXG 520 GG G G G GGG G G G G GGG G GG GG G Sbjct: 183 GGRGGGRGGGGRGGG-GGRGGGGFRGGAGRNGGGGGGGGGFNRGRGGGGGGGGG 235 Score = 31.5 bits (68), Expect = 1.4 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 677 RXGGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXG 528 R GGG GGG G G G GG G G G GG GG G Sbjct: 189 RGGGGR-GGGGGRGGGG--FRGGAGRNGGGGGGGGGFNRGRGGGGGGGGG 235 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPK 511 GGG GG G G G G G G GGG GG G P+ Sbjct: 12 GGGRGFGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRGAFDTGPPE 65 >BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p protein. Length = 592 Score = 45.2 bits (102), Expect = 1e-04 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPP 670 G P PP PP P PP P P P P P P P PPP P Sbjct: 214 GPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYP 265 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 G P PP P PP P P P P PPP P PP PPP Sbjct: 211 GPPGPPGPPGTGPPGPPGPPGTTYPQPP--PPPPPPPPPPPSYPYPPYPYPPP 261 Score = 38.3 bits (85), Expect = 0.012 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 G P PP P P PPP P P P P PP P P P P P Sbjct: 225 GPPGPPGTTYPQPPPPP-----PPPPPPPPSYPYPPYPYPPPGPYPGPWIPLP 272 Score = 37.1 bits (82), Expect = 0.028 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P P P PP P P P P P P Sbjct: 237 PPPPPPPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVP 274 Score = 35.9 bits (79), Expect = 0.065 Identities = 25/91 (27%), Positives = 25/91 (27%), Gaps = 7/91 (7%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXP-XPPPPXPPPXXXXXXXXXXXXXXX 701 PP PPPP P P P P PP P P P PP Sbjct: 152 PPPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPPQKGEHGHHHHHKGSKG 211 Query: 702 XXXXXXPXQXXPXXPXXXP------PPXPXP 776 P P P P PP P P Sbjct: 212 PPGPPGPPGTGPPGPPGPPGTTYPQPPPPPP 242 Score = 35.9 bits (79), Expect = 0.065 Identities = 30/110 (27%), Positives = 32/110 (29%), Gaps = 16/110 (14%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPP-PXXPXP--------------P 655 P PP PP P PPP P P P P P P Sbjct: 153 PPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPPQKGEHGHHHHHKGSKGP 212 Query: 656 PXXP-PPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXPFFFP 802 P P PP P P PPPPPP P P+ +P Sbjct: 213 PGPPGPPGTGPPGPPGPPGTTYPQPPPP---PPPPPPPPPSYPYPPYPYP 259 Score = 35.9 bits (79), Expect = 0.065 Identities = 26/98 (26%), Positives = 26/98 (26%), Gaps = 4/98 (4%) Frame = +2 Query: 521 PXPPXXXPPX----PXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXX 688 P PP PP P PP P P PP P PP PP Sbjct: 178 PHPPIVTPPIIVPIPLPPQKGEHGHHHHHKGSKGPPGPPGPPGTGPPGPPG-PPGTTYPQ 236 Query: 689 XXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXPFFFP 802 P P PPP P P P P Sbjct: 237 PPPPPPPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVP 274 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PP PPPP P P PP PP P P PP P Sbjct: 48 PPQHYYPPPPPPPP------PPPQHCNCPPGPPGPPGPPGLP 83 Score = 33.9 bits (74), Expect = 0.26 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +2 Query: 515 GXPXPPXXXPPXPXP-PPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 G P P P P PP P PPP P PPP PPP Sbjct: 114 GQPGEPGPIGPPGLPGPPGHKSGHGHHDHHDHHHHHPAPPPPPPPPPPPPPPPP 167 Score = 33.9 bits (74), Expect = 0.26 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P P P P P P P P P P Sbjct: 239 PPPPPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVPVP 276 Score = 33.5 bits (73), Expect = 0.35 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPP 658 P PP PP P PPP P P P P P P P P P Sbjct: 235 PQPPPPPPPPPPPPPSYPYPPYPYPPPGPYP-GPWIPLP-VPVPWP 278 Score = 32.3 bits (70), Expect = 0.80 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P PP P P P PP P P PP PP Sbjct: 150 PAPPPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPP 186 Score = 31.9 bits (69), Expect = 1.1 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 8/57 (14%) Frame = +1 Query: 526 PPXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPP--------XXPPP 672 PP PP PP P P PP P P P PPP P P Sbjct: 218 PPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVP 274 Score = 31.5 bits (68), Expect = 1.4 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P PPPP P P P P P P PP P P Sbjct: 150 PAPPPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIP 192 Score = 31.5 bits (68), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPPXXPP 670 P P PPP P PPP PP Sbjct: 150 PAPPPPPPPPPPPPPPPPPP 169 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P PPPP P P P P PP P P P P P Sbjct: 49 PQHYYPPPPPPPPPPPQHCNCP----PGPPGPPGPPGLPGTPGP 88 Score = 29.5 bits (63), Expect(2) = 0.012 Identities = 16/61 (26%), Positives = 16/61 (26%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXPFFF 799 P P P PP P P PPPPPP P P Sbjct: 113 PGQPGEPGPIGPPGLPGPPGHKSGHGHHDHHDHHHHHPAPPPPPPPPPPPPPPPPPPHSH 172 Query: 800 P 802 P Sbjct: 173 P 173 Score = 29.1 bits (62), Expect = 7.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 PP P PPPP PPP Sbjct: 48 PPQHYYPPPPPPPPPP 63 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 2/50 (4%) Frame = +1 Query: 526 PPXXXPPXPPXPXXXPXXXXP--XXXXXXXPPXXXXPXPXXPXPPPXXPP 669 PP P PP P P P PP P P P P P P Sbjct: 229 PPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVPVPWP 278 Score = 27.9 bits (59), Expect(2) = 0.012 Identities = 15/48 (31%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Frame = +2 Query: 509 IFGXPXPPXXXPPXPXPPPXXXXXXXPXXP--XXXXPXXPXXPPPXXP 646 I+ P PP P PPP P P P P P P P Sbjct: 44 IYKLPPQHYYPPPPPPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGP 91 >AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA protein. Length = 594 Score = 45.2 bits (102), Expect = 1e-04 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPP 670 G P PP PP P PP P P P P P P P PPP P Sbjct: 216 GPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYP 267 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 G P PP P PP P P P P PPP P PP PPP Sbjct: 213 GPPGPPGPPGTGPPGPPGPPGTTYPQPP--PPPPPPPPPPPSYPYPPYPYPPP 263 Score = 38.3 bits (85), Expect = 0.012 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 G P PP P P PPP P P P P PP P P P P P Sbjct: 227 GPPGPPGTTYPQPPPPP-----PPPPPPPPSYPYPPYPYPPPGPYPGPWIPLP 274 Score = 37.1 bits (82), Expect = 0.028 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P P P PP P P P P P P Sbjct: 239 PPPPPPPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVP 276 Score = 35.9 bits (79), Expect = 0.065 Identities = 25/91 (27%), Positives = 25/91 (27%), Gaps = 7/91 (7%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXP-XPPPPXPPPXXXXXXXXXXXXXXX 701 PP PPPP P P P P PP P P P PP Sbjct: 154 PPPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPPQKGEHGHHHHHKGSKG 213 Query: 702 XXXXXXPXQXXPXXPXXXP------PPXPXP 776 P P P P PP P P Sbjct: 214 PPGPPGPPGTGPPGPPGPPGTTYPQPPPPPP 244 Score = 35.9 bits (79), Expect = 0.065 Identities = 30/110 (27%), Positives = 32/110 (29%), Gaps = 16/110 (14%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPP-PXXPXP--------------P 655 P PP PP P PPP P P P P P P Sbjct: 155 PPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPPQKGEHGHHHHHKGSKGP 214 Query: 656 PXXP-PPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXPFFFP 802 P P PP P P PPPPPP P P+ +P Sbjct: 215 PGPPGPPGTGPPGPPGPPGTTYPQPPPP---PPPPPPPPPSYPYPPYPYP 261 Score = 35.9 bits (79), Expect = 0.065 Identities = 26/98 (26%), Positives = 26/98 (26%), Gaps = 4/98 (4%) Frame = +2 Query: 521 PXPPXXXPPX----PXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXX 688 P PP PP P PP P P PP P PP PP Sbjct: 180 PHPPIVTPPIIVPIPLPPQKGEHGHHHHHKGSKGPPGPPGPPGTGPPGPPG-PPGTTYPQ 238 Query: 689 XXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXPFFFP 802 P P PPP P P P P Sbjct: 239 PPPPPPPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVP 276 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PP PPPP P P PP PP P P PP P Sbjct: 50 PPQHYYPPPPPPPP------PPPQHCNCPPGPPGPPGPPGLP 85 Score = 33.9 bits (74), Expect = 0.26 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +2 Query: 515 GXPXPPXXXPPXPXP-PPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 G P P P P PP P PPP P PPP PPP Sbjct: 116 GQPGEPGPIGPPGLPGPPGHKSGHGHHDHHDHHHHHPAPPPPPPPPPPPPPPPP 169 Score = 33.9 bits (74), Expect = 0.26 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P P P P P P P P P P Sbjct: 241 PPPPPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVPVP 278 Score = 33.5 bits (73), Expect = 0.35 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPP 658 P PP PP P PPP P P P P P P P P P Sbjct: 237 PQPPPPPPPPPPPPPSYPYPPYPYPPPGPYP-GPWIPLP-VPVPWP 280 Score = 32.3 bits (70), Expect = 0.80 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P PP P P P PP P P PP PP Sbjct: 152 PAPPPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPP 188 Score = 31.9 bits (69), Expect = 1.1 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 8/57 (14%) Frame = +1 Query: 526 PPXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPP--------XXPPP 672 PP PP PP P P PP P P P PPP P P Sbjct: 220 PPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVP 276 Score = 31.5 bits (68), Expect = 1.4 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P PPPP P P P P P P PP P P Sbjct: 152 PAPPPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIP 194 Score = 31.5 bits (68), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPPXXPP 670 P P PPP P PPP PP Sbjct: 152 PAPPPPPPPPPPPPPPPPPP 171 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P PPPP P P P P PP P P P P P Sbjct: 51 PQHYYPPPPPPPPPPPQHCNCP----PGPPGPPGPPGLPGTPGP 90 Score = 29.5 bits (63), Expect(2) = 0.012 Identities = 16/61 (26%), Positives = 16/61 (26%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXPFFF 799 P P P PP P P PPPPPP P P Sbjct: 115 PGQPGEPGPIGPPGLPGPPGHKSGHGHHDHHDHHHHHPAPPPPPPPPPPPPPPPPPPHSH 174 Query: 800 P 802 P Sbjct: 175 P 175 Score = 29.1 bits (62), Expect = 7.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 PP P PPPP PPP Sbjct: 50 PPQHYYPPPPPPPPPP 65 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 2/50 (4%) Frame = +1 Query: 526 PPXXXPPXPPXPXXXPXXXXP--XXXXXXXPPXXXXPXPXXPXPPPXXPP 669 PP P PP P P P PP P P P P P P Sbjct: 231 PPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVPVPWP 280 Score = 27.9 bits (59), Expect(2) = 0.012 Identities = 15/48 (31%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Frame = +2 Query: 509 IFGXPXPPXXXPPXPXPPPXXXXXXXPXXP--XXXXPXXPXXPPPXXP 646 I+ P PP P PPP P P P P P P P Sbjct: 46 IYKLPPQHYYPPPPPPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGP 93 >AE013599-1244|AAS64915.1| 253|Drosophila melanogaster CG13214-PB, isoform B protein. Length = 253 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG GGGG G G GG GG G G G GGGG GG Sbjct: 45 GGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGG 88 Score = 36.3 bits (80), Expect = 0.049 Identities = 29/93 (31%), Positives = 30/93 (32%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GG GGG G G GGG GG G GGG G G Sbjct: 39 GLQGPGGGFGGGGGFGGGGAGGGYGG-----------GGGGGPAGGFGGGPGGGGAGGFG 87 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPK 511 G G G G GG GG P+ Sbjct: 88 GGNNGLGGFANGRPIAPGGGGGG---GGAPAPR 117 Score = 35.5 bits (78), Expect = 0.086 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G GGG G G G G G G GG GG G Sbjct: 37 GAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFG 87 Score = 34.7 bits (76), Expect = 0.15 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GG G G GGG G G G G GG G G GG G Sbjct: 30 ASAGGSPGAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGG 82 Score = 33.9 bits (74), Expect = 0.26 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 G G G G G G GG GG G G G GG GG F Sbjct: 37 GAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGF 86 >U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino protein. Length = 1058 Score = 44.4 bits (100), Expect = 2e-04 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXP---XPPPPXPPP 656 P PPPP P P P PP PP P PPPP PPP Sbjct: 480 PHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPP 526 Score = 41.1 bits (92), Expect = 0.002 Identities = 28/90 (31%), Positives = 28/90 (31%), Gaps = 2/90 (2%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP--XXPXPPPXXPPPXAXXXXXXX 700 P PP P PPP P P P P PPP PPP PPP Sbjct: 480 PHAVAPPPPPPPPPLPAFVAPPPP----PPPPPPPPPLANYGAPPPPPPPPPG------- 528 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P PPPPP P Sbjct: 529 SGSAPPPPPPAPIEGGGGIPPPPPPMSASP 558 Score = 38.7 bits (86), Expect = 0.009 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXP----PPPXPPP 656 P PPPP P P P PP PP P P P PP PPP Sbjct: 495 PAFVAPPPPPPPPPPP----PPLANYGAPPPPPPPPPGSGSAPPPPPP 538 Score = 38.7 bits (86), Expect = 0.009 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 P PPPP P P PP P P PPPP P Sbjct: 500 PPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 540 Score = 36.7 bits (81), Expect = 0.037 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 5/56 (8%) Frame = +2 Query: 521 PXPPXXXPPXPX----PPPXXXXXXXPXXPXXXXPXXPXXPPPXX-PXPPPXXPPP 673 P PP PP P PPP P P P PPP PPP P P Sbjct: 485 PPPPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 540 Score = 35.1 bits (77), Expect = 0.11 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 7/63 (11%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXP-------PPXXPP 670 F P PP PP PPP P P P PPP P P PP PP Sbjct: 497 FVAPPPPPPPPP---PPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 553 Query: 671 PXA 679 A Sbjct: 554 MSA 556 >BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p protein. Length = 1153 Score = 44.4 bits (100), Expect = 2e-04 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXP---XPPPPXPPP 656 P PPPP P P P PP PP P PPPP PPP Sbjct: 575 PHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPP 621 Score = 41.1 bits (92), Expect = 0.002 Identities = 28/90 (31%), Positives = 28/90 (31%), Gaps = 2/90 (2%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP--XXPXPPPXXPPPXAXXXXXXX 700 P PP P PPP P P P P PPP PPP PPP Sbjct: 575 PHAVAPPPPPPPPPLPAFVAPPPP----PPPPPPPPPMANYGAPPPPPPPPPG------- 623 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P PPPPP P Sbjct: 624 SGSAPPPPPPAPIEGGGGIPPPPPPMSASP 653 Score = 38.7 bits (86), Expect = 0.009 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXP----PPPXPPP 656 P PPPP P P P PP PP P P P PP PPP Sbjct: 590 PAFVAPPPPPPPPPPP----PPMANYGAPPPPPPPPPGSGSAPPPPPP 633 Score = 38.7 bits (86), Expect = 0.009 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 P PPPP P P PP P P PPPP P Sbjct: 595 PPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAP 635 Score = 36.7 bits (81), Expect = 0.037 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 5/56 (8%) Frame = +2 Query: 521 PXPPXXXPPXPX----PPPXXXXXXXPXXPXXXXPXXPXXPPPXX-PXPPPXXPPP 673 P PP PP P PPP P P P PPP PPP P P Sbjct: 580 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAP 635 Score = 35.1 bits (77), Expect = 0.11 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 7/63 (11%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXP-------PPXXPP 670 F P PP PP PPP P P P PPP P P PP PP Sbjct: 592 FVAPPPPPPPPP---PPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 648 Query: 671 PXA 679 A Sbjct: 649 MSA 651 >BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p protein. Length = 1286 Score = 44.4 bits (100), Expect = 2e-04 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXP---XPPPPXPPP 656 P PPPP P P P PP PP P PPPP PPP Sbjct: 708 PHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPP 754 Score = 41.1 bits (92), Expect = 0.002 Identities = 28/90 (31%), Positives = 28/90 (31%), Gaps = 2/90 (2%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP--XXPXPPPXXPPPXAXXXXXXX 700 P PP P PPP P P P P PPP PPP PPP Sbjct: 708 PHAVAPPPPPPPPPLPAFVAPPPP----PPPPPPPPPMANYGAPPPPPPPPPG------- 756 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P PPPPP P Sbjct: 757 SGSAPPPPPPAPIEGGGGIPPPPPPMSASP 786 Score = 38.7 bits (86), Expect = 0.009 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXP----PPPXPPP 656 P PPPP P P P PP PP P P P PP PPP Sbjct: 723 PAFVAPPPPPPPPPPP----PPMANYGAPPPPPPPPPGSGSAPPPPPP 766 Score = 38.7 bits (86), Expect = 0.009 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 P PPPP P P PP P P PPPP P Sbjct: 728 PPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAP 768 Score = 36.7 bits (81), Expect = 0.037 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 5/56 (8%) Frame = +2 Query: 521 PXPPXXXPPXPX----PPPXXXXXXXPXXPXXXXPXXPXXPPPXX-PXPPPXXPPP 673 P PP PP P PPP P P P PPP PPP P P Sbjct: 713 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAP 768 Score = 35.1 bits (77), Expect = 0.11 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 7/63 (11%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXP-------PPXXPP 670 F P PP PP PPP P P P PPP P P PP PP Sbjct: 725 FVAPPPPPPPPP---PPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 781 Query: 671 PXA 679 A Sbjct: 782 MSA 784 >AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA protein. Length = 237 Score = 44.0 bits (99), Expect = 2e-04 Identities = 30/87 (34%), Positives = 30/87 (34%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G KK GGGGGG G GGG GGG G GGG Sbjct: 163 GAKKAFTNNRGGGGGGGGFGGRG-----------------GGRGGGGRGGGGGRGGGGFR 205 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGG 541 G G G G GGG G GG Sbjct: 206 GGAGRNGGGGGGGGFNRGRGGGGGGGG 232 Score = 41.9 bits (94), Expect = 0.001 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GG G G G GG GG G G GGGG GG Sbjct: 9 GGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGG 52 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXX-GXGXGXGGGGXXXXGG 524 GG GGGG G G GG GG G G G GGGG GG Sbjct: 8 GGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGG 51 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 G G GGGG G G GG GG G G G GGGG Sbjct: 16 GFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGG 53 Score = 39.5 bits (88), Expect = 0.005 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXX-GXXXXXXXGGGXGXGGXXXGG 526 GG GGG G GGG G G G G GGG G GG GG Sbjct: 8 GGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGG 56 Score = 39.1 bits (87), Expect = 0.007 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G G G GGG G G G G GGG G GG G Sbjct: 178 GGGFGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGFNRGRGGGG 228 Score = 37.9 bits (84), Expect = 0.016 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG G G G G GG GG G G G GGG GG Sbjct: 10 GGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGG 53 Score = 37.5 bits (83), Expect = 0.021 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = -2 Query: 672 GGGXXGGGXGXXGG--GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G GG G G G G G GG G GG G G Sbjct: 173 GGGGGGGGFGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGFNRGRG 225 Score = 37.1 bits (82), Expect = 0.028 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 GG GGGG G G G GG G G GGGG G Sbjct: 191 GGRGGGGGRGGGGFRGGAGRNGGGGGGGGFNRGRGGGGGGGGG 233 Score = 36.3 bits (80), Expect = 0.049 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG GGGG G GG GG G G GG G GG Sbjct: 173 GGGGGGGGFGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGG 215 Score = 35.5 bits (78), Expect = 0.086 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GG G G G G GG G G G GGG Sbjct: 20 GGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGG 57 Score = 35.1 bits (77), Expect = 0.11 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = -2 Query: 672 GGGXXGGGXGXXG-GGXXGXXGXXXXGXXGXXXXXXXGGG--XGXGGXXXGGXG 520 G G GGG G G GG G G G G GGG G GG GG G Sbjct: 180 GFGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGFNRGRGGGGGGGGG 233 Score = 33.5 bits (73), Expect = 0.35 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 636 GGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G G G G GGG G GG GG G Sbjct: 8 GGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGG 46 Score = 33.1 bits (72), Expect = 0.46 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G GGG GGG G GGG G G G Sbjct: 9 GGGGGGRGFGGGGGGGGRGF-----------GGGGGGRGGGGGRGGGGGFGRGGGGRGGG 57 Query: 591 XG 586 G Sbjct: 58 RG 59 Score = 32.7 bits (71), Expect = 0.60 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXG 529 GG GGG GGG G G G G G G G G G Sbjct: 18 GGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRGAFDTG 64 Score = 31.5 bits (68), Expect = 1.4 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXG---XGGXXXGGXG 520 GGG GGG GGG G G G GGG G GG GG G Sbjct: 8 GGG--GGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRG 59 Score = 31.5 bits (68), Expect = 1.4 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPK 511 G G GGG G G G G G G GGG GG G P+ Sbjct: 14 GRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRGAFDTGPPE 67 Score = 29.5 bits (63), Expect = 5.6 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 677 RXGGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGG 540 R GGG GGG G G GG G G G GG GG Sbjct: 193 RGGGGGRGGGGFRGGAGRNGGGG-----GGGGFNRGRGGGGGGGGG 233 >AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p protein. Length = 417 Score = 43.6 bits (98), Expect = 3e-04 Identities = 29/97 (29%), Positives = 29/97 (29%), Gaps = 10/97 (10%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXP-XXPXXXXPXXPXXP---PPXXPXPPPXXPPPXAXXX 688 P PP P P PPP P P P P P PP P PP PP Sbjct: 319 PAPPGTQAPPPMPPPLMPWMSAPQPPPPATEPLNPPIPGTLPPLIPPPPGTSAPPMPPWG 378 Query: 689 XXXXXXXXXXXXPXXPXXAXXXPP------PPPPXXP 781 P P PP PPPP P Sbjct: 379 GGAYSGWGGGYAPPPPPPCAPPPPALSLSQPPPPPPP 415 Score = 31.1 bits (67), Expect = 1.8 Identities = 21/81 (25%), Positives = 21/81 (25%), Gaps = 1/81 (1%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXP-PXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXX 701 PP PPP P P P P P P P PP PP Sbjct: 321 PPGTQAPPPMPPPLMPWMSAPQPPPPATEPLNPPIPGTLPPLIPPPPGTSAPPMPPWGGG 380 Query: 702 XXXXXXPXQXXPXXPXXXPPP 764 P P PPP Sbjct: 381 AYSGWGGGYAPPPPPPCAPPP 401 >AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p protein. Length = 222 Score = 43.6 bits (98), Expect = 3e-04 Identities = 29/97 (29%), Positives = 29/97 (29%), Gaps = 10/97 (10%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXP-XXPXXXXPXXPXXP---PPXXPXPPPXXPPPXAXXX 688 P PP P P PPP P P P P P PP P PP PP Sbjct: 124 PAPPGTQAPPPMPPPLMPWMSAPQPPPPATEPLNPPIPGTLPPLIPPPPGTSAPPMPPWG 183 Query: 689 XXXXXXXXXXXXPXXPXXAXXXPP------PPPPXXP 781 P P PP PPPP P Sbjct: 184 GGAYSGWGGGYAPPPPPPCAPPPPALSLSQPPPPPPP 220 Score = 31.1 bits (67), Expect = 1.8 Identities = 21/81 (25%), Positives = 21/81 (25%), Gaps = 1/81 (1%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXP-PXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXX 701 PP PPP P P P P P P P PP PP Sbjct: 126 PPGTQAPPPMPPPLMPWMSAPQPPPPATEPLNPPIPGTLPPLIPPPPGTSAPPMPPWGGG 185 Query: 702 XXXXXXPXQXXPXXPXXXPPP 764 P P PPP Sbjct: 186 AYSGWGGGYAPPPPPPCAPPP 206 >AE014298-9|AAX52465.1| 193|Drosophila melanogaster CG13376-PA protein. Length = 193 Score = 43.6 bits (98), Expect = 3e-04 Identities = 25/84 (29%), Positives = 26/84 (30%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GG GGG G G + G GGG G GG G G G Sbjct: 23 GGSGGGWSSGGGGGGGHGGGGDVQIIKVITESGSSGGGGGGGGWSSGGGGGGGGWSSGGG 82 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG G Sbjct: 83 GGGGGWSSGGGGGGWSSGGGGGSG 106 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/78 (32%), Positives = 25/78 (32%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G GGG G G W G GGG GGG G GG Sbjct: 81 GGGGGGGWSSGGGGGGWSSGGGGGSGSDVKLIKIISLGGGGGGHSGGGGGWSSGGGGGGW 140 Query: 595 XXGGXXXXGXGXGXGGGG 542 GG G G GGG Sbjct: 141 SSGG----SGGHGSSGGG 154 Score = 37.1 bits (82), Expect = 0.028 Identities = 31/94 (32%), Positives = 33/94 (35%), Gaps = 7/94 (7%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXG----XX 613 G GGGGGG + G G G + GGG GGG GGG G Sbjct: 55 GSSGGGGGGGGWSSGGGGGGGGWSSGGGGGGGGWSSGGG--GGGWSSGGGGGSGSDVKLI 112 Query: 612 GXXXXGXXGXXXXXXXGG---GXGXGGXXXGGXG 520 G G GG G G GG GG G Sbjct: 113 KIISLGGGGGGHSGGGGGWSSGGGGGGWSSGGSG 146 Score = 33.5 bits (73), Expect = 0.35 Identities = 25/84 (29%), Positives = 25/84 (29%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GG G G G G GGG GG G GG Sbjct: 23 GGSGGGWSSGGGGGGGHGGGGDVQIIKVITESGSSGGGGGGGGWSSGGGG----GGGGWS 78 Query: 595 XXGGXXXXGXGXGXGGGGXXXXGG 524 GG G G GGGG GG Sbjct: 79 SGGGGGGGGWSSGGGGGGWSSGGG 102 Score = 33.1 bits (72), Expect = 0.46 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGG-GXXGGGXGXXGGGXXG 619 GGGGGG G G + GG G GGG G GGG G Sbjct: 134 GGGGGGWSSGGSGGHGSSGGGDTKVIKIIKLSSGGHGGAGGGGGHGGGGGGG 185 Score = 31.5 bits (68), Expect = 1.4 Identities = 27/102 (26%), Positives = 28/102 (27%), Gaps = 12/102 (11%) Frame = -2 Query: 795 KKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXG------ 634 + G G GGGGG G G GGG GG G G Sbjct: 53 ESGSSGGGGGGGGWSSGGGGGGGGWSSGGGGGGGGWSSGGGGGGWSSGGGGGSGSDVKLI 112 Query: 633 ------GGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GG G G G GG G G GG Sbjct: 113 KIISLGGGGGGHSGGGGGWSSGGGGGGWSSGGSGGHGSSGGG 154 >AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA protein. Length = 787 Score = 43.6 bits (98), Expect = 3e-04 Identities = 29/97 (29%), Positives = 29/97 (29%), Gaps = 10/97 (10%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXP-XXPXXXXPXXPXXP---PPXXPXPPPXXPPPXAXXX 688 P PP P P PPP P P P P P PP P PP PP Sbjct: 689 PAPPGTQAPPPMPPPLMPWMSAPQPPPPATEPLNPPIPGTLPPLIPPPPGTSAPPMPPWG 748 Query: 689 XXXXXXXXXXXXPXXPXXAXXXPP------PPPPXXP 781 P P PP PPPP P Sbjct: 749 GGAYSGWGGGYAPPPPPPCAPPPPALSLSQPPPPPPP 785 Score = 31.1 bits (67), Expect = 1.8 Identities = 21/81 (25%), Positives = 21/81 (25%), Gaps = 1/81 (1%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXP-PXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXX 701 PP PPP P P P P P P P PP PP Sbjct: 691 PPGTQAPPPMPPPLMPWMSAPQPPPPATEPLNPPIPGTLPPLIPPPPGTSAPPMPPWGGG 750 Query: 702 XXXXXXPXQXXPXXPXXXPPP 764 P P PPP Sbjct: 751 AYSGWGGGYAPPPPPPCAPPP 771 >AE014296-3444|AAF51657.1| 98|Drosophila melanogaster CG11458-PA protein. Length = 98 Score = 43.2 bits (97), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = -1 Query: 655 GGGXGGGGX--GXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGGG G G GG GG G G G GGGG GG Sbjct: 51 GGGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGGGGGGGGGKHGGG 96 Score = 41.9 bits (94), Expect = 0.001 Identities = 29/82 (35%), Positives = 29/82 (35%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXXXX 590 G GGG G G W G GG GGGG G G GG Sbjct: 21 GGGGGGGGGQGG--WQKNGGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNG--- 75 Query: 589 GGXXXXGXGXGXGGGGXXXXGG 524 GG G G G GGGG GG Sbjct: 76 GGGKHGGGGGGGGGGGKHGGGG 97 Score = 40.7 bits (91), Expect = 0.002 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G GGG GGG G GGG G G Sbjct: 23 GGGGGGGQGGWQKNGGGGGGGGQGGWQKGGGGGGGGKHGGGGG--GGGKHG-------GG 73 Query: 591 XGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GG GG G Sbjct: 74 NGGGGKHGGGGGGGGGGGKHGGGG 97 Score = 38.7 bits (86), Expect = 0.009 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 4/57 (7%) Frame = -2 Query: 678 AXGGGXXGGGXGXX----GGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GGG GGG G GGG G G G G GGG G GG GG G Sbjct: 20 AGGGGGGGGGQGGWQKNGGGGGGGGQGGWQKG-GGGGGGGKHGGGGGGGGKHGGGNG 75 Score = 37.5 bits (83), Expect = 0.021 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Frame = -2 Query: 672 GGGXXGGGXGXX--GGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPK 511 GGG GGG G GGG G G G GGG GG GG G K Sbjct: 37 GGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGGGGGGGGGK 92 Score = 31.5 bits (68), Expect = 1.4 Identities = 20/58 (34%), Positives = 21/58 (36%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGG 628 G +G GGGGGG G G GGG GGG G GGG Sbjct: 42 GGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGKH---GGGGGGGGGGGKHGGG 96 >X73134-1|CAA51651.1| 127|Drosophila melanogaster GCR 20 protein. Length = 127 Score = 42.3 bits (95), Expect = 7e-04 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GGG GG G G G GG GG G G G GGG GG F Sbjct: 50 GGGFGGPGGGFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGF 99 Score = 39.9 bits (89), Expect = 0.004 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 G G GGG G GGG G G G GGG G GG GG G P Sbjct: 59 GFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGG-GFGGRPGGGFGGP 110 Score = 37.9 bits (84), Expect = 0.016 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GGG G G G G G G G GG G G Sbjct: 73 GFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGGPGGGFGGPGGGFGG 123 Score = 36.7 bits (81), Expect = 0.037 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GGG G G G G GG G GG GG G Sbjct: 52 GFGGPGGGFGGPGGGFGGQGG--GFGGPGGGFGGQGGGFGGQGGFGGGGFG 100 Score = 35.9 bits (79), Expect = 0.065 Identities = 25/74 (33%), Positives = 25/74 (33%), Gaps = 2/74 (2%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGG--GXXGGGXGXXGGG 628 G G G GGG GG G G G GG G GGG G GGG Sbjct: 54 GGPGGGFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGGPGGG 113 Query: 627 XXGXXGXXXXGXXG 586 G G G G Sbjct: 114 FGGPGGGFGGGFGG 127 Score = 33.5 bits (73), Expect = 0.35 Identities = 22/72 (30%), Positives = 22/72 (30%) Frame = -2 Query: 657 GGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKIFXXKXSNFXX 478 GGG G GGG G G G GG G G GG G F Sbjct: 50 GGGFGGPGGGFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGG 109 Query: 477 XXFPLXKXGGGF 442 GGGF Sbjct: 110 PGGGFGGPGGGF 121 >AY113557-1|AAM29562.1| 93|Drosophila melanogaster RH06401p protein. Length = 93 Score = 42.3 bits (95), Expect = 7e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGGG G GG GG G G GGGG GG Sbjct: 29 GGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGG 72 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G GGG G G G G GGG G GG G G Sbjct: 24 GGGGGGGGYGGGGGGGYGGGGGGQSG-YGGGGQKNGGGGHGGGGQGSYGGG 73 Score = 40.3 bits (90), Expect = 0.003 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G GGG G G G GG GG GG G Sbjct: 29 GGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQGGHG 79 Score = 37.9 bits (84), Expect = 0.016 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGGG G GG GG G GGG GG Sbjct: 37 GGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQGGHGG 80 Score = 35.9 bits (79), Expect = 0.065 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXG--GGXGXGGXXXGGXG 520 GG GGG G GGG G G G G GG GG GG G Sbjct: 33 GGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQG 84 Score = 35.5 bits (78), Expect = 0.086 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXA--XGGGXXGGGXGXXGGGXXGXXGX 607 G GGGGGG G G G GGG GGG G GGG G G Sbjct: 21 GLLGGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQGGHGG 80 Query: 606 XXXG 595 G Sbjct: 81 GGQG 84 Score = 31.5 bits (68), Expect = 1.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GGG GGG G G G G G G G GG GG Sbjct: 37 GGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGG 85 Score = 30.7 bits (66), Expect = 2.4 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 6/57 (10%) Frame = -2 Query: 672 GGGXXGGG----XGXXGGGXXGXXGXXXXGXXGXXXXXXXG--GGXGXGGXXXGGXG 520 GGG GGG G GGG G G G G GG G GG G G Sbjct: 36 GGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKKGGG 92 >AY070976-1|AAL48598.1| 127|Drosophila melanogaster RE07460p protein. Length = 127 Score = 42.3 bits (95), Expect = 7e-04 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GGG GG G G G GG GG G G G GGG GG F Sbjct: 50 GGGFGGPGGGFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGF 99 Score = 39.9 bits (89), Expect = 0.004 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 G G GGG G GGG G G G GGG G GG GG G P Sbjct: 59 GFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGG-GFGGRPGGGFGGP 110 Score = 37.9 bits (84), Expect = 0.016 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GGG G G G G G G G GG G G Sbjct: 73 GFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGGPGGGFGGPGGGFGG 123 Score = 36.7 bits (81), Expect = 0.037 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GGG G G G G GG G GG GG G Sbjct: 52 GFGGPGGGFGGPGGGFGGQGG--GFGGPGGGFGGQGGGFGGQGGFGGGGFG 100 Score = 35.9 bits (79), Expect = 0.065 Identities = 25/74 (33%), Positives = 25/74 (33%), Gaps = 2/74 (2%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGG--GXXGGGXGXXGGG 628 G G G GGG GG G G G GG G GGG G GGG Sbjct: 54 GGPGGGFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGGPGGG 113 Query: 627 XXGXXGXXXXGXXG 586 G G G G Sbjct: 114 FGGPGGGFGGGFGG 127 Score = 33.5 bits (73), Expect = 0.35 Identities = 22/72 (30%), Positives = 22/72 (30%) Frame = -2 Query: 657 GGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKIFXXKXSNFXX 478 GGG G GGG G G G GG G G GG G F Sbjct: 50 GGGFGGPGGGFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGG 109 Query: 477 XXFPLXKXGGGF 442 GGGF Sbjct: 110 PGGGFGGPGGGF 121 >AE014298-2542|AAF48711.1| 133|Drosophila melanogaster CG5172-PA, isoform A protein. Length = 133 Score = 42.3 bits (95), Expect = 7e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGGG G GG GG G G GGGG GG Sbjct: 29 GGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGG 72 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G GGG G G G G GGG G GG G G Sbjct: 24 GGGGGGGGYGGGGGGGYGGGGGGQSG-YGGGGQKNGGGGHGGGGQGSYGGG 73 Score = 33.1 bits (72), Expect = 0.46 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXG 619 G G GGGGGG G G GGG GGG G GGG G Sbjct: 28 GGGGYGGGGGGGYGGGGGGQSGYGGGGQKN--------GGGGHGGGGQGSYGGGSQG 76 >AE014298-2541|AAS65393.1| 95|Drosophila melanogaster CG5172-PB, isoform B protein. Length = 95 Score = 42.3 bits (95), Expect = 7e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGGG G GG GG G G GGGG GG Sbjct: 29 GGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGG 72 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G GGG G G G G GGG G GG G G Sbjct: 24 GGGGGGGGYGGGGGGGYGGGGGGQSG-YGGGGQKNGGGGHGGGGQGSYGGG 73 Score = 33.1 bits (72), Expect = 0.46 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXG 619 G G GGGGGG G G GGG GGG G GGG G Sbjct: 28 GGGGYGGGGGGGYGGGGGGQSGYGGGGQKN--------GGGGHGGGGQGSYGGGSQG 76 >AE014297-1701|AAF54959.1| 127|Drosophila melanogaster CG9757-PA protein. Length = 127 Score = 42.3 bits (95), Expect = 7e-04 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GGG GG G G G GG GG G G G GGG GG F Sbjct: 50 GGGFGGPGGGFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGF 99 Score = 39.9 bits (89), Expect = 0.004 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 G G GGG G GGG G G G GGG G GG GG G P Sbjct: 59 GFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGG-GFGGRPGGGFGGP 110 Score = 37.9 bits (84), Expect = 0.016 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GGG G G G G G G G GG G G Sbjct: 73 GFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGGPGGGFGGPGGGFGG 123 Score = 36.7 bits (81), Expect = 0.037 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G GGG G G G G GG G GG GG G Sbjct: 52 GFGGPGGGFGGPGGGFGGQGG--GFGGPGGGFGGQGGGFGGQGGFGGGGFG 100 Score = 35.9 bits (79), Expect = 0.065 Identities = 25/74 (33%), Positives = 25/74 (33%), Gaps = 2/74 (2%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGG--GXXGGGXGXXGGG 628 G G G GGG GG G G G GG G GGG G GGG Sbjct: 54 GGPGGGFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGGPGGG 113 Query: 627 XXGXXGXXXXGXXG 586 G G G G Sbjct: 114 FGGPGGGFGGGFGG 127 Score = 33.5 bits (73), Expect = 0.35 Identities = 22/72 (30%), Positives = 22/72 (30%) Frame = -2 Query: 657 GGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKIFXXKXSNFXX 478 GGG G GGG G G G GG G G GG G F Sbjct: 50 GGGFGGPGGGFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGG 109 Query: 477 XXFPLXKXGGGF 442 GGGF Sbjct: 110 PGGGFGGPGGGF 121 >AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-PA protein. Length = 926 Score = 42.3 bits (95), Expect = 7e-04 Identities = 26/89 (29%), Positives = 26/89 (29%), Gaps = 2/89 (2%) Frame = +2 Query: 521 PXPPXXXPPX--PXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 P P PP P PPP P P PPP PPP PP Sbjct: 194 PTRPPTRPPTRPPTPPPTYLPPTNKPLPPVTTRLPPPPPPP--RTPPPTRPPTRPPTTRP 251 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P PPPP P P Sbjct: 252 PATYLPPTNKPLPPVTTRLPPPPPSPRTP 280 Score = 39.1 bits (87), Expect = 0.007 Identities = 26/94 (27%), Positives = 26/94 (27%), Gaps = 7/94 (7%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXX--PXXXXPXXPXXPPPXXPXPPPXXPPP-----XA 679 P PP PP PP P P P P P P P PPP Sbjct: 230 PPPPPRTPPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPSPRTPPPTRPPTRP 289 Query: 680 XXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P PPPPPP P Sbjct: 290 PTTRPPATYLPPTNKPLPPVTTRLPPPPPPPRTP 323 Score = 37.9 bits (84), Expect = 0.016 Identities = 26/96 (27%), Positives = 26/96 (27%), Gaps = 6/96 (6%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXX---PXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXX 691 P PP P P PP P P P P P PPP PPP Sbjct: 272 PPPPSPRTPPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPPTK 331 Query: 692 XXXXXXXXXXXP---XXPXXAXXXPPPPPPXXPXXP 790 P P P PPP P P Sbjct: 332 PPTTRPPATYLPPTNKPPPPVTTRRPTPPPTRPPPP 367 Score = 37.5 bits (83), Expect = 0.021 Identities = 26/101 (25%), Positives = 27/101 (26%), Gaps = 7/101 (6%) Frame = +2 Query: 521 PXPPXXXPPXPXP----PPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPP---XXPPPXA 679 P PP PP P PP P P P PPP P PPP P P Sbjct: 530 PPPPPTRPPTKPPTTYLPPVTVRTTRATPPPTRPPTRPPTPPPTRPPPPPTRASTPAPTY 589 Query: 680 XXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXPFFFP 802 PP PP P + P Sbjct: 590 LPPTNKPLPPVTVRTTVRTTPRPTLPPTKPPTRPPTTYLPP 630 Score = 37.1 bits (82), Expect = 0.028 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PP PPP P PP PP P PPP PP Sbjct: 201 PPTRPPTPPPTYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPP 243 Score = 35.1 bits (77), Expect = 0.11 Identities = 25/93 (26%), Positives = 25/93 (26%), Gaps = 5/93 (5%) Frame = +3 Query: 513 LXXXPPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXP-----XPPPPXPPPXXXXXXX 677 L PP PPP P P PP P P P PPPP PP Sbjct: 270 LPPPPPSPRTPPPTRPPTRPPTTRPP-ATYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRP 328 Query: 678 XXXXXXXXXXXXXXPXQXXPXXPXXXPPPXPXP 776 P P P P P P Sbjct: 329 PTKPPTTRPPATYLPPTNKPPPPVTTRRPTPPP 361 Score = 35.1 bits (77), Expect = 0.11 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Frame = +1 Query: 541 PPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPP-----PXXPPPXR 678 PP PP P P P PP P P PP P PPP R Sbjct: 271 PPPPPSPRTPPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPPPR 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +3 Query: 543 PPPPXPXPXP-XXXXPPXXXXXXPPXXPXPXPP--PPXPPP 656 PPP P P PP PP P PP PP PPP Sbjct: 170 PPPDVPFDLPVRTTQPPTRPPTRPPTRPPTRPPTRPPTPPP 210 Score = 33.5 bits (73), Expect = 0.35 Identities = 19/75 (25%), Positives = 19/75 (25%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXXXXXXXXPX 725 PP P PP PP P PPP PP Sbjct: 294 PPATYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPPTKPPTTRPPATYLPPTNKPPPPVT 353 Query: 726 QXXPXXPXXXPPPXP 770 P P PPP P Sbjct: 354 TRRPTPPPTRPPPPP 368 Score = 33.1 bits (72), Expect = 0.46 Identities = 23/86 (26%), Positives = 23/86 (26%), Gaps = 2/86 (2%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXXX 704 PP PP P P P PP PPPP PP Sbjct: 193 PPTRPPTRPPTRPPTPPPTYLPPTNKPLPPVTTR-LPPPPPPPRTPPPTRPPTRPPTTRP 251 Query: 705 XXXXXPXQXXPXXP--XXXPPPXPXP 776 P P P PPP P P Sbjct: 252 PATYLPPTNKPLPPVTTRLPPPPPSP 277 Score = 32.7 bits (71), Expect = 0.60 Identities = 20/74 (27%), Positives = 20/74 (27%) Frame = +2 Query: 560 PPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPX 739 PP P P PP P PP PP P P Sbjct: 170 PPPDVPFDLPVRTTQPPTRPPTRPPTRPPTRPPTRPP------TPPPTYLPPTNKPLPPV 223 Query: 740 XAXXXPPPPPPXXP 781 PPPPPP P Sbjct: 224 TTRLPPPPPPPRTP 237 Score = 32.7 bits (71), Expect = 0.60 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +1 Query: 541 PPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPP--PXXPPP 672 PP PP P P P PP P P PP PPP Sbjct: 228 PPPPPPPRTPPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPP 273 Score = 32.7 bits (71), Expect = 0.60 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 6/54 (11%) Frame = +3 Query: 513 LXXXPPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXP------XPXPPPPXPPP 656 L PP PPP P P PP P P PPP PPP Sbjct: 313 LPPPPPPPRTPPPTRPPTKPPTTRPPATYLPPTNKPPPPVTTRRPTPPPTRPPP 366 Score = 32.3 bits (70), Expect = 0.80 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 4/50 (8%) Frame = +1 Query: 541 PPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPP----PXXPPPXR 678 PP PP P P P PP P P PP PPP R Sbjct: 314 PPPPPPPRTPPPTRPPTKPPTTRPPATYLPPTNKPPPPVTTRRPTPPPTR 363 Score = 31.1 bits (67), Expect = 1.8 Identities = 21/87 (24%), Positives = 21/87 (24%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P P P PP P P P P PPP PP P P Sbjct: 172 PDVPFDLPVRTTQPPTRPPTRPPTRPPTRPPTRPPTPPPTY-LPPTNKPLPPVTTRLPPP 230 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P PP P Sbjct: 231 PPPPRTPPPTRPPTRPPTTRPPATYLP 257 Score = 31.1 bits (67), Expect = 1.8 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 12/60 (20%) Frame = +3 Query: 513 LXXXPPXXXXPPPPXPXPXPXXXXPPXXXXXX------------PPXXPXPXPPPPXPPP 656 L PP PPP P P PP PP P P PPP PP Sbjct: 227 LPPPPPPPRTPPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPSPRTPPPTRPP 286 Score = 30.3 bits (65), Expect = 3.2 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PP P P P PP P P PPP PP Sbjct: 367 PPTRASTPAPTYLPPTNKPLPPVTVRTTVRTTPRPTPPPTKPP 409 Score = 30.3 bits (65), Expect = 3.2 Identities = 21/81 (25%), Positives = 22/81 (27%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXXXX 707 P PP P P PP P P P PP PP Sbjct: 502 PRPTLPPTKPPTRPPTTYLPPPTVRTTRP--PPPPTRPPTKPPTTYLPPVTVRTTRATPP 559 Query: 708 XXXXPXQXXPXXPXXXPPPXP 770 P + P P PPP P Sbjct: 560 PTRPPTR-PPTPPPTRPPPPP 579 Score = 29.9 bits (64), Expect = 4.3 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P P P PP P PPPP PP Sbjct: 399 PRPTPPPTKPPTRPPTTYLPPPTVRTTRPPPPPTRPP 435 Score = 29.9 bits (64), Expect = 4.3 Identities = 23/92 (25%), Positives = 23/92 (25%), Gaps = 2/92 (2%) Frame = +2 Query: 521 PXPPXXXPPXPXP--PPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 P P PP P P PP P P PP P P Sbjct: 560 PTRPPTRPPTPPPTRPPPPPTRASTPAPTYLPPTNKPLPPVTVRTTVRTTPRPTLPPTKP 619 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P PPPPP P P Sbjct: 620 PTRPPTTYLPP--PSVRTTRPPPPPTRPPTKP 649 Score = 29.1 bits (62), Expect = 7.4 Identities = 18/62 (29%), Positives = 18/62 (29%), Gaps = 2/62 (3%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPPXXPP--PXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPX 784 P PP P PP PP P P P PPPPPP Sbjct: 179 PVRTTQPPTRPPTRPPTRPPTRPPTRPPTPPPTYLPPTNKPLPPVTTRL-PPPPPPPRTP 237 Query: 785 XP 790 P Sbjct: 238 PP 239 Score = 29.1 bits (62), Expect = 7.4 Identities = 19/77 (24%), Positives = 20/77 (25%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXXXXXXXXPX 725 P P P PP P PPPP PP P Sbjct: 502 PRPTLPPTKPPTRPPTTYLPPPTVRTTRPPPPPTRPPTKPPTTYLPPVTVRTTRATPPPT 561 Query: 726 QXXPXXPXXXPPPXPXP 776 + P P PP P P Sbjct: 562 R-PPTRPPTPPPTRPPP 577 >X62636-1|CAA44502.1| 326|Drosophila melanogaster hrp36.1 protein. Length = 326 Score = 41.9 bits (94), Expect = 0.001 Identities = 31/93 (33%), Positives = 31/93 (33%), Gaps = 3/93 (3%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGG-XXGXX 613 G G GG GG G G G A GGG G G GGG G Sbjct: 204 GRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSG 263 Query: 612 GXXXXGXXGXXXXXXXGGGXG--XGGXXXGGXG 520 G G G GGG G GG GG G Sbjct: 264 GWNQQGGSGGGPWNNQGGGNGGWNGGGGGGGYG 296 Score = 38.3 bits (85), Expect = 0.012 Identities = 28/93 (30%), Positives = 31/93 (33%), Gaps = 2/93 (2%) Frame = -2 Query: 798 KKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGG--GXXGGGXGXXGGGX 625 ++ G G GGGG G G G + GG GGG G GG Sbjct: 231 RQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGG- 289 Query: 624 XGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G G GGG G GG GG Sbjct: 290 GGGGGYGGGNSNGSWGGNGGGGGGGQGGNMGGG 322 Score = 35.1 bits (77), Expect = 0.11 Identities = 22/82 (26%), Positives = 23/82 (28%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXXXX 590 G GGG G G + G G G GG G GG Sbjct: 240 GAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGGYGGGN 299 Query: 589 GGXXXXGXGXGXGGGGXXXXGG 524 G G G GGG GG Sbjct: 300 SNGSWGGNGGGGGGGQGGNMGG 321 Score = 33.9 bits (74), Expect = 0.26 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG G GG G GG GG G GGG GG Sbjct: 200 GGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGG 243 Score = 32.3 bits (70), Expect = 0.80 Identities = 27/97 (27%), Positives = 28/97 (28%), Gaps = 6/97 (6%) Frame = -2 Query: 792 KGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXX------GG 631 +G G GGG GG G G GG GGG G GG Sbjct: 216 QGDRGQGGGGWGGQNRQNGG--GNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGG 273 Query: 630 GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG G G G Sbjct: 274 GPWNNQGGGNGGWNGGGGGGGYGGGNSNGSWGGNGGG 310 Score = 32.3 bits (70), Expect = 0.80 Identities = 28/94 (29%), Positives = 29/94 (30%), Gaps = 4/94 (4%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXG----GGXXGGGXGXXGGGXX 622 G G GGG G G G + G GG GG GGG Sbjct: 225 GWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNG 284 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 285 GWNGGGGGGGYGGGNSNGSWGGNGGGG--GGGQG 316 Score = 31.9 bits (69), Expect = 1.1 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGX-XGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 GGG GG GGG G G G G GGG G G G P Sbjct: 222 GGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGP 275 Score = 30.7 bits (66), Expect = 2.4 Identities = 25/85 (29%), Positives = 25/85 (29%), Gaps = 5/85 (5%) Frame = -1 Query: 763 GGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXG-----GGGXGXGXXGGXXX 599 GGG G G G G G G GGG G GG Sbjct: 234 GGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGG 293 Query: 598 XXXGGXXXXGXGXGXGGGGXXXXGG 524 GG G G GGGG GG Sbjct: 294 GYGGGNSNGSWG-GNGGGGGGGQGG 317 Score = 29.5 bits (63), Expect = 5.6 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -2 Query: 657 GGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GGG G G G G G G GG GG GG Sbjct: 202 GGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGG 245 >X59691-1|CAA42212.1| 386|Drosophila melanogaster P11 (hnRNP protein) protein. Length = 386 Score = 41.9 bits (94), Expect = 0.001 Identities = 31/93 (33%), Positives = 31/93 (33%), Gaps = 3/93 (3%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGG-XXGXX 613 G G GG GG G G G A GGG G G GGG G Sbjct: 204 GRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSG 263 Query: 612 GXXXXGXXGXXXXXXXGGGXG--XGGXXXGGXG 520 G G G GGG G GG GG G Sbjct: 264 GWNQQGGTGGGPWNNQGGGNGGWNGGGGGGGYG 296 Score = 33.9 bits (74), Expect = 0.26 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG G GG G GG GG G GGG GG Sbjct: 200 GGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGG 243 Score = 33.9 bits (74), Expect = 0.26 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G GG G GGGG GG Sbjct: 255 GGGQGGGSGGWNQQGGTGGGPWNNQGGGNGGWNGGGGGGGYGGG 298 Score = 33.5 bits (73), Expect = 0.35 Identities = 25/78 (32%), Positives = 25/78 (32%), Gaps = 1/78 (1%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXG-GGXGGGGXGXGXXGGXXX 599 G G G G G G G G GG GGG G G GG Sbjct: 242 GGGGGFGNSGGNFGGGQGGGSGGWNQQGGTGGGPWNNQGGGNGGWNGGGGGGGYGGGNSN 301 Query: 598 XXXGGXXXXGXGXGXGGG 545 GG G G G GGG Sbjct: 302 GSWGG---NGGGGGGGGG 316 Score = 33.1 bits (72), Expect = 0.46 Identities = 22/77 (28%), Positives = 23/77 (29%), Gaps = 1/77 (1%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGX-GXGXXGGXXXXX 593 G GGG G G + G G G GG G G GG Sbjct: 240 GAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGTGGGPWNNQGGGNGGWNGGGGGGGYGGGN 299 Query: 592 XGGXXXXGXGXGXGGGG 542 G G G GGGG Sbjct: 300 SNGSWGGNGGGGGGGGG 316 Score = 31.1 bits (67), Expect = 1.8 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGX-XGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 GGG GG GGG G G G G GGG G G G P Sbjct: 222 GGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGTGGGP 275 Score = 29.9 bits (64), Expect = 4.3 Identities = 22/78 (28%), Positives = 22/78 (28%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G G GGG GGG G GG Sbjct: 251 GGNFGGGQGGGSGGWNQQGGTGGGPWNNQGGGNGGWNGGGGGGGYGGGNSNGSWGGNGGG 310 Query: 595 XXGGXXXXGXGXGXGGGG 542 GG GGG Sbjct: 311 GGGGGGFGNEYQQSYGGG 328 Score = 29.5 bits (63), Expect = 5.6 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -2 Query: 657 GGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GGG G G G G G G GG GG GG Sbjct: 202 GGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGG 245 >X54803-1|CAA38574.1| 386|Drosophila melanogaster Hrb87F protein. Length = 386 Score = 41.9 bits (94), Expect = 0.001 Identities = 31/93 (33%), Positives = 31/93 (33%), Gaps = 3/93 (3%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGG-XXGXX 613 G G GG GG G G G A GGG G G GGG G Sbjct: 204 GRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSG 263 Query: 612 GXXXXGXXGXXXXXXXGGGXG--XGGXXXGGXG 520 G G G GGG G GG GG G Sbjct: 264 GWNQQGGSGGGPWNNQGGGNGGWNGGGGGGGYG 296 Score = 36.7 bits (81), Expect = 0.037 Identities = 28/94 (29%), Positives = 29/94 (30%), Gaps = 4/94 (4%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXG----GGXXGGGXGXXGGGXX 622 G G GGG G G G + G GG GG GGG Sbjct: 225 GWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNG 284 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GG G GG GG G Sbjct: 285 GWNGGGGGGGYGGGNSNGSWGGNGGGGGGGGGFG 318 Score = 34.3 bits (75), Expect = 0.20 Identities = 23/86 (26%), Positives = 26/86 (30%) Frame = -2 Query: 798 KKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXG 619 ++ G G GGGG G G G + GG G G G G Sbjct: 231 RQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGG 290 Query: 618 XXGXXXXGXXGXXXXXXXGGGXGXGG 541 G G GGG G GG Sbjct: 291 GGGGYGGGNSNGSWGGNGGGGGGGGG 316 Score = 33.9 bits (74), Expect = 0.26 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG G GG G GG GG G GGG GG Sbjct: 200 GGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGG 243 Score = 33.9 bits (74), Expect = 0.26 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G GG G GGGG GG Sbjct: 255 GGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGGYGGG 298 Score = 33.5 bits (73), Expect = 0.35 Identities = 25/78 (32%), Positives = 25/78 (32%), Gaps = 1/78 (1%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXG-GGXGGGGXGXGXXGGXXX 599 G G G G G G G G GG GGG G G GG Sbjct: 242 GGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGGYGGGNSN 301 Query: 598 XXXGGXXXXGXGXGXGGG 545 GG G G G GGG Sbjct: 302 GSWGG---NGGGGGGGGG 316 Score = 31.9 bits (69), Expect = 1.1 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGX-XGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 GGG GG GGG G G G G GGG G G G P Sbjct: 222 GGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGP 275 Score = 31.5 bits (68), Expect = 1.4 Identities = 22/88 (25%), Positives = 26/88 (29%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXXXX 590 G GGG G G + G G G GG G GG Sbjct: 240 GAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGGYGG-- 297 Query: 589 GGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 G G G GGGG G +++ Sbjct: 298 GNSNGSWGGNGGGGGGGGGFGNEYQQSY 325 Score = 29.5 bits (63), Expect = 5.6 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -2 Query: 657 GGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GGG G G G G G G GG GG GG Sbjct: 202 GGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGG 245 >BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p protein. Length = 652 Score = 41.9 bits (94), Expect = 0.001 Identities = 24/84 (28%), Positives = 24/84 (28%), Gaps = 1/84 (1%) Frame = +2 Query: 542 PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXX 721 PP P PP P P P P PP P P P P Sbjct: 522 PPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPG 581 Query: 722 XPXXPXXAXXXPP-PPPPXXPXXP 790 P P PP PP P P P Sbjct: 582 PPGPPGPTRPGPPGPPGPTRPGPP 605 Score = 38.7 bits (86), Expect = 0.009 Identities = 26/90 (28%), Positives = 26/90 (28%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXX 691 FG P PP PP P P P P P P P P P P PP Sbjct: 546 FGPPGPP--GPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPP-----G 598 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P PP P P P Sbjct: 599 PTRPGPPGPTRPGPPGPTRPGPPGPSPNDP 628 Score = 38.3 bits (85), Expect = 0.012 Identities = 26/93 (27%), Positives = 26/93 (27%), Gaps = 1/93 (1%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPP-PXXPXPPPXXPPPXAXXXX 691 G P P P P PP P P P P PP P P P PP Sbjct: 533 GPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPG 592 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P P PP P P P Sbjct: 593 PPGPPGPTRPGPPGP----TRPGPPGPTRPGPP 621 Score = 37.1 bits (82), Expect = 0.028 Identities = 25/92 (27%), Positives = 25/92 (27%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 G P PP PP P P P P P P P P P P P P Sbjct: 527 GPPGPPG--PPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGP-PGPPGPTGPTRPGPP 583 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P PP P P P Sbjct: 584 GPPGPTRPGPPGPPGPTRPGPPGPTRPGPPGP 615 Score = 32.7 bits (71), Expect = 0.60 Identities = 22/86 (25%), Positives = 22/86 (25%), Gaps = 4/86 (4%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPP----XXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXX 692 PP PP P P P P PP P P P P PP Sbjct: 522 PPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPG 581 Query: 693 XXXXXXXXXPXQXXPXXPXXXPPPXP 770 P P P PP P Sbjct: 582 PPGPPGPTRPGPPGPPGPTRPGPPGP 607 Score = 30.7 bits (66), Expect = 2.4 Identities = 22/93 (23%), Positives = 22/93 (23%), Gaps = 1/93 (1%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 G P P P P P P P P P PP P P Sbjct: 502 GGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPT 561 Query: 695 XXXXXXXXXXPXXPXXAXXXPP-PPPPXXPXXP 790 P PP PP P P P Sbjct: 562 RPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPP 594 Score = 29.1 bits (62), Expect = 7.4 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P PP P P P P P P P PP PP Sbjct: 516 PNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPP 558 >AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p protein. Length = 299 Score = 41.9 bits (94), Expect = 0.001 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GG G G G GG GG G G GGGG GG Sbjct: 9 GGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGG 52 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXX-GXGXGXGGGGXXXXGG 524 GG GGGG G G GG GG G G G GGGG GG Sbjct: 8 GGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGG 51 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 G G GGGG G G GG GG G G G GGGG Sbjct: 16 GFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGG 53 Score = 39.5 bits (88), Expect = 0.005 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXG-XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GG GGG G GGG G G G G GGG G GG GG Sbjct: 8 GGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGG 56 Score = 37.9 bits (84), Expect = 0.016 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG G G G G GG GG G G G GGG GG Sbjct: 10 GGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGG 53 Score = 35.5 bits (78), Expect = 0.086 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GG G G G G GG G G G GGG Sbjct: 20 GGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGG 57 Score = 33.5 bits (73), Expect = 0.35 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 636 GGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G G G G GGG G GG GG G Sbjct: 8 GGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGG 46 Score = 33.1 bits (72), Expect = 0.46 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXXXGX 592 GGGGGG G G GGG GGG G GGG G G G Sbjct: 9 GGGGGGRGFGGGGGGGGRGF-----------GGGGGGRGGGGGRGGGGGFGRGGGGRGGG 57 Query: 591 XG 586 G Sbjct: 58 RG 59 Score = 32.7 bits (71), Expect = 0.60 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXG 529 GG GGG GGG G G G G G G G G G Sbjct: 18 GGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRGAFDTG 64 Score = 31.5 bits (68), Expect = 1.4 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXG---XGGXXXGGXG 520 GGG GGG GGG G G G GGG G GG GG G Sbjct: 8 GGG--GGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRG 59 Score = 31.5 bits (68), Expect = 1.4 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPK 511 G G GGG G G G G G G GGG GG G P+ Sbjct: 14 GRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRGAFDTGPPE 67 >AY071088-1|AAL48710.1| 173|Drosophila melanogaster RE15531p protein. Length = 173 Score = 41.9 bits (94), Expect = 0.001 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGGG G G GG GGG G GG G G Sbjct: 24 GLLGGGGGGGGSIGGGAGGIGQLLQSKLGGL------GGGLGGGLGGLSGGLGGKLG-GG 76 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG GG GG G Sbjct: 77 GGGGGYSGGYSNGGGYSGGGGYSGGGG 103 Score = 33.5 bits (73), Expect = 0.35 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G GG GGG G G G + GGG GGG GGG G G Sbjct: 53 GLGGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGG 109 >AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p protein. Length = 268 Score = 41.9 bits (94), Expect = 0.001 Identities = 24/84 (28%), Positives = 24/84 (28%), Gaps = 1/84 (1%) Frame = +2 Query: 542 PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXX 721 PP P PP P P P P PP P P P P Sbjct: 138 PPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPG 197 Query: 722 XPXXPXXAXXXPP-PPPPXXPXXP 790 P P PP PP P P P Sbjct: 198 PPGPPGPTRPGPPGPPGPTRPGPP 221 Score = 38.7 bits (86), Expect = 0.009 Identities = 26/90 (28%), Positives = 26/90 (28%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXX 691 FG P PP PP P P P P P P P P P P PP Sbjct: 162 FGPPGPP--GPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPP-----G 214 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P PP P P P Sbjct: 215 PTRPGPPGPTRPGPPGPTRPGPPGPSPNDP 244 Score = 38.3 bits (85), Expect = 0.012 Identities = 26/93 (27%), Positives = 26/93 (27%), Gaps = 1/93 (1%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPP-PXXPXPPPXXPPPXAXXXX 691 G P P P P PP P P P P PP P P P PP Sbjct: 149 GPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPG 208 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P P PP P P P Sbjct: 209 PPGPPGPTRPGPPGP----TRPGPPGPTRPGPP 237 Score = 37.1 bits (82), Expect = 0.028 Identities = 25/92 (27%), Positives = 25/92 (27%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 G P PP PP P P P P P P P P P P P P Sbjct: 143 GPPGPPG--PPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGP-PGPPGPTGPTRPGPP 199 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P PP P P P Sbjct: 200 GPPGPTRPGPPGPPGPTRPGPPGPTRPGPPGP 231 Score = 32.7 bits (71), Expect = 0.60 Identities = 22/86 (25%), Positives = 22/86 (25%), Gaps = 4/86 (4%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPP----XXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXX 692 PP PP P P P P PP P P P P PP Sbjct: 138 PPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPG 197 Query: 693 XXXXXXXXXPXQXXPXXPXXXPPPXP 770 P P P PP P Sbjct: 198 PPGPPGPTRPGPPGPPGPTRPGPPGP 223 Score = 30.7 bits (66), Expect = 2.4 Identities = 22/93 (23%), Positives = 22/93 (23%), Gaps = 1/93 (1%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 G P P P P P P P P P PP P P Sbjct: 118 GGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPT 177 Query: 695 XXXXXXXXXXPXXPXXAXXXPP-PPPPXXPXXP 790 P PP PP P P P Sbjct: 178 RPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPP 210 Score = 29.1 bits (62), Expect = 7.4 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P PP P P P P P P P PP PP Sbjct: 132 PNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPP 174 >AE014298-2545|AAF48713.1| 173|Drosophila melanogaster CG10598-PA, isoform A protein. Length = 173 Score = 41.9 bits (94), Expect = 0.001 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGGG G G GG GGG G GG G G Sbjct: 24 GLLGGGGGGGGSIGGGAGGIGQLLQSKLGGL------GGGLGGGLGGLSGGLGGKLG-GG 76 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG GG GG G Sbjct: 77 GGGGGYSGGYSNGGGYSGGGGYSGGGG 103 Score = 33.5 bits (73), Expect = 0.35 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G GG GGG G G G + GGG GGG GGG G G Sbjct: 53 GLGGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGG 109 >AE014298-2544|AAN09437.1| 230|Drosophila melanogaster CG10598-PB, isoform B protein. Length = 230 Score = 41.9 bits (94), Expect = 0.001 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGGG G G GG GGG G GG G G Sbjct: 81 GLLGGGGGGGGSIGGGAGGIGQLLQSKLGGL------GGGLGGGLGGLSGGLGGKLG-GG 133 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG GG GG G Sbjct: 134 GGGGGYSGGYSNGGGYSGGGGYSGGGG 160 Score = 33.5 bits (73), Expect = 0.35 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G GG GGG G G G + GGG GGG GGG G G Sbjct: 110 GLGGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGG 166 >AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC, isoform C protein. Length = 682 Score = 41.9 bits (94), Expect = 0.001 Identities = 24/84 (28%), Positives = 24/84 (28%), Gaps = 1/84 (1%) Frame = +2 Query: 542 PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXX 721 PP P PP P P P P PP P P P P Sbjct: 552 PPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPG 611 Query: 722 XPXXPXXAXXXPP-PPPPXXPXXP 790 P P PP PP P P P Sbjct: 612 PPGPPGPTRPGPPGPPGPTRPGPP 635 Score = 38.7 bits (86), Expect = 0.009 Identities = 26/90 (28%), Positives = 26/90 (28%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXX 691 FG P PP PP P P P P P P P P P P PP Sbjct: 576 FGPPGPP--GPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPP-----G 628 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P PP P P P Sbjct: 629 PTRPGPPGPTRPGPPGPTRPGPPGPSPNDP 658 Score = 38.3 bits (85), Expect = 0.012 Identities = 26/93 (27%), Positives = 26/93 (27%), Gaps = 1/93 (1%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPP-PXXPXPPPXXPPPXAXXXX 691 G P P P P PP P P P P PP P P P PP Sbjct: 563 GPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPG 622 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P P PP P P P Sbjct: 623 PPGPPGPTRPGPPGP----TRPGPPGPTRPGPP 651 Score = 37.1 bits (82), Expect = 0.028 Identities = 25/92 (27%), Positives = 25/92 (27%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 G P PP PP P P P P P P P P P P P P Sbjct: 557 GPPGPPG--PPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGP-PGPPGPTGPTRPGPP 613 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P PP P P P Sbjct: 614 GPPGPTRPGPPGPPGPTRPGPPGPTRPGPPGP 645 Score = 32.7 bits (71), Expect = 0.60 Identities = 22/86 (25%), Positives = 22/86 (25%), Gaps = 4/86 (4%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPP----XXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXX 692 PP PP P P P P PP P P P P PP Sbjct: 552 PPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPG 611 Query: 693 XXXXXXXXXPXQXXPXXPXXXPPPXP 770 P P P PP P Sbjct: 612 PPGPPGPTRPGPPGPPGPTRPGPPGP 637 Score = 30.7 bits (66), Expect = 2.4 Identities = 22/93 (23%), Positives = 22/93 (23%), Gaps = 1/93 (1%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 G P P P P P P P P P PP P P Sbjct: 532 GGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPT 591 Query: 695 XXXXXXXXXXPXXPXXAXXXPP-PPPPXXPXXP 790 P PP PP P P P Sbjct: 592 RPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPP 624 Score = 29.1 bits (62), Expect = 7.4 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P PP P P P P P P P PP PP Sbjct: 546 PNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPP 588 >AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB, isoform B protein. Length = 682 Score = 41.9 bits (94), Expect = 0.001 Identities = 24/84 (28%), Positives = 24/84 (28%), Gaps = 1/84 (1%) Frame = +2 Query: 542 PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXX 721 PP P PP P P P P PP P P P P Sbjct: 552 PPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPG 611 Query: 722 XPXXPXXAXXXPP-PPPPXXPXXP 790 P P PP PP P P P Sbjct: 612 PPGPPGPTRPGPPGPPGPTRPGPP 635 Score = 38.7 bits (86), Expect = 0.009 Identities = 26/90 (28%), Positives = 26/90 (28%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXX 691 FG P PP PP P P P P P P P P P P PP Sbjct: 576 FGPPGPP--GPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPP-----G 628 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P PP P P P Sbjct: 629 PTRPGPPGPTRPGPPGPTRPGPPGPSPNDP 658 Score = 38.3 bits (85), Expect = 0.012 Identities = 26/93 (27%), Positives = 26/93 (27%), Gaps = 1/93 (1%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPP-PXXPXPPPXXPPPXAXXXX 691 G P P P P PP P P P P PP P P P PP Sbjct: 563 GPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPG 622 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P P PP P P P Sbjct: 623 PPGPPGPTRPGPPGP----TRPGPPGPTRPGPP 651 Score = 37.1 bits (82), Expect = 0.028 Identities = 25/92 (27%), Positives = 25/92 (27%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 G P PP PP P P P P P P P P P P P P Sbjct: 557 GPPGPPG--PPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGP-PGPPGPTGPTRPGPP 613 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P PP P P P Sbjct: 614 GPPGPTRPGPPGPPGPTRPGPPGPTRPGPPGP 645 Score = 32.7 bits (71), Expect = 0.60 Identities = 22/86 (25%), Positives = 22/86 (25%), Gaps = 4/86 (4%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPP----XXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXX 692 PP PP P P P P PP P P P P PP Sbjct: 552 PPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPG 611 Query: 693 XXXXXXXXXPXQXXPXXPXXXPPPXP 770 P P P PP P Sbjct: 612 PPGPPGPTRPGPPGPPGPTRPGPPGP 637 Score = 30.7 bits (66), Expect = 2.4 Identities = 22/93 (23%), Positives = 22/93 (23%), Gaps = 1/93 (1%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 G P P P P P P P P P PP P P Sbjct: 532 GGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPT 591 Query: 695 XXXXXXXXXXPXXPXXAXXXPP-PPPPXXPXXP 790 P PP PP P P P Sbjct: 592 RPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPP 624 Score = 29.1 bits (62), Expect = 7.4 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P PP P P P P P P P PP PP Sbjct: 546 PNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPP 588 >AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD, isoform D protein. Length = 268 Score = 41.9 bits (94), Expect = 0.001 Identities = 24/84 (28%), Positives = 24/84 (28%), Gaps = 1/84 (1%) Frame = +2 Query: 542 PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXX 721 PP P PP P P P P PP P P P P Sbjct: 138 PPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPG 197 Query: 722 XPXXPXXAXXXPP-PPPPXXPXXP 790 P P PP PP P P P Sbjct: 198 PPGPPGPTRPGPPGPPGPTRPGPP 221 Score = 38.7 bits (86), Expect = 0.009 Identities = 26/90 (28%), Positives = 26/90 (28%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXX 691 FG P PP PP P P P P P P P P P P PP Sbjct: 162 FGPPGPP--GPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPP-----G 214 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P PP P P P Sbjct: 215 PTRPGPPGPTRPGPPGPTRPGPPGPSPNDP 244 Score = 38.3 bits (85), Expect = 0.012 Identities = 26/93 (27%), Positives = 26/93 (27%), Gaps = 1/93 (1%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPP-PXXPXPPPXXPPPXAXXXX 691 G P P P P PP P P P P PP P P P PP Sbjct: 149 GPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPG 208 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P P PP P P P Sbjct: 209 PPGPPGPTRPGPPGP----TRPGPPGPTRPGPP 237 Score = 37.1 bits (82), Expect = 0.028 Identities = 25/92 (27%), Positives = 25/92 (27%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 G P PP PP P P P P P P P P P P P P Sbjct: 143 GPPGPPG--PPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGP-PGPPGPTGPTRPGPP 199 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P PP P P P Sbjct: 200 GPPGPTRPGPPGPPGPTRPGPPGPTRPGPPGP 231 Score = 32.7 bits (71), Expect = 0.60 Identities = 22/86 (25%), Positives = 22/86 (25%), Gaps = 4/86 (4%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPP----XXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXX 692 PP PP P P P P PP P P P P PP Sbjct: 138 PPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPG 197 Query: 693 XXXXXXXXXPXQXXPXXPXXXPPPXP 770 P P P PP P Sbjct: 198 PPGPPGPTRPGPPGPPGPTRPGPPGP 223 Score = 30.7 bits (66), Expect = 2.4 Identities = 22/93 (23%), Positives = 22/93 (23%), Gaps = 1/93 (1%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 G P P P P P P P P P PP P P Sbjct: 118 GGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPT 177 Query: 695 XXXXXXXXXXPXXPXXAXXXPP-PPPPXXPXXP 790 P PP PP P P P Sbjct: 178 RPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPP 210 Score = 29.1 bits (62), Expect = 7.4 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P PP P P P P P P P PP PP Sbjct: 132 PNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPP 174 >AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA, isoform A protein. Length = 268 Score = 41.9 bits (94), Expect = 0.001 Identities = 24/84 (28%), Positives = 24/84 (28%), Gaps = 1/84 (1%) Frame = +2 Query: 542 PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXX 721 PP P PP P P P P PP P P P P Sbjct: 138 PPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPG 197 Query: 722 XPXXPXXAXXXPP-PPPPXXPXXP 790 P P PP PP P P P Sbjct: 198 PPGPPGPTRPGPPGPPGPTRPGPP 221 Score = 38.7 bits (86), Expect = 0.009 Identities = 26/90 (28%), Positives = 26/90 (28%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXX 691 FG P PP PP P P P P P P P P P P PP Sbjct: 162 FGPPGPP--GPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPP-----G 214 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P P PP P P P Sbjct: 215 PTRPGPPGPTRPGPPGPTRPGPPGPSPNDP 244 Score = 38.3 bits (85), Expect = 0.012 Identities = 26/93 (27%), Positives = 26/93 (27%), Gaps = 1/93 (1%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPP-PXXPXPPPXXPPPXAXXXX 691 G P P P P PP P P P P PP P P P PP Sbjct: 149 GPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPG 208 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P P PP P P P Sbjct: 209 PPGPPGPTRPGPPGP----TRPGPPGPTRPGPP 237 Score = 37.1 bits (82), Expect = 0.028 Identities = 25/92 (27%), Positives = 25/92 (27%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 G P PP PP P P P P P P P P P P P P Sbjct: 143 GPPGPPG--PPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGP-PGPPGPTGPTRPGPP 199 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P PP P P P Sbjct: 200 GPPGPTRPGPPGPPGPTRPGPPGPTRPGPPGP 231 Score = 32.7 bits (71), Expect = 0.60 Identities = 22/86 (25%), Positives = 22/86 (25%), Gaps = 4/86 (4%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPP----XXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXX 692 PP PP P P P P PP P P P P PP Sbjct: 138 PPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPG 197 Query: 693 XXXXXXXXXPXQXXPXXPXXXPPPXP 770 P P P PP P Sbjct: 198 PPGPPGPTRPGPPGPPGPTRPGPPGP 223 Score = 30.7 bits (66), Expect = 2.4 Identities = 22/93 (23%), Positives = 22/93 (23%), Gaps = 1/93 (1%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXX 694 G P P P P P P P P P PP P P Sbjct: 118 GGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPT 177 Query: 695 XXXXXXXXXXPXXPXXAXXXPP-PPPPXXPXXP 790 P PP PP P P P Sbjct: 178 RPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPP 210 Score = 29.1 bits (62), Expect = 7.4 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P PP P P P P P P P PP PP Sbjct: 132 PNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPP 174 >BT021407-1|AAX33555.1| 720|Drosophila melanogaster LD06749p protein. Length = 720 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 1/64 (1%) Frame = -3 Query: 677 RXGGGX-XGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGGXXXQKFFX 501 R GGG GGG G G G GG G G G GG GG GG K F Sbjct: 647 RGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGGFGNKSFD 706 Query: 500 XXXP 489 P Sbjct: 707 SSAP 710 Score = 41.1 bits (92), Expect = 0.002 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G GG GG G G G GGGG GG Sbjct: 648 GGGGRGGGGGFGGRGGGGRGGGGGFGGRG-GGGRGGGGFGGRGG 690 Score = 37.5 bits (83), Expect = 0.021 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G G G G G G G GG G GG GG G Sbjct: 648 GGGGRGGGGGFGGRGGGGRGGGGGFGGRG-GGGRGGGGFGGRGGRGGGGRG 697 Score = 37.5 bits (83), Expect = 0.021 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKIF 505 GG GGG G GGG G G G GG G GG GG K F Sbjct: 650 GGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGGFGNKSF 705 Score = 36.7 bits (81), Expect = 0.037 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = -2 Query: 672 GGGXXGGG--XGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G GGG G G G G G G GG GG G Sbjct: 649 GGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGGFG 701 Score = 32.7 bits (71), Expect = 0.60 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = -2 Query: 666 GXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXG-GGXGXGGXXXGGXG 520 G GGG GGG G G G G G GG G GG G G Sbjct: 645 GGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGG 694 >BT012315-1|AAS77440.1| 385|Drosophila melanogaster LD32727p protein. Length = 385 Score = 41.5 bits (93), Expect = 0.001 Identities = 29/92 (31%), Positives = 29/92 (31%), Gaps = 2/92 (2%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GG GG G G G A GGG G G GGG G G Sbjct: 204 GRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSG 263 Query: 609 --XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GG G G GG G Sbjct: 264 GWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYG 295 Score = 37.5 bits (83), Expect = 0.021 Identities = 24/87 (27%), Positives = 24/87 (27%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXXXX 590 G GG G G W G GG GGG G G G Sbjct: 212 GRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGS 271 Query: 589 GGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG G G GG GG N Sbjct: 272 GGGPWNNQGGGNGGWNGGGGGGYGGGN 298 Score = 35.5 bits (78), Expect = 0.086 Identities = 27/93 (29%), Positives = 29/93 (31%) Frame = -2 Query: 798 KKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXG 619 ++ G G GGGG G G GG GG GGG G Sbjct: 231 RQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQ-----GGSGGGPWNNQGGGNGG 285 Query: 618 XXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G GG G GG GG G Sbjct: 286 WNGGGGGGYGGGNSNGSWGGN-GGGGGGGGGFG 317 Score = 33.9 bits (74), Expect = 0.26 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG G GG G GG GG G GGG GG Sbjct: 200 GGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGG 243 Score = 31.9 bits (69), Expect = 1.1 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGX-XGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 GGG GG GGG G G G G GGG G G G P Sbjct: 222 GGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGP 275 Score = 31.5 bits (68), Expect = 1.4 Identities = 22/88 (25%), Positives = 26/88 (29%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXXXX 590 G GGG G G + G G G GG G GG Sbjct: 240 GAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNS 299 Query: 589 GGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 G G G GGGG G +++ Sbjct: 300 NGSWG---GNGGGGGGGGGFGNEYQQSY 324 Score = 29.5 bits (63), Expect = 5.6 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -2 Query: 657 GGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GGG G G G G G G GG GG GG Sbjct: 202 GGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGG 245 Score = 29.5 bits (63), Expect = 5.6 Identities = 25/78 (32%), Positives = 25/78 (32%), Gaps = 1/78 (1%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXG-GGXGGGGXGXGXXGGXXX 599 G G G G G G G G GG GGG G G GG Sbjct: 242 GGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGG-GGGYGGGNSN 300 Query: 598 XXXGGXXXXGXGXGXGGG 545 GG G G G GGG Sbjct: 301 GSWGG---NGGGGGGGGG 315 >AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p protein. Length = 1049 Score = 41.5 bits (93), Expect = 0.001 Identities = 28/90 (31%), Positives = 28/90 (31%), Gaps = 2/90 (2%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP--XXPXPPPXXPPPXAXXXXXXX 700 P PP P PPP P P P P PPP PPP PPP Sbjct: 470 PHAVAPPPPPPPPPLHAFVAPPPP---PPPPPPPPPPLANYGAPPPPPPPPPG------- 519 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P PPPPP P Sbjct: 520 SGSAPPPPPPAPIEGGGGIPPPPPPMSASP 549 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PP PPPP P P PP P P PPPP P Sbjct: 490 PPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 531 Score = 39.5 bits (88), Expect = 0.005 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXP----XPXPPPPXPPP 656 P PPPP P P PP PP P PPPP PPP Sbjct: 470 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 517 Score = 37.5 bits (83), Expect = 0.021 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 10/58 (17%) Frame = +3 Query: 510 FLXXXPPXXXXPPPPXP-----XPXPXXXXPPXXXXXXPPXXPXPXP-----PPPXPP 653 F+ PP PPPP P P P PP PP P P PPP PP Sbjct: 487 FVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 544 Score = 37.1 bits (82), Expect = 0.028 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = +2 Query: 521 PXPPXXXPPX-----PXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPP 670 P PP PP P PPP P P P PPP PP PP Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 >AF162774-1|AAF68853.2| 720|Drosophila melanogaster Nopp140-like nucleolar protein protein. Length = 720 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 1/64 (1%) Frame = -3 Query: 677 RXGGGX-XGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGGXXXQKFFX 501 R GGG GGG G G G GG G G G GG GG GG K F Sbjct: 647 RGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGGFGNKSFD 706 Query: 500 XXXP 489 P Sbjct: 707 SSAP 710 Score = 41.1 bits (92), Expect = 0.002 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G GG GG G G G GGGG GG Sbjct: 648 GGGGRGGGGGFGGRGGGGRGGGGGFGGRG-GGGRGGGGFGGRGG 690 Score = 37.5 bits (83), Expect = 0.021 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G G G G G G G GG G GG GG G Sbjct: 648 GGGGRGGGGGFGGRGGGGRGGGGGFGGRG-GGGRGGGGFGGRGGRGGGGRG 697 Score = 37.5 bits (83), Expect = 0.021 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKIF 505 GG GGG G GGG G G G GG G GG GG K F Sbjct: 650 GGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGGFGNKSF 705 Score = 36.7 bits (81), Expect = 0.037 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = -2 Query: 672 GGGXXGGG--XGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G GGG G G G G G G GG GG G Sbjct: 649 GGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGGFG 701 Score = 32.7 bits (71), Expect = 0.60 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = -2 Query: 666 GXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXG-GGXGXGGXXXGGXG 520 G GGG GGG G G G G G GG G GG G G Sbjct: 645 GGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGG 694 >AE014297-1716|AAF54967.1| 385|Drosophila melanogaster CG12749-PA, isoform A protein. Length = 385 Score = 41.5 bits (93), Expect = 0.001 Identities = 29/92 (31%), Positives = 29/92 (31%), Gaps = 2/92 (2%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GG GG G G G A GGG G G GGG G G Sbjct: 204 GRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSG 263 Query: 609 --XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GG G G GG G Sbjct: 264 GWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYG 295 Score = 37.5 bits (83), Expect = 0.021 Identities = 24/87 (27%), Positives = 24/87 (27%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXXXX 590 G GG G G W G GG GGG G G G Sbjct: 212 GRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGS 271 Query: 589 GGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG G G GG GG N Sbjct: 272 GGGPWNNQGGGNGGWNGGGGGGYGGGN 298 Score = 35.5 bits (78), Expect = 0.086 Identities = 27/93 (29%), Positives = 29/93 (31%) Frame = -2 Query: 798 KKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXG 619 ++ G G GGGG G G GG GG GGG G Sbjct: 231 RQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQ-----GGSGGGPWNNQGGGNGG 285 Query: 618 XXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G GG G GG GG G Sbjct: 286 WNGGGGGGYGGGNSNGSWGGN-GGGGGGGGGFG 317 Score = 33.9 bits (74), Expect = 0.26 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG G GG G GG GG G GGG GG Sbjct: 200 GGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGG 243 Score = 31.9 bits (69), Expect = 1.1 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGX-XGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 GGG GG GGG G G G G GGG G G G P Sbjct: 222 GGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGP 275 Score = 31.5 bits (68), Expect = 1.4 Identities = 22/88 (25%), Positives = 26/88 (29%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXXXX 590 G GGG G G + G G G GG G GG Sbjct: 240 GAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNS 299 Query: 589 GGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 G G G GGGG G +++ Sbjct: 300 NGSWG---GNGGGGGGGGGFGNEYQQSY 324 Score = 29.5 bits (63), Expect = 5.6 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -2 Query: 657 GGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GGG G G G G G G GG GG GG Sbjct: 202 GGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGG 245 Score = 29.5 bits (63), Expect = 5.6 Identities = 25/78 (32%), Positives = 25/78 (32%), Gaps = 1/78 (1%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXG-GGXGGGGXGXGXXGGXXX 599 G G G G G G G G GG GGG G G GG Sbjct: 242 GGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGG-GGGYGGGNSN 300 Query: 598 XXXGGXXXXGXGXGXGGG 545 GG G G G GGG Sbjct: 301 GSWGG---NGGGGGGGGG 315 >AE014297-1715|AAN13574.1| 325|Drosophila melanogaster CG12749-PB, isoform B protein. Length = 325 Score = 41.5 bits (93), Expect = 0.001 Identities = 29/92 (31%), Positives = 29/92 (31%), Gaps = 2/92 (2%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GG GG G G G A GGG G G GGG G G Sbjct: 204 GRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSG 263 Query: 609 --XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GG G G GG G Sbjct: 264 GWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYG 295 Score = 39.1 bits (87), Expect = 0.007 Identities = 29/94 (30%), Positives = 32/94 (34%), Gaps = 3/94 (3%) Frame = -2 Query: 798 KKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGG---GXXGGGXGXXGGG 628 ++ G G GGGG G G G + GG GG G GGG Sbjct: 231 RQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGG 290 Query: 627 XXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G G G GGG G GG GG Sbjct: 291 GGGYGGGNSNGSWGGNGG---GGGGGQGGNMGGG 321 Score = 37.5 bits (83), Expect = 0.021 Identities = 24/87 (27%), Positives = 24/87 (27%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXXXX 590 G GG G G W G GG GGG G G G Sbjct: 212 GRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGS 271 Query: 589 GGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GG G G GG GG N Sbjct: 272 GGGPWNNQGGGNGGWNGGGGGGYGGGN 298 Score = 35.5 bits (78), Expect = 0.086 Identities = 27/92 (29%), Positives = 28/92 (30%), Gaps = 4/92 (4%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXG----GGXXGGGXGXXGGGXX 622 G G GGG G G G + G GG GG GGG Sbjct: 225 GWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNG 284 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G G G GG G GG GG Sbjct: 285 GWNGGGGGGYGGGNSNGSWGGNGGGGGGGQGG 316 Score = 33.9 bits (74), Expect = 0.26 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG G GG G GG GG G GGG GG Sbjct: 200 GGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGG 243 Score = 33.5 bits (73), Expect = 0.35 Identities = 23/82 (28%), Positives = 24/82 (29%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXXXX 590 G GGG G G + G G G GG G GG Sbjct: 240 GAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNS 299 Query: 589 GGXXXXGXGXGXGGGGXXXXGG 524 G G G G GGG GG Sbjct: 300 NGSWG-GNGGGGGGGQGGNMGG 320 Score = 31.9 bits (69), Expect = 1.1 Identities = 24/92 (26%), Positives = 25/92 (27%), Gaps = 1/92 (1%) Frame = -2 Query: 792 KGXXGXXGGGGGGXXXAXXGCX-GXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGX 616 +G G GGG GG G G G G GG GG G Sbjct: 216 QGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGP 275 Query: 615 XGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G GG G Sbjct: 276 WNNQGGGNGGWNGGGGGGYGGGNSNGSWGGNG 307 Score = 31.9 bits (69), Expect = 1.1 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGX-XGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 GGG GG GGG G G G G GGG G G G P Sbjct: 222 GGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGP 275 Score = 29.5 bits (63), Expect = 5.6 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -2 Query: 657 GGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GGG G G G G G G GG GG GG Sbjct: 202 GGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGG 245 >AE014296-3628|AAF51788.3| 720|Drosophila melanogaster CG7421-PA, isoform A protein. Length = 720 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 1/64 (1%) Frame = -3 Query: 677 RXGGGX-XGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGGXXXQKFFX 501 R GGG GGG G G G GG G G G GG GG GG K F Sbjct: 647 RGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGGFGNKSFD 706 Query: 500 XXXP 489 P Sbjct: 707 SSAP 710 Score = 41.1 bits (92), Expect = 0.002 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G GG GG G G G GGGG GG Sbjct: 648 GGGGRGGGGGFGGRGGGGRGGGGGFGGRG-GGGRGGGGFGGRGG 690 Score = 37.5 bits (83), Expect = 0.021 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G G G G G G G GG G GG GG G Sbjct: 648 GGGGRGGGGGFGGRGGGGRGGGGGFGGRG-GGGRGGGGFGGRGGRGGGGRG 697 Score = 37.5 bits (83), Expect = 0.021 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKIF 505 GG GGG G GGG G G G GG G GG GG K F Sbjct: 650 GGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGGFGNKSF 705 Score = 36.7 bits (81), Expect = 0.037 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = -2 Query: 672 GGGXXGGG--XGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G GGG G G G G G G GG GG G Sbjct: 649 GGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGGFG 701 Score = 32.7 bits (71), Expect = 0.60 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = -2 Query: 666 GXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXG-GGXGXGGXXXGGXG 520 G GGG GGG G G G G G GG G GG G G Sbjct: 645 GGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGG 694 >AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA, isoform A protein. Length = 1059 Score = 41.5 bits (93), Expect = 0.001 Identities = 28/90 (31%), Positives = 28/90 (31%), Gaps = 2/90 (2%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP--XXPXPPPXXPPPXAXXXXXXX 700 P PP P PPP P P P P PPP PPP PPP Sbjct: 480 PHAVAPPPPPPPPPLHAFVAPPPP---PPPPPPPPPPLANYGAPPPPPPPPPG------- 529 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P PPPPP P Sbjct: 530 SGSAPPPPPPAPIEGGGGIPPPPPPMSASP 559 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PP PPPP P P PP P P PPPP P Sbjct: 500 PPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 541 Score = 39.5 bits (88), Expect = 0.005 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXP----XPXPPPPXPPP 656 P PPPP P P PP PP P PPPP PPP Sbjct: 480 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 527 Score = 37.5 bits (83), Expect = 0.021 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 10/58 (17%) Frame = +3 Query: 510 FLXXXPPXXXXPPPPXP-----XPXPXXXXPPXXXXXXPPXXPXPXP-----PPPXPP 653 F+ PP PPPP P P P PP PP P P PPP PP Sbjct: 497 FVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 554 Score = 37.1 bits (82), Expect = 0.028 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = +2 Query: 521 PXPPXXXPPX-----PXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPP 670 P PP PP P PPP P P P PPP PP PP Sbjct: 485 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 539 >AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB, isoform B protein. Length = 1049 Score = 41.5 bits (93), Expect = 0.001 Identities = 28/90 (31%), Positives = 28/90 (31%), Gaps = 2/90 (2%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP--XXPXPPPXXPPPXAXXXXXXX 700 P PP P PPP P P P P PPP PPP PPP Sbjct: 470 PHAVAPPPPPPPPPLHAFVAPPPP---PPPPPPPPPPLANYGAPPPPPPPPPG------- 519 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P PPPPP P Sbjct: 520 SGSAPPPPPPAPIEGGGGIPPPPPPMSASP 549 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PP PPPP P P PP P P PPPP P Sbjct: 490 PPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 531 Score = 39.5 bits (88), Expect = 0.005 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXP----XPXPPPPXPPP 656 P PPPP P P PP PP P PPPP PPP Sbjct: 470 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 517 Score = 37.5 bits (83), Expect = 0.021 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 10/58 (17%) Frame = +3 Query: 510 FLXXXPPXXXXPPPPXP-----XPXPXXXXPPXXXXXXPPXXPXPXP-----PPPXPP 653 F+ PP PPPP P P P PP PP P P PPP PP Sbjct: 487 FVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 544 Score = 37.1 bits (82), Expect = 0.028 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = +2 Query: 521 PXPPXXXPPX-----PXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPP 670 P PP PP P PPP P P P PPP PP PP Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 >AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD, isoform D protein. Length = 1207 Score = 41.5 bits (93), Expect = 0.001 Identities = 28/90 (31%), Positives = 28/90 (31%), Gaps = 2/90 (2%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP--XXPXPPPXXPPPXAXXXXXXX 700 P PP P PPP P P P P PPP PPP PPP Sbjct: 628 PHAVAPPPPPPPPPLHAFVAPPPP---PPPPPPPPPPLANYGAPPPPPPPPPG------- 677 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P PPPPP P Sbjct: 678 SGSAPPPPPPAPIEGGGGIPPPPPPMSASP 707 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PP PPPP P P PP P P PPPP P Sbjct: 648 PPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 689 Score = 39.5 bits (88), Expect = 0.005 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXP----XPXPPPPXPPP 656 P PPPP P P PP PP P PPPP PPP Sbjct: 628 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 675 Score = 37.5 bits (83), Expect = 0.021 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 10/58 (17%) Frame = +3 Query: 510 FLXXXPPXXXXPPPPXP-----XPXPXXXXPPXXXXXXPPXXPXPXP-----PPPXPP 653 F+ PP PPPP P P P PP PP P P PPP PP Sbjct: 645 FVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 702 Score = 37.1 bits (82), Expect = 0.028 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = +2 Query: 521 PXPPXXXPPX-----PXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPP 670 P PP PP P PPP P P P PPP PP PP Sbjct: 633 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 687 >AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC, isoform C protein. Length = 1154 Score = 41.5 bits (93), Expect = 0.001 Identities = 28/90 (31%), Positives = 28/90 (31%), Gaps = 2/90 (2%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP--XXPXPPPXXPPPXAXXXXXXX 700 P PP P PPP P P P P PPP PPP PPP Sbjct: 575 PHAVAPPPPPPPPPLHAFVAPPPP---PPPPPPPPPPLANYGAPPPPPPPPPG------- 624 Query: 701 XXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P PPPPP P Sbjct: 625 SGSAPPPPPPAPIEGGGGIPPPPPPMSASP 654 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PP PPPP P P PP P P PPPP P Sbjct: 595 PPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 636 Score = 39.5 bits (88), Expect = 0.005 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXP----XPXPPPPXPPP 656 P PPPP P P PP PP P PPPP PPP Sbjct: 575 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 622 Score = 37.5 bits (83), Expect = 0.021 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 10/58 (17%) Frame = +3 Query: 510 FLXXXPPXXXXPPPPXP-----XPXPXXXXPPXXXXXXPPXXPXPXP-----PPPXPP 653 F+ PP PPPP P P P PP PP P P PPP PP Sbjct: 592 FVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 649 Score = 37.1 bits (82), Expect = 0.028 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = +2 Query: 521 PXPPXXXPPX-----PXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPP 670 P PP PP P PPP P P P PPP PP PP Sbjct: 580 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 634 >AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-PA protein. Length = 460 Score = 41.1 bits (92), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXX---PPXXPXPXPPPPXPPP 656 P P P P P P PP PP P P PPPP PPP Sbjct: 34 PEPYRNPNPNPVPDPTRPPPPPPSPPCGRPPPGSPPPGPPPPGPPP 79 Score = 34.3 bits (75), Expect = 0.20 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXP 667 P P P P P P P P P P P P PPP P Sbjct: 34 PEPYRNPNPNPVPDPTRPPPPPPSPPCGRPPPGSPPPGPPPPGPPPGCP 82 Score = 30.7 bits (66), Expect = 2.4 Identities = 16/59 (27%), Positives = 16/59 (27%) Frame = +1 Query: 496 FXXKNFWXSXPPXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPPXXPPP 672 F W P P P P P P P P PPP PPP Sbjct: 21 FHVNGQWEFPAQYPEPYRNPNPNPVPDPTRPPPPPPSPPCGRPPPGSPPPGPPPPGPPP 79 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPP 655 P P PP P PP P P P P PPP P P Sbjct: 44 PVPDPTRPP-PPPPSPPCGRPPPGSPPPGPP--PPGPPPGCPGGP 85 >BT022701-1|AAY55117.1| 157|Drosophila melanogaster IP07196p protein. Length = 157 Score = 40.3 bits (90), Expect = 0.003 Identities = 26/86 (30%), Positives = 26/86 (30%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GGG GG G GG GG G GGG Sbjct: 31 GAGGGAPGAGGGGPGGRGGGPPQKRGTCGPKPCGGQQCNKCGKGGPGGRGGPGGKGGGPG 90 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXG 544 G G G G GGG G G Sbjct: 91 GRNGPGGSGGPGGRNAPNGGGGGGGG 116 Score = 29.5 bits (63), Expect = 5.6 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = -2 Query: 678 AXGG--GXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXG-GGXGXGGXXXGGXGXP 514 A GG G GGG G GGG G G G GG G G G G P Sbjct: 32 AGGGAPGAGGGGPGGRGGGPPQKRGTCGPKPCGGQQCNKCGKGGPGGRGGPGGKGGGP 89 >AE014297-1019|AAN13441.1| 157|Drosophila melanogaster CG31415-PA protein. Length = 157 Score = 40.3 bits (90), Expect = 0.003 Identities = 26/86 (30%), Positives = 26/86 (30%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G GGG GG G GG GG G GGG Sbjct: 31 GAGGGAPGAGGGGPGGRGGGPPQKRGTCGPKPCGGQQCNKCGKGGPGGRGGPGGKGGGPG 90 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXG 544 G G G G GGG G G Sbjct: 91 GRNGPGGSGGPGGRNAPNGGGGGGGG 116 Score = 29.5 bits (63), Expect = 5.6 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = -2 Query: 678 AXGG--GXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXG-GGXGXGGXXXGGXGXP 514 A GG G GGG G GGG G G G GG G G G G P Sbjct: 32 AGGGAPGAGGGGPGGRGGGPPQKRGTCGPKPCGGQQCNKCGKGGPGGRGGPGGKGGGP 89 >AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p protein. Length = 527 Score = 39.9 bits (89), Expect = 0.004 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PPP P P P PP P PPP PPP Sbjct: 357 PPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPP 400 Score = 37.9 bits (84), Expect = 0.016 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPP---XPPP 656 P PPP P P PP P P P PPPP PPP Sbjct: 351 PGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPP 396 Score = 35.5 bits (78), Expect = 0.086 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXP----XPPPXXPPPXA 679 P PP PP P P P P PPP PPP PPP A Sbjct: 335 PLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPA 391 Score = 35.1 bits (77), Expect = 0.11 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPP 670 P PP PPP P P PPP PPP PP Sbjct: 351 PGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPP 400 Score = 35.1 bits (77), Expect = 0.11 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP PP PP P P P PPP PPP P P Sbjct: 357 PPPPNRPPPISTAPP-----PPPVSAPVVAPPPPPPPPPAAVPPPPPPPMP 402 Score = 34.7 bits (76), Expect = 0.15 Identities = 26/86 (30%), Positives = 26/86 (30%), Gaps = 12/86 (13%) Frame = +2 Query: 551 PXPPPXXXXXXXPXXPXXXXPXXPXX-PPPXXPX---------PPPXXPPP--XAXXXXX 694 P PPP P P PPP P PPP PPP A Sbjct: 315 PMPPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPP 374 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPP 772 P P A PPPPPP Sbjct: 375 VSAPVVAPPPPPPPPPAAVPPPPPPP 400 >AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC, isoform C protein. Length = 494 Score = 39.9 bits (89), Expect = 0.004 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PPP P P P PP P PPP PPP Sbjct: 324 PPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPP 367 Score = 37.9 bits (84), Expect = 0.016 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPP---XPPP 656 P PPP P P PP P P P PPPP PPP Sbjct: 318 PGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPP 363 Score = 35.5 bits (78), Expect = 0.086 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXP----XPPPXXPPPXA 679 P PP PP P P P P PPP PPP PPP A Sbjct: 302 PLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPA 358 Score = 35.1 bits (77), Expect = 0.11 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPP 670 P PP PPP P P PPP PPP PP Sbjct: 318 PGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPP 367 Score = 35.1 bits (77), Expect = 0.11 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP PP PP P P P PPP PPP P P Sbjct: 324 PPPPNRPPPISTAPP-----PPPVSAPVVAPPPPPPPPPAAVPPPPPPPMP 369 Score = 34.7 bits (76), Expect = 0.15 Identities = 26/86 (30%), Positives = 26/86 (30%), Gaps = 12/86 (13%) Frame = +2 Query: 551 PXPPPXXXXXXXPXXPXXXXPXXPXX-PPPXXPX---------PPPXXPPP--XAXXXXX 694 P PPP P P PPP P PPP PPP A Sbjct: 282 PMPPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPP 341 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPP 772 P P A PPPPPP Sbjct: 342 VSAPVVAPPPPPPPPPAAVPPPPPPP 367 >AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB, isoform B protein. Length = 527 Score = 39.9 bits (89), Expect = 0.004 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PPP P P P PP P PPP PPP Sbjct: 357 PPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPP 400 Score = 37.9 bits (84), Expect = 0.016 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPP---XPPP 656 P PPP P P PP P P P PPPP PPP Sbjct: 351 PGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPP 396 Score = 35.5 bits (78), Expect = 0.086 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXP----XPPPXXPPPXA 679 P PP PP P P P P PPP PPP PPP A Sbjct: 335 PLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPA 391 Score = 35.1 bits (77), Expect = 0.11 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPP 670 P PP PPP P P PPP PPP PP Sbjct: 351 PGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPP 400 Score = 35.1 bits (77), Expect = 0.11 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP PP PP P P P PPP PPP P P Sbjct: 357 PPPPNRPPPISTAPP-----PPPVSAPVVAPPPPPPPPPAAVPPPPPPPMP 402 Score = 34.7 bits (76), Expect = 0.15 Identities = 26/86 (30%), Positives = 26/86 (30%), Gaps = 12/86 (13%) Frame = +2 Query: 551 PXPPPXXXXXXXPXXPXXXXPXXPXX-PPPXXPX---------PPPXXPPP--XAXXXXX 694 P PPP P P PPP P PPP PPP A Sbjct: 315 PMPPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPP 374 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPP 772 P P A PPPPPP Sbjct: 375 VSAPVVAPPPPPPPPPAAVPPPPPPP 400 >AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA, isoform A protein. Length = 527 Score = 39.9 bits (89), Expect = 0.004 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PPP P P P PP P PPP PPP Sbjct: 357 PPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPP 400 Score = 37.9 bits (84), Expect = 0.016 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPP---XPPP 656 P PPP P P PP P P P PPPP PPP Sbjct: 351 PGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPP 396 Score = 35.5 bits (78), Expect = 0.086 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXP----XPPPXXPPPXA 679 P PP PP P P P P PPP PPP PPP A Sbjct: 335 PLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPA 391 Score = 35.1 bits (77), Expect = 0.11 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPP 670 P PP PPP P P PPP PPP PP Sbjct: 351 PGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPP 400 Score = 35.1 bits (77), Expect = 0.11 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP PP PP P P P PPP PPP P P Sbjct: 357 PPPPNRPPPISTAPP-----PPPVSAPVVAPPPPPPPPPAAVPPPPPPPMP 402 Score = 34.7 bits (76), Expect = 0.15 Identities = 26/86 (30%), Positives = 26/86 (30%), Gaps = 12/86 (13%) Frame = +2 Query: 551 PXPPPXXXXXXXPXXPXXXXPXXPXX-PPPXXPX---------PPPXXPPP--XAXXXXX 694 P PPP P P PPP P PPP PPP A Sbjct: 315 PMPPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPP 374 Query: 695 XXXXXXXXXXPXXPXXAXXXPPPPPP 772 P P A PPPPPP Sbjct: 375 VSAPVVAPPPPPPPPPAAVPPPPPPP 400 >BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p protein. Length = 207 Score = 39.5 bits (88), Expect = 0.005 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PPPP P P P PP P P P PP PPP Sbjct: 52 PPPKPRPPPPPPPP-PTTTRPPTTTPT-PTTTPTPITTPPPPPP 93 Score = 37.9 bits (84), Expect = 0.016 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 PP PP P PPP P P PP P PP PPP Sbjct: 53 PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPP--PPPPSAPPPP 99 Score = 37.5 bits (83), Expect = 0.021 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +3 Query: 525 PPXXXXPPPPXPXPX---PXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PPPP P P P P P P P PP PPP Sbjct: 53 PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPP 99 Score = 35.9 bits (79), Expect = 0.065 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Frame = +2 Query: 629 PPPXXPXPPPXX-PPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P P PPP PPP P PPPPPP P P Sbjct: 45 PTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPP 99 Score = 35.9 bits (79), Expect = 0.065 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP P P PPP P P P P PPP PPP Sbjct: 50 PAPPPKPRPPPPPPPPPTTTRPP--TTTPTPTTTPTPITTPPPPPPSAPPP 98 Score = 34.3 bits (75), Expect = 0.20 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXX-PXPPPXXPPP 673 F P P PP P PPP P P P P P PPP PP Sbjct: 44 FPTPSAPAP-PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPP 97 Score = 32.7 bits (71), Expect = 0.60 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXP 667 P P PP P PP P PPP PPP P Sbjct: 53 PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDP 101 Score = 32.3 bits (70), Expect = 0.80 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +3 Query: 588 PXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXXXXXXXXPXQXXPXXPXXXPPPX 767 P PP P P PPPP PP P P P PPP Sbjct: 45 PTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPP----PPPPSAPPPPD 100 Query: 768 P 770 P Sbjct: 101 P 101 Score = 31.5 bits (68), Expect = 1.4 Identities = 22/77 (28%), Positives = 22/77 (28%) Frame = +2 Query: 551 PXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPX 730 P P P P P P PPP PP P P P Sbjct: 38 PYVPDNFPTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTT-------TPTPITTPPP 90 Query: 731 XPXXAXXXPPPPPPXXP 781 P A PPPP P P Sbjct: 91 PPPSA---PPPPDPATP 104 Score = 29.1 bits (62), Expect = 7.4 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXP 667 P PP PP P P P PP P P P P Sbjct: 56 PRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 104 >BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p protein. Length = 207 Score = 39.5 bits (88), Expect = 0.005 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PPPP P P P PP P P P PP PPP Sbjct: 52 PPPKPRPPPPPPPP-PTTTRPPTTTPT-PTTTPTPITTPPPPPP 93 Score = 37.9 bits (84), Expect = 0.016 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 PP PP P PPP P P PP P PP PPP Sbjct: 53 PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPP--PPPPSAPPPP 99 Score = 37.5 bits (83), Expect = 0.021 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +3 Query: 525 PPXXXXPPPPXPXPX---PXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PPPP P P P P P P P PP PPP Sbjct: 53 PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPP 99 Score = 35.9 bits (79), Expect = 0.065 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Frame = +2 Query: 629 PPPXXPXPPPXX-PPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P P PPP PPP P PPPPPP P P Sbjct: 45 PTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPP 99 Score = 35.9 bits (79), Expect = 0.065 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP P P PPP P P P P PPP PPP Sbjct: 50 PAPPPKPRPPPPPPPPPTTTRPP--TTTPTPTTTPTPITTPPPPPPSAPPP 98 Score = 34.3 bits (75), Expect = 0.20 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXX-PXPPPXXPPP 673 F P P PP P PPP P P P P P PPP PP Sbjct: 44 FPTPSAPAP-PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPP 97 Score = 32.7 bits (71), Expect = 0.60 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXP 667 P P PP P PP P PPP PPP P Sbjct: 53 PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDP 101 Score = 32.3 bits (70), Expect = 0.80 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +3 Query: 588 PXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXXXXXXXXPXQXXPXXPXXXPPPX 767 P PP P P PPPP PP P P P PPP Sbjct: 45 PTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPP----PPPPSAPPPPD 100 Query: 768 P 770 P Sbjct: 101 P 101 Score = 31.5 bits (68), Expect = 1.4 Identities = 22/77 (28%), Positives = 22/77 (28%) Frame = +2 Query: 551 PXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPX 730 P P P P P P PPP PP P P P Sbjct: 38 PYVPDNFPTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTT-------TPTPITTPPP 90 Query: 731 XPXXAXXXPPPPPPXXP 781 P A PPPP P P Sbjct: 91 PPPSA---PPPPDPATP 104 Score = 29.1 bits (62), Expect = 7.4 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXP 667 P PP PP P P P PP P P P P Sbjct: 56 PRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 104 >BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p protein. Length = 212 Score = 39.5 bits (88), Expect = 0.005 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 549 PPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP P P PP PP P P PP P PPP Sbjct: 76 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPP 111 Score = 33.9 bits (74), Expect = 0.26 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P P PP PP P P PPP P P Sbjct: 76 PPQWSPGPPAYPPPPQRPWGPP------PPPGPPPPGPPPPPGP 113 Score = 30.7 bits (66), Expect = 2.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 552 PXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P P PP P PPPP PPP Sbjct: 70 PRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPP 104 Score = 30.7 bits (66), Expect = 2.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPPXXPPP 673 P P PPP PPP PPP Sbjct: 90 PQRPWGPPPPPGPPPPGPPPP 110 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 553 PXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPPXXPPP 672 P P P PP P P PPP PPP Sbjct: 70 PRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPP 109 Score = 29.5 bits (63), Expect = 5.6 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPP 565 +G P PP PP P PPP Sbjct: 94 WGPPPPPGPPPPGPPPPP 111 Score = 29.1 bits (62), Expect = 7.4 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P P PP P P P PP P P P P P Sbjct: 76 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 117 Score = 29.1 bits (62), Expect = 7.4 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 560 PPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 PP P P P PPP P PP PPP Sbjct: 76 PPQWSPGPPAYPPPPQRPWGP--PPPPGPPPPGPPPPP 111 >AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p protein. Length = 242 Score = 39.5 bits (88), Expect = 0.005 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 549 PPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP P P PP PP P P PP P PPP Sbjct: 106 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPP 141 Score = 33.9 bits (74), Expect = 0.26 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P P PP PP P P PPP P P Sbjct: 106 PPQWSPGPPAYPPPPQRPWGPP------PPPGPPPPGPPPPPGP 143 Score = 31.9 bits (69), Expect = 1.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP P P PP PP P PPPP PPP Sbjct: 93 PPEDQQHPRQYGYPPQWSPGPPAYPP--PPQRPWGPPPPPGPPP 134 Score = 30.7 bits (66), Expect = 2.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPPXXPPP 673 P P PPP PPP PPP Sbjct: 120 PQRPWGPPPPPGPPPPGPPPP 140 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 553 PXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPPXXPPP 672 P P P PP P P PPP PPP Sbjct: 100 PRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPP 139 Score = 29.5 bits (63), Expect = 5.6 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPP 565 +G P PP PP P PPP Sbjct: 124 WGPPPPPGPPPPGPPPPP 141 Score = 29.1 bits (62), Expect = 7.4 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 4/43 (9%) Frame = +2 Query: 557 PPPXXXXXXXPXXPXXXXPXXPXXPP----PXXPXPPPXXPPP 673 PP P P P PP P P PPP PPP Sbjct: 93 PPEDQQHPRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPPP 135 Score = 29.1 bits (62), Expect = 7.4 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P P PP P P P PP P P P P P Sbjct: 106 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 147 Score = 29.1 bits (62), Expect = 7.4 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 560 PPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 PP P P P PPP P PP PPP Sbjct: 106 PPQWSPGPPAYPPPPQRPWGP--PPPPGPPPPGPPPPP 141 >AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA, isoform A protein. Length = 242 Score = 39.5 bits (88), Expect = 0.005 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 549 PPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP P P PP PP P P PP P PPP Sbjct: 106 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPP 141 Score = 33.9 bits (74), Expect = 0.26 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P P PP PP P P PPP P P Sbjct: 106 PPQWSPGPPAYPPPPQRPWGPP------PPPGPPPPGPPPPPGP 143 Score = 31.9 bits (69), Expect = 1.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP P P PP PP P PPPP PPP Sbjct: 93 PPEDQQHPRQYGYPPQWSPGPPAYPP--PPQRPWGPPPPPGPPP 134 Score = 30.7 bits (66), Expect = 2.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPPXXPPP 673 P P PPP PPP PPP Sbjct: 120 PQRPWGPPPPPGPPPPGPPPP 140 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 553 PXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPPXXPPP 672 P P P PP P P PPP PPP Sbjct: 100 PRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPP 139 Score = 29.5 bits (63), Expect = 5.6 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPP 565 +G P PP PP P PPP Sbjct: 124 WGPPPPPGPPPPGPPPPP 141 Score = 29.1 bits (62), Expect = 7.4 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 4/43 (9%) Frame = +2 Query: 557 PPPXXXXXXXPXXPXXXXPXXPXXPP----PXXPXPPPXXPPP 673 PP P P P PP P P PPP PPP Sbjct: 93 PPEDQQHPRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPPP 135 Score = 29.1 bits (62), Expect = 7.4 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P P PP P P P PP P P P P P Sbjct: 106 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 147 Score = 29.1 bits (62), Expect = 7.4 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 560 PPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 PP P P P PPP P PP PPP Sbjct: 106 PPQWSPGPPAYPPPPQRPWGP--PPPPGPPPPGPPPPP 141 >AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB, isoform B protein. Length = 212 Score = 39.5 bits (88), Expect = 0.005 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 549 PPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP P P PP PP P P PP P PPP Sbjct: 76 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPP 111 Score = 33.9 bits (74), Expect = 0.26 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P P PP PP P P PPP P P Sbjct: 76 PPQWSPGPPAYPPPPQRPWGPP------PPPGPPPPGPPPPPGP 113 Score = 30.7 bits (66), Expect = 2.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 552 PXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P P PP P PPPP PPP Sbjct: 70 PRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPP 104 Score = 30.7 bits (66), Expect = 2.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPPXXPPP 673 P P PPP PPP PPP Sbjct: 90 PQRPWGPPPPPGPPPPGPPPP 110 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 553 PXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPPXXPPP 672 P P P PP P P PPP PPP Sbjct: 70 PRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPP 109 Score = 29.5 bits (63), Expect = 5.6 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPP 565 +G P PP PP P PPP Sbjct: 94 WGPPPPPGPPPPGPPPPP 111 Score = 29.1 bits (62), Expect = 7.4 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P P PP P P P PP P P P P P Sbjct: 76 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 117 Score = 29.1 bits (62), Expect = 7.4 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 560 PPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 PP P P P PPP P PP PPP Sbjct: 76 PPQWSPGPPAYPPPPQRPWGP--PPPPGPPPPGPPPPP 111 >AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA protein. Length = 1118 Score = 39.5 bits (88), Expect = 0.005 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PPPP P P P PP P P P PP PPP Sbjct: 34 PPPKPRPPPPPPPP-PTTTRPPTTTPT-PTTTPTPITTPPPPPP 75 Score = 37.9 bits (84), Expect = 0.016 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 PP PP P PPP P P PP P PP PPP Sbjct: 35 PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPP--PPPPSAPPPP 81 Score = 37.5 bits (83), Expect = 0.021 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +3 Query: 525 PPXXXXPPPPXPXPX---PXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PPPP P P P P P P P PP PPP Sbjct: 35 PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPP 81 Score = 35.9 bits (79), Expect = 0.065 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Frame = +2 Query: 629 PPPXXPXPPPXX-PPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P P PPP PPP P PPPPPP P P Sbjct: 27 PTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPP 81 Score = 35.9 bits (79), Expect = 0.065 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP P P PPP P P P P PPP PPP Sbjct: 32 PAPPPKPRPPPPPPPPPTTTRPP--TTTPTPTTTPTPITTPPPPPPSAPPP 80 Score = 34.3 bits (75), Expect = 0.20 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXX-PXPPPXXPPP 673 F P P PP P PPP P P P P P PPP PP Sbjct: 26 FPTPSAPAP-PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPP 79 Score = 32.7 bits (71), Expect = 0.60 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXP 667 P P PP P PP P PPP PPP P Sbjct: 35 PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDP 83 Score = 32.3 bits (70), Expect = 0.80 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +3 Query: 588 PXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXXXXXXXXPXQXXPXXPXXXPPPX 767 P PP P P PPPP PP P P P PPP Sbjct: 27 PTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPP----PPPPSAPPPPD 82 Query: 768 P 770 P Sbjct: 83 P 83 Score = 31.5 bits (68), Expect = 1.4 Identities = 22/77 (28%), Positives = 22/77 (28%) Frame = +2 Query: 551 PXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPX 730 P P P P P P PPP PP P P P Sbjct: 20 PYVPDNFPTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTT-------TPTPITTPPP 72 Query: 731 XPXXAXXXPPPPPPXXP 781 P A PPPP P P Sbjct: 73 PPPSA---PPPPDPATP 86 Score = 29.1 bits (62), Expect = 7.4 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXP 667 P PP PP P P P PP P P P P Sbjct: 38 PRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 86 >BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p protein. Length = 399 Score = 39.1 bits (87), Expect = 0.007 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXG---XGGXXXGGXG 520 GGG GGG G GG G G G G GGG G GG GG G Sbjct: 215 GGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGG 268 Score = 38.7 bits (86), Expect = 0.009 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G GG G G G GGGG Sbjct: 232 GGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGG 269 Score = 38.3 bits (85), Expect = 0.012 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G G G G G G GGG G G GG G Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGG 263 Score = 38.3 bits (85), Expect = 0.012 Identities = 22/63 (34%), Positives = 23/63 (36%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKIFXXKX 493 GG GGG G GGG G G G GGG G GG G K Sbjct: 227 GGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNVQPRDGDWKCNSCNN 286 Query: 492 SNF 484 +NF Sbjct: 287 TNF 289 Score = 35.9 bits (79), Expect = 0.065 Identities = 23/59 (38%), Positives = 24/59 (40%), Gaps = 5/59 (8%) Frame = -2 Query: 672 GGGXXGG-----GXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPK 511 GGG GG G G GGG G G G G GGG G GG GG P+ Sbjct: 219 GGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGG--GGGNVQPR 275 Score = 34.7 bits (76), Expect = 0.15 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG GG G G G G GGG G GG G Sbjct: 214 GGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGG 264 Score = 34.7 bits (76), Expect = 0.15 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GG G GGG G G G G GG GG G Sbjct: 310 GGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGG 360 Score = 33.5 bits (73), Expect = 0.35 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G GGGGGG G G GGG GG GGG G G Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGG 269 Score = 31.5 bits (68), Expect = 1.4 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG GGGG G G GG G GGG GG F Sbjct: 315 GGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRF 364 Score = 31.1 bits (67), Expect = 1.8 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKI 508 GG GG GG G G GGG G GG G G I Sbjct: 63 GGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGGGGGGGSGGNDMI 116 Score = 30.7 bits (66), Expect = 2.4 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG GG G GGG G GG GG G Sbjct: 61 GNGGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGGGGGGGSG 111 Score = 30.7 bits (66), Expect = 2.4 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXG-XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GGG G G G GG GG GG G Sbjct: 307 GSSGGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGG 358 Score = 30.7 bits (66), Expect = 2.4 Identities = 24/85 (28%), Positives = 25/85 (29%), Gaps = 1/85 (1%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWX-GXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXX 599 G G GGG G G + G GGG GGGG G Sbjct: 310 GGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNG 369 Query: 598 XXXGGXXXXGXGXGXGGGGXXXXGG 524 GG G G GG GG Sbjct: 370 GGRGG-RGGGGGNRRDGGPMRNDGG 393 Score = 30.3 bits (65), Expect = 3.2 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -3 Query: 677 RXGGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 + GGG GGG G G G GG G G GG G GG Sbjct: 212 KGGGGG-GGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGG 261 Score = 30.3 bits (65), Expect = 3.2 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 677 RXGGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGG 540 R GGG GGG G G GG G G G GG GG Sbjct: 229 RRGGGGGGGGGGGGGGRFDRGGG----GGGGRYDRGGGGGGGGGGG 270 Score = 30.3 bits (65), Expect = 3.2 Identities = 22/87 (25%), Positives = 22/87 (25%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGGG G G G G G GGG G Sbjct: 307 GSSGGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFND 366 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GG GG G Sbjct: 367 NNGGGRGGRGGGGGNRRDGGPMRNDGG 393 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 666 GXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG G G G G G G GG G Sbjct: 56 GSGGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGG 104 Score = 28.7 bits (61), Expect = 9.8 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXG 643 G + G G GGGGGG G G GGG GGG G Sbjct: 221 GGRGGFGGRRGGGGGG---GGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGG 270 >BT003283-1|AAO25040.1| 178|Drosophila melanogaster HL05737p protein. Length = 178 Score = 39.1 bits (87), Expect = 0.007 Identities = 29/91 (31%), Positives = 30/91 (32%) Frame = -2 Query: 792 KGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXX 613 +G G GGG GG G G GGG G G G GGG G Sbjct: 85 QGSYGGYGGGYGGYGAGGYGDYYAGGYYNGYDYGYDGYGYGGGFEGNGYGGGGGGNMGGG 144 Query: 612 GXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG GG GG G Sbjct: 145 RGGPRGGGG-----PKGGGGFNGGKQRGGGG 170 Score = 33.5 bits (73), Expect = 0.35 Identities = 26/94 (27%), Positives = 27/94 (28%), Gaps = 4/94 (4%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXG----GGXXGXX 613 G GG GG G G GGG G G G G GG Sbjct: 56 GMRGGPRGGMRGGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYYAGGYYNGY 115 Query: 612 GXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPK 511 G G G G GG GG G P+ Sbjct: 116 DYGYDGYGYGGGFEGNGYGGGGGGNMGGGRGGPR 149 Score = 32.3 bits (70), Expect = 0.80 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 G G GGG G G GG GG G G GGG G Sbjct: 121 GYGYGGGFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGG 163 >BT001384-1|AAN71139.1| 178|Drosophila melanogaster GH03391p protein. Length = 178 Score = 39.1 bits (87), Expect = 0.007 Identities = 29/91 (31%), Positives = 30/91 (32%) Frame = -2 Query: 792 KGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXX 613 +G G GGG GG G G GGG G G G GGG G Sbjct: 85 QGSYGGYGGGYGGYGAGGYGDYYAGGYYNGYDYGYDGYGYGGGFEGNGYGGGGGGNMGGG 144 Query: 612 GXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG GG GG G Sbjct: 145 RGGPRGGGG-----PKGGGGFNGGKQRGGGG 170 Score = 33.5 bits (73), Expect = 0.35 Identities = 26/94 (27%), Positives = 27/94 (28%), Gaps = 4/94 (4%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXG----GGXXGXX 613 G GG GG G G GGG G G G G GG Sbjct: 56 GMRGGPRGGMRGGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYYAGGYYNGY 115 Query: 612 GXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPK 511 G G G G GG GG G P+ Sbjct: 116 DYGYDGYGYGGGFEGNGYGGGGGGNMGGGRGGPR 149 Score = 32.3 bits (70), Expect = 0.80 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 G G GGG G G GG GG G G GGG G Sbjct: 121 GYGYGGGFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGG 163 >AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB, isoform B protein. Length = 399 Score = 39.1 bits (87), Expect = 0.007 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXG---XGGXXXGGXG 520 GGG GGG G GG G G G G GGG G GG GG G Sbjct: 215 GGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGG 268 Score = 38.7 bits (86), Expect = 0.009 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G GG G G G GGGG Sbjct: 232 GGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGG 269 Score = 38.3 bits (85), Expect = 0.012 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G G G G G G GGG G G GG G Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGG 263 Score = 38.3 bits (85), Expect = 0.012 Identities = 22/63 (34%), Positives = 23/63 (36%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKIFXXKX 493 GG GGG G GGG G G G GGG G GG G K Sbjct: 227 GGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNVQPRDGDWKCNSCNN 286 Query: 492 SNF 484 +NF Sbjct: 287 TNF 289 Score = 35.9 bits (79), Expect = 0.065 Identities = 23/59 (38%), Positives = 24/59 (40%), Gaps = 5/59 (8%) Frame = -2 Query: 672 GGGXXGG-----GXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPK 511 GGG GG G G GGG G G G G GGG G GG GG P+ Sbjct: 219 GGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGG--GGGNVQPR 275 Score = 34.7 bits (76), Expect = 0.15 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG GG G G G G GGG G GG G Sbjct: 214 GGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGG 264 Score = 34.7 bits (76), Expect = 0.15 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GG G GGG G G G G GG GG G Sbjct: 310 GGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGG 360 Score = 33.5 bits (73), Expect = 0.35 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G GGGGGG G G GGG GG GGG G G Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGG 269 Score = 31.5 bits (68), Expect = 1.4 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG GGGG G G GG G GGG GG F Sbjct: 315 GGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRF 364 Score = 31.1 bits (67), Expect = 1.8 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKI 508 GG GG GG G G GGG G GG G G I Sbjct: 63 GGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGGGGGGGSGGNDMI 116 Score = 30.7 bits (66), Expect = 2.4 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG GG G GGG G GG GG G Sbjct: 61 GNGGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGGGGGGGSG 111 Score = 30.7 bits (66), Expect = 2.4 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXG-XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GGG G G G GG GG GG G Sbjct: 307 GSSGGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGG 358 Score = 30.7 bits (66), Expect = 2.4 Identities = 24/85 (28%), Positives = 25/85 (29%), Gaps = 1/85 (1%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWX-GXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXX 599 G G GGG G G + G GGG GGGG G Sbjct: 310 GGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNG 369 Query: 598 XXXGGXXXXGXGXGXGGGGXXXXGG 524 GG G G GG GG Sbjct: 370 GGRGG-RGGGGGNRRDGGPMRNDGG 393 Score = 30.3 bits (65), Expect = 3.2 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -3 Query: 677 RXGGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 + GGG GGG G G G GG G G GG G GG Sbjct: 212 KGGGGG-GGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGG 261 Score = 30.3 bits (65), Expect = 3.2 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 677 RXGGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGG 540 R GGG GGG G G GG G G G GG GG Sbjct: 229 RRGGGGGGGGGGGGGGRFDRGGG----GGGGRYDRGGGGGGGGGGG 270 Score = 30.3 bits (65), Expect = 3.2 Identities = 22/87 (25%), Positives = 22/87 (25%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGGG G G G G G GGG G Sbjct: 307 GSSGGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFND 366 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GG GG G Sbjct: 367 NNGGGRGGRGGGGGNRRDGGPMRNDGG 393 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 666 GXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG G G G G G G GG G Sbjct: 56 GSGGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGG 104 Score = 28.7 bits (61), Expect = 9.8 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXG 643 G + G G GGGGGG G G GGG GGG G Sbjct: 221 GGRGGFGGRRGGGGGG---GGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGG 270 >AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA, isoform A protein. Length = 399 Score = 39.1 bits (87), Expect = 0.007 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXG---XGGXXXGGXG 520 GGG GGG G GG G G G G GGG G GG GG G Sbjct: 215 GGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGG 268 Score = 38.7 bits (86), Expect = 0.009 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G GG G G G GGGG Sbjct: 232 GGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGG 269 Score = 38.3 bits (85), Expect = 0.012 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G G G G G G GGG G G GG G Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGG 263 Score = 38.3 bits (85), Expect = 0.012 Identities = 22/63 (34%), Positives = 23/63 (36%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKIFXXKX 493 GG GGG G GGG G G G GGG G GG G K Sbjct: 227 GGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNVQPRDGDWKCNSCNN 286 Query: 492 SNF 484 +NF Sbjct: 287 TNF 289 Score = 35.9 bits (79), Expect = 0.065 Identities = 23/59 (38%), Positives = 24/59 (40%), Gaps = 5/59 (8%) Frame = -2 Query: 672 GGGXXGG-----GXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPK 511 GGG GG G G GGG G G G G GGG G GG GG P+ Sbjct: 219 GGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGG--GGGNVQPR 275 Score = 34.7 bits (76), Expect = 0.15 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG GG G G G G GGG G GG G Sbjct: 214 GGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGG 264 Score = 34.7 bits (76), Expect = 0.15 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GG G GGG G G G G GG GG G Sbjct: 310 GGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGG 360 Score = 33.5 bits (73), Expect = 0.35 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G GGGGGG G G GGG GG GGG G G Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGG 269 Score = 31.5 bits (68), Expect = 1.4 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKNF 506 GG GGGG G G GG G GGG GG F Sbjct: 315 GGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRF 364 Score = 31.1 bits (67), Expect = 1.8 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKI 508 GG GG GG G G GGG G GG G G I Sbjct: 63 GGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGGGGGGGSGGNDMI 116 Score = 30.7 bits (66), Expect = 2.4 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG GG G GGG G GG GG G Sbjct: 61 GNGGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGGGGGGGSG 111 Score = 30.7 bits (66), Expect = 2.4 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXG-XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GGG G GGG G G G GG GG GG G Sbjct: 307 GSSGGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGG 358 Score = 30.7 bits (66), Expect = 2.4 Identities = 24/85 (28%), Positives = 25/85 (29%), Gaps = 1/85 (1%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWX-GXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXX 599 G G GGG G G + G GGG GGGG G Sbjct: 310 GGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNG 369 Query: 598 XXXGGXXXXGXGXGXGGGGXXXXGG 524 GG G G GG GG Sbjct: 370 GGRGG-RGGGGGNRRDGGPMRNDGG 393 Score = 30.3 bits (65), Expect = 3.2 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -3 Query: 677 RXGGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 + GGG GGG G G G GG G G GG G GG Sbjct: 212 KGGGGG-GGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGG 261 Score = 30.3 bits (65), Expect = 3.2 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 677 RXGGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGG 540 R GGG GGG G G GG G G G GG GG Sbjct: 229 RRGGGGGGGGGGGGGGRFDRGGG----GGGGRYDRGGGGGGGGGGG 270 Score = 30.3 bits (65), Expect = 3.2 Identities = 22/87 (25%), Positives = 22/87 (25%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGGG G G G G G GGG G Sbjct: 307 GSSGGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFND 366 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GG GG G Sbjct: 367 NNGGGRGGRGGGGGNRRDGGPMRNDGG 393 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 666 GXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG G G G G G G GG G Sbjct: 56 GSGGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGG 104 Score = 28.7 bits (61), Expect = 9.8 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXG 643 G + G G GGGGGG G G GGG GGG G Sbjct: 221 GGRGGFGGRRGGGGGG---GGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGG 270 >AE014297-1707|AAS65146.1| 178|Drosophila melanogaster CG16901-PD, isoform D protein. Length = 178 Score = 39.1 bits (87), Expect = 0.007 Identities = 29/91 (31%), Positives = 30/91 (32%) Frame = -2 Query: 792 KGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXX 613 +G G GGG GG G G GGG G G G GGG G Sbjct: 85 QGSYGGYGGGYGGYGAGGYGDYYAGGYYNGYDYGYDGYGYGGGFEGNGYGGGGGGNMGGG 144 Query: 612 GXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG GG GG G Sbjct: 145 RGGPRGGGG-----PKGGGGFNGGKQRGGGG 170 Score = 33.5 bits (73), Expect = 0.35 Identities = 26/94 (27%), Positives = 27/94 (28%), Gaps = 4/94 (4%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXG----GGXXGXX 613 G GG GG G G GGG G G G G GG Sbjct: 56 GMRGGPRGGMRGGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYYAGGYYNGY 115 Query: 612 GXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPK 511 G G G G GG GG G P+ Sbjct: 116 DYGYDGYGYGGGFEGNGYGGGGGGNMGGGRGGPR 149 Score = 32.3 bits (70), Expect = 0.80 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 G G GGG G G GG GG G G GGG G Sbjct: 121 GYGYGGGFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGG 163 >AE014297-1706|AAF54963.2| 344|Drosophila melanogaster CG16901-PB, isoform B protein. Length = 344 Score = 39.1 bits (87), Expect = 0.007 Identities = 29/91 (31%), Positives = 30/91 (32%) Frame = -2 Query: 792 KGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXX 613 +G G GGG GG G G GGG G G G GGG G Sbjct: 251 QGSYGGYGGGYGGYGAGGYGDYYAGGYYNGYDYGYDGYGYGGGFEGNGYGGGGGGNMGGG 310 Query: 612 GXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG GG GG G Sbjct: 311 RGGPRGGGG-----PKGGGGFNGGKQRGGGG 336 Score = 33.5 bits (73), Expect = 0.35 Identities = 26/94 (27%), Positives = 27/94 (28%), Gaps = 4/94 (4%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXG----GGXXGXX 613 G GG GG G G GGG G G G G GG Sbjct: 222 GMRGGPRGGMRGGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYYAGGYYNGY 281 Query: 612 GXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPK 511 G G G G GG GG G P+ Sbjct: 282 DYGYDGYGYGGGFEGNGYGGGGGGNMGGGRGGPR 315 Score = 32.3 bits (70), Expect = 0.80 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 G G GGG G G GG GG G G GGG G Sbjct: 287 GYGYGGGFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGG 329 >AY118781-1|AAM50641.1| 117|Drosophila melanogaster GH13168p protein. Length = 117 Score = 38.7 bits (86), Expect = 0.009 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GG G G GG G G G G GGGG GG Sbjct: 58 GGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYGGG 101 Score = 37.5 bits (83), Expect = 0.021 Identities = 22/64 (34%), Positives = 23/64 (35%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G + G G GGGGG G G G GGG GGG G GGG Sbjct: 47 GGRGGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYGGGGGGGY 106 Query: 621 GXXG 610 G Sbjct: 107 DDGG 110 Score = 36.7 bits (81), Expect = 0.037 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGGG G G G G G GGGG GG Sbjct: 67 GGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYGGGGGGGYDDGG 110 Score = 32.7 bits (71), Expect = 0.60 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GG GGG G G G G G GG G GG GG G Sbjct: 53 GGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYGGGGG 103 Score = 32.7 bits (71), Expect = 0.60 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG GGG G G G GGG G GG GG G Sbjct: 58 GGG--GGGYYNGGGGGGGGRRPVYSGNFG--PGYGNGGGGGGGGYGGGGGG 104 Score = 31.5 bits (68), Expect = 1.4 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GG GGG GGG G G G G G G GG G Sbjct: 47 GGRGGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGG 96 Score = 30.3 bits (65), Expect = 3.2 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXG-GGXGXGGXXXGG 526 GGG GG G GG G G G GG G GG GG Sbjct: 61 GGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYGGGGGGGYDDGG 110 >AE014297-3096|AAF55954.1| 117|Drosophila melanogaster CG5778-PA protein. Length = 117 Score = 38.7 bits (86), Expect = 0.009 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GG G G GG G G G G GGGG GG Sbjct: 58 GGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYGGG 101 Score = 37.5 bits (83), Expect = 0.021 Identities = 22/64 (34%), Positives = 23/64 (35%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G + G G GGGGG G G G GGG GGG G GGG Sbjct: 47 GGRGGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYGGGGGGGY 106 Query: 621 GXXG 610 G Sbjct: 107 DDGG 110 Score = 36.7 bits (81), Expect = 0.037 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGGG G G G G G GGGG GG Sbjct: 67 GGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYGGGGGGGYDDGG 110 Score = 32.7 bits (71), Expect = 0.60 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GG GGG G G G G G GG G GG GG G Sbjct: 53 GGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYGGGGG 103 Score = 32.7 bits (71), Expect = 0.60 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG GGG G G G GGG G GG GG G Sbjct: 58 GGG--GGGYYNGGGGGGGGRRPVYSGNFG--PGYGNGGGGGGGGYGGGGGG 104 Score = 31.5 bits (68), Expect = 1.4 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GG GGG GGG G G G G G G GG G Sbjct: 47 GGRGGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGG 96 Score = 30.3 bits (65), Expect = 3.2 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXG-GGXGXGGXXXGG 526 GGG GG G GG G G G GG G GG GG Sbjct: 61 GGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYGGGGGGGYDDGG 110 >AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA protein. Length = 579 Score = 38.7 bits (86), Expect = 0.009 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P P PP PP P PPPP PPP Sbjct: 463 PPPPPPPPPP----PP------PPPPPTEPPPPPPPPP 490 Score = 38.3 bits (85), Expect = 0.012 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PPP P P P PP PP P P PPPP P Sbjct: 463 PPPPPPPPPPPPPPP------PPTEPPPPPPPPPEP 492 Score = 34.7 bits (76), Expect = 0.15 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 587 PXXPXXXXPXXPXXPPPXXPXPPPXXPP 670 P P P P PPP P PPP PP Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPPPP 490 Score = 34.3 bits (75), Expect = 0.20 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPPXXPPP 673 P P PPP P PPP PPP Sbjct: 464 PPPPPPPPPPPPPPPPTEPPP 484 Score = 33.5 bits (73), Expect = 0.35 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PP PPPP P P P P P P PPPP P Sbjct: 463 PPPPPPPPPPPPPPPP------------PTEPPPPPPPPPEP 492 Score = 32.3 bits (70), Expect = 0.80 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 596 PXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P PPP P PP PPP Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPP 488 Score = 32.3 bits (70), Expect = 0.80 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 596 PXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P PPP PPP PPP Sbjct: 464 PPPPPPPPPPPPPPPPTEPPPPPPPP 489 Score = 32.3 bits (70), Expect = 0.80 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 596 PXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P PPP PPP PPP Sbjct: 465 PPPPPPPPPPPPPPPTEPPPPPPPPP 490 Score = 31.1 bits (67), Expect = 1.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 587 PXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P P PP P PPP P P Sbjct: 464 PPPPPPPPPPPPPPPPTEPPPPPPPPPEP 492 Score = 29.5 bits (63), Expect = 5.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 610 PPXXXXPXPXXPXPPPXXPPPXR 678 PP P P P PPP PP R Sbjct: 471 PPPPPPPPPTEPPPPPPPPPEPR 493 Score = 29.1 bits (62), Expect = 7.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXP 598 P PP PP P PPP P P Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPP 488 Score = 29.1 bits (62), Expect = 7.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXP 598 P PP PP P PPP P P Sbjct: 464 PPPPPPPPPPPPPPPPTEPPPPPPPP 489 Score = 29.1 bits (62), Expect = 7.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXP 598 P PP PP P PPP P P Sbjct: 465 PPPPPPPPPPPPPPPTEPPPPPPPPP 490 >M74121-1|AAC41573.1| 1293|Drosophila melanogaster maleless protein protein. Length = 1293 Score = 38.3 bits (85), Expect = 0.012 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GGG G G G G GG GG G G G GGG GG N Sbjct: 1209 GGGYGNNGGGYGNIGGGYGNNAGGYGNNG-GYGNNGGGYRNNGGGYGNN 1256 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG G G G G GG GG G G GG GG Sbjct: 1202 GGGYGNNGGGYGNNGGGYGNIGGGYGNNAGGYGNNGGYGNNGGG 1245 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GGG G G G G G GG G G GGG GG N Sbjct: 1216 GGGYGNIGGGYGNNAG-GYGNNGGYGNNGGGYRNNGGGYGNNGGGYGNN 1263 >BT015282-1|AAT94511.1| 1250|Drosophila melanogaster LD04601p protein. Length = 1250 Score = 38.3 bits (85), Expect = 0.012 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GGG GGGG G G GG G G GGG GG K+ Sbjct: 799 GGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGGKGKKPGGESKKS 847 Score = 37.9 bits (84), Expect = 0.016 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 G GGGG G G G GG G G G GGGG Sbjct: 796 GPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGG 831 Score = 32.7 bits (71), Expect = 0.60 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G G G G G G G G GGG G G GG G Sbjct: 771 GGGGPGPGPGGGGSGRGAGSGGWSSGPGG--GGSGGGGGSGGWGSGTGGGG 819 Score = 31.5 bits (68), Expect = 1.4 Identities = 28/92 (30%), Positives = 28/92 (30%), Gaps = 1/92 (1%) Frame = -2 Query: 798 KKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXG 619 K G G GGGGG G G GGG G GGG G Sbjct: 760 KVGGIVGEVRGGGGGPGPGPGG--------GGSGRGAGSGGWSSGPGGGGSG-GGGGSGG 810 Query: 618 XXGXXXXGXXGXXXXXXXGGGXGXG-GXXXGG 526 G G GGG G G G GG Sbjct: 811 WGSGTGGGGSGGWGSGTGGGGLGGGKGKKPGG 842 Score = 31.5 bits (68), Expect = 1.4 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G G G G G G G G GG G G Sbjct: 776 GPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSG 826 Score = 31.1 bits (67), Expect = 1.8 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = -2 Query: 672 GGGXXGGGXGXXGGG---XXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G GG G G G G GGG G G GG G Sbjct: 778 GPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGG 831 Score = 30.7 bits (66), Expect = 2.4 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGG 540 GGG GGG G G G GG G G G GG GG Sbjct: 798 GGGGSGGGGGSGGWGSGTGGG-------GSGGWGSGTGGGGLGG 834 Score = 30.3 bits (65), Expect = 3.2 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXG-GXXXGGXGXPK 511 GG G G G G G G G GG G G G GG G K Sbjct: 782 GGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGGK 836 >BT010267-1|AAQ23585.1| 936|Drosophila melanogaster RE21725p protein. Length = 936 Score = 38.3 bits (85), Expect = 0.012 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GGG G G G G GG GG G G G GGG GG N Sbjct: 852 GGGYGNNGGGYGNIGGGYGNNAGGYGNNG-GYGNNGGGYRNNGGGYGNN 899 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG G G G G GG GG G G GG GG Sbjct: 845 GGGYGNNGGGYGNNGGGYGNIGGGYGNNAGGYGNNGGYGNNGGG 888 Score = 29.9 bits (64), Expect = 4.3 Identities = 24/80 (30%), Positives = 25/80 (31%), Gaps = 3/80 (3%) Frame = -2 Query: 672 GGGXXGGGXGXXGGG---XXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKIFX 502 G G GGG G GGG G G G GGG G G G + Sbjct: 847 GYGNNGGGYGNNGGGYGNIGGGYGNNAGGYGNNGGYGNNGGGYRNNGGGYGNNGGG--YG 904 Query: 501 XKXSNFXXXXFPLXKXGGGF 442 K F GGGF Sbjct: 905 NKRGGFGDSFESNRGSGGGF 924 >BT003785-1|AAO41468.1| 936|Drosophila melanogaster LD44547p protein. Length = 936 Score = 38.3 bits (85), Expect = 0.012 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GGG G G G G GG GG G G G GGG GG N Sbjct: 852 GGGYGNNGGGYGNIGGGYGNNAGGYGNNG-GYGNNGGGYRNNGGGYGNN 899 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG G G G G GG GG G G GG GG Sbjct: 845 GGGYGNNGGGYGNNGGGYGNIGGGYGNNAGGYGNNGGYGNNGGG 888 Score = 29.9 bits (64), Expect = 4.3 Identities = 24/80 (30%), Positives = 25/80 (31%), Gaps = 3/80 (3%) Frame = -2 Query: 672 GGGXXGGGXGXXGGG---XXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKIFX 502 G G GGG G GGG G G G GGG G G G + Sbjct: 847 GYGNNGGGYGNNGGGYGNIGGGYGNNAGGYGNNGGYGNNGGGYRNNGGGYGNNGGG--YG 904 Query: 501 XKXSNFXXXXFPLXKXGGGF 442 K F GGGF Sbjct: 905 NKRGGFGDSFESNRGSGGGF 924 >AF255733-1|AAF71288.1| 1250|Drosophila melanogaster DNA topoisomerase III alpha protein. Length = 1250 Score = 38.3 bits (85), Expect = 0.012 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GGG GGGG G G GG G G GGG GG K+ Sbjct: 799 GGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGGKGKKPGGESKKS 847 Score = 37.9 bits (84), Expect = 0.016 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 G GGGG G G G GG G G G GGGG Sbjct: 796 GPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGG 831 Score = 32.7 bits (71), Expect = 0.60 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G G G G G G G G GGG G G GG G Sbjct: 771 GGGGPGPGPGGGGSGRGAGSGGWSSGPGG--GGSGGGGGSGGWGSGTGGGG 819 Score = 31.5 bits (68), Expect = 1.4 Identities = 28/92 (30%), Positives = 28/92 (30%), Gaps = 1/92 (1%) Frame = -2 Query: 798 KKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXG 619 K G G GGGGG G G GGG G GGG G Sbjct: 760 KVGGIVGEVRGGGGGPGPGPGG--------GGSGRGAGSGGWSSGPGGGGSG-GGGGSGG 810 Query: 618 XXGXXXXGXXGXXXXXXXGGGXGXG-GXXXGG 526 G G GGG G G G GG Sbjct: 811 WGSGTGGGGSGGWGSGTGGGGLGGGKGKKPGG 842 Score = 31.5 bits (68), Expect = 1.4 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G G G G G G G G GG G G Sbjct: 776 GPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSG 826 Score = 31.1 bits (67), Expect = 1.8 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = -2 Query: 672 GGGXXGGGXGXXGGG---XXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G GG G G G G GGG G G GG G Sbjct: 778 GPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGG 831 Score = 30.7 bits (66), Expect = 2.4 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGG 540 GGG GGG G G G GG G G G GG GG Sbjct: 798 GGGGSGGGGGSGGWGSGTGGG-------GSGGWGSGTGGGGLGG 834 Score = 30.3 bits (65), Expect = 3.2 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXG-GXXXGGXGXPK 511 GG G G G G G G G GG G G G GG G K Sbjct: 782 GGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGGK 836 >AE014134-3114|AAF53813.2| 1250|Drosophila melanogaster CG10123-PA protein. Length = 1250 Score = 38.3 bits (85), Expect = 0.012 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GGG GGGG G G GG G G GGG GG K+ Sbjct: 799 GGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGGKGKKPGGESKKS 847 Score = 37.9 bits (84), Expect = 0.016 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 G GGGG G G G GG G G G GGGG Sbjct: 796 GPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGG 831 Score = 32.7 bits (71), Expect = 0.60 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG G G G G G G G G GGG G G GG G Sbjct: 771 GGGGPGPGPGGGGSGRGAGSGGWSSGPGG--GGSGGGGGSGGWGSGTGGGG 819 Score = 31.5 bits (68), Expect = 1.4 Identities = 28/92 (30%), Positives = 28/92 (30%), Gaps = 1/92 (1%) Frame = -2 Query: 798 KKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXG 619 K G G GGGGG G G GGG G GGG G Sbjct: 760 KVGGIVGEVRGGGGGPGPGPGG--------GGSGRGAGSGGWSSGPGGGGSG-GGGGSGG 810 Query: 618 XXGXXXXGXXGXXXXXXXGGGXGXG-GXXXGG 526 G G GGG G G G GG Sbjct: 811 WGSGTGGGGSGGWGSGTGGGGLGGGKGKKPGG 842 Score = 31.5 bits (68), Expect = 1.4 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G GGG G G G G G G G G GG G G Sbjct: 776 GPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSG 826 Score = 31.1 bits (67), Expect = 1.8 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = -2 Query: 672 GGGXXGGGXGXXGGG---XXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G GG G G G G GGG G G GG G Sbjct: 778 GPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGG 831 Score = 30.7 bits (66), Expect = 2.4 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGG 540 GGG GGG G G G GG G G G GG GG Sbjct: 798 GGGGSGGGGGSGGWGSGTGGG-------GSGGWGSGTGGGGLGG 834 Score = 30.3 bits (65), Expect = 3.2 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXG-GXXXGGXGXPK 511 GG G G G G G G G GG G G G GG G K Sbjct: 782 GGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGGK 836 >AE013599-124|AAM68335.1| 936|Drosophila melanogaster CG11680-PC, isoform C protein. Length = 936 Score = 38.3 bits (85), Expect = 0.012 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GGG G G G G GG GG G G G GGG GG N Sbjct: 852 GGGYGNNGGGYGNIGGGYGNNAGGYGNNG-GYGNNGGGYRNNGGGYGNN 899 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG G G G G GG GG G G GG GG Sbjct: 845 GGGYGNNGGGYGNNGGGYGNIGGGYGNNAGGYGNNGGYGNNGGG 888 Score = 29.9 bits (64), Expect = 4.3 Identities = 24/80 (30%), Positives = 25/80 (31%), Gaps = 3/80 (3%) Frame = -2 Query: 672 GGGXXGGGXGXXGGG---XXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKIFX 502 G G GGG G GGG G G G GGG G G G + Sbjct: 847 GYGNNGGGYGNNGGGYGNIGGGYGNNAGGYGNNGGYGNNGGGYRNNGGGYGNNGGG--YG 904 Query: 501 XKXSNFXXXXFPLXKXGGGF 442 K F GGGF Sbjct: 905 NKRGGFGDSFESNRGSGGGF 924 >AE013599-123|AAF57297.1| 1293|Drosophila melanogaster CG11680-PA, isoform A protein. Length = 1293 Score = 38.3 bits (85), Expect = 0.012 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGGXXXKN 509 GGG G G G G GG GG G G G GGG GG N Sbjct: 1209 GGGYGNNGGGYGNIGGGYGNNAGGYGNNG-GYGNNGGGYRNNGGGYGNN 1256 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG G G G G GG GG G G GG GG Sbjct: 1202 GGGYGNNGGGYGNNGGGYGNIGGGYGNNAGGYGNNGGYGNNGGG 1245 Score = 29.9 bits (64), Expect = 4.3 Identities = 24/80 (30%), Positives = 25/80 (31%), Gaps = 3/80 (3%) Frame = -2 Query: 672 GGGXXGGGXGXXGGG---XXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKIFX 502 G G GGG G GGG G G G GGG G G G + Sbjct: 1204 GYGNNGGGYGNNGGGYGNIGGGYGNNAGGYGNNGGYGNNGGGYRNNGGGYGNNGGG--YG 1261 Query: 501 XKXSNFXXXXFPLXKXGGGF 442 K F GGGF Sbjct: 1262 NKRGGFGDSFESNRGSGGGF 1281 >BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p protein. Length = 1273 Score = 37.9 bits (84), Expect = 0.016 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P P PP P P PP P PPP Sbjct: 696 PPPPPPMPAS-----PTASSAAPPPPPPPAPPAPPPPP 728 Score = 36.7 bits (81), Expect = 0.037 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXP-XXXXPXXPXXPPPXXPXPPPXXPPPXA 679 P PP PP P PPP P P P PP PP PPP A Sbjct: 714 PPPPPPAPPAPPPPPGFSPLGSPSGSLASTAPSPPHAPPMLSSFQPP--PPPVA 765 Score = 32.3 bits (70), Expect = 0.80 Identities = 20/71 (28%), Positives = 22/71 (30%) Frame = +2 Query: 557 PPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXP 736 PPP P P P PP P PPP P + P P Sbjct: 696 PPPPPPMPASPTASSAAPPPPPPPAPP-APPPPPGFSPLGSPSGSLASTAPSPPHAP--P 752 Query: 737 XXAXXXPPPPP 769 + PPPPP Sbjct: 753 MLSSFQPPPPP 763 Score = 30.7 bits (66), Expect = 2.4 Identities = 19/72 (26%), Positives = 19/72 (26%), Gaps = 4/72 (5%) Frame = +2 Query: 587 PXXPXXXXPXXPXXPPPXXPXPPPXXPPP----XAXXXXXXXXXXXXXXXPXXPXXAXXX 754 P P P PP P P P PPP P P Sbjct: 698 PPPPMPASPTASSAAPPPPPPPAPPAPPPPPGFSPLGSPSGSLASTAPSPPHAPPMLSSF 757 Query: 755 PPPPPPXXPXXP 790 PPPPP P Sbjct: 758 QPPPPPVAGFMP 769 >AY075564-1|AAL68371.1| 161|Drosophila melanogaster RH68528p protein. Length = 161 Score = 37.9 bits (84), Expect = 0.016 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GG GGG G G G GGG G GG GG G Sbjct: 57 GGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGGGPGFGGGFGGGPG 107 Score = 34.3 bits (75), Expect = 0.20 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKI 508 GG G G G GG G G G G GGG G GG G G P + Sbjct: 69 GGGPGFGGGPGFGGGQGFGGRPGFGG-GPGFGGGFGGGPGFGGGSGFGGGRPAV 121 Score = 32.7 bits (71), Expect = 0.60 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Frame = -2 Query: 672 GGGXXGGGXGXXGG-GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GG GGG G GG G G G G G GGG G GG G G Sbjct: 46 GGPGFGGGPGFGGGPGFGGRPGFG--GGPGFGGGPGFGGGQGFGGRPGFGGG 95 Score = 32.3 bits (70), Expect = 0.80 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGG G G GG GGG G G G G Sbjct: 37 GLGGRPGFGGGPGFGGGPGFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGG-G 95 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G G G G G GG Sbjct: 96 PGFGGGFGGGPGFGGGSGFGGGRPAVGG 123 Score = 29.9 bits (64), Expect = 4.3 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A G GG G GG G G G G GGG G GG G G Sbjct: 32 ANAQGGLGGRPGFGGGPGFGG-GPGFGGGPGFGGRPGFGGGPGFGGGPGFGGG 83 Score = 29.9 bits (64), Expect = 4.3 Identities = 21/75 (28%), Positives = 21/75 (28%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXXXX 590 G GGG G G GGG G GG G Sbjct: 43 GFGGGPGFGGGPGFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGGGPGFGGGF 102 Query: 589 GGXXXXGXGXGXGGG 545 GG G G G GGG Sbjct: 103 GGGPGFGGGSGFGGG 117 >AE014134-1930|AAF52990.2| 161|Drosophila melanogaster CG7296-PA protein. Length = 161 Score = 37.9 bits (84), Expect = 0.016 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GG GGG G G G GGG G GG GG G Sbjct: 57 GGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGGGPGFGGGFGGGPG 107 Score = 34.3 bits (75), Expect = 0.20 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKI 508 GG G G G GG G G G G GGG G GG G G P + Sbjct: 69 GGGPGFGGGPGFGGGQGFGGRPGFGG-GPGFGGGFGGGPGFGGGSGFGGGRPAV 121 Score = 32.7 bits (71), Expect = 0.60 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Frame = -2 Query: 672 GGGXXGGGXGXXGG-GXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GG GGG G GG G G G G G GGG G GG G G Sbjct: 46 GGPGFGGGPGFGGGPGFGGRPGFG--GGPGFGGGPGFGGGQGFGGRPGFGGG 95 Score = 32.3 bits (70), Expect = 0.80 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G G GGG G G GG GGG G G G G Sbjct: 37 GLGGRPGFGGGPGFGGGPGFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGG-G 95 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 G G G G G G GG Sbjct: 96 PGFGGGFGGGPGFGGGSGFGGGRPAVGG 123 Score = 29.9 bits (64), Expect = 4.3 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A G GG G GG G G G G GGG G GG G G Sbjct: 32 ANAQGGLGGRPGFGGGPGFGG-GPGFGGGPGFGGRPGFGGGPGFGGGPGFGGG 83 Score = 29.9 bits (64), Expect = 4.3 Identities = 21/75 (28%), Positives = 21/75 (28%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXXXX 590 G GGG G G GGG G GG G Sbjct: 43 GFGGGPGFGGGPGFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGGGPGFGGGF 102 Query: 589 GGXXXXGXGXGXGGG 545 GG G G G GGG Sbjct: 103 GGGPGFGGGSGFGGG 117 >U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptide protein. Length = 684 Score = 37.5 bits (83), Expect = 0.021 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +3 Query: 543 PPPPXPX--PXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P PP PP P PPP PPP Sbjct: 437 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 476 Score = 36.7 bits (81), Expect = 0.037 Identities = 26/87 (29%), Positives = 26/87 (29%), Gaps = 1/87 (1%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP-XXPXPPPXXPPPXAXXXX 691 G PP PP P P P P PPP PPP P P A Sbjct: 400 GPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPA---- 455 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPP 772 P P PPPPPP Sbjct: 456 ------MGGGPPPAPGGPGAPPPPPPP 476 Score = 32.3 bits (70), Expect = 0.80 Identities = 22/78 (28%), Positives = 24/78 (30%), Gaps = 3/78 (3%) Frame = +2 Query: 446 PPPXXFRGNXXFXKLEXXXKKIF-GXPXPPXXX--PPXPXPPPXXXXXXXPXXPXXXXPX 616 PPP F G ++F G P PP PP P P P P Sbjct: 411 PPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAP 470 Query: 617 XPXXPPPXXPXPPPXXPP 670 P PPP P P Sbjct: 471 PPPPPPPGLGGAPKKEDP 488 Score = 32.3 bits (70), Expect = 0.80 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPP 641 PP PPP P P P P P P PPP Sbjct: 439 PPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 477 >U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous protein protein. Length = 1091 Score = 37.5 bits (83), Expect = 0.021 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = +2 Query: 521 PXPPXXX---PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP PP P P P P P P PPP P P PPP Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPP 568 Score = 33.5 bits (73), Expect = 0.35 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P P P PP P PPP P P Sbjct: 539 PPPPPPPPMPGRAGGP----PPPPPPPGMGGPPPPPMP 572 Score = 31.1 bits (67), Expect = 1.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 552 PXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P P P P P PPPP PPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPP 546 Score = 31.1 bits (67), Expect = 1.8 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +3 Query: 543 PPPPXPXPX-----PXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P P PP PP P P PPP Sbjct: 541 PPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPP 583 Score = 30.7 bits (66), Expect = 2.4 Identities = 24/93 (25%), Positives = 24/93 (25%), Gaps = 5/93 (5%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXP-----PPXXPPPXAXXXX 691 P P P PP P P PPP P P PP PPP Sbjct: 507 PKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPG---- 562 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P PPPP P P Sbjct: 563 --MGGPPPPPMPGMMRPGGGPPPPPMMMGPMVP 593 Score = 30.7 bits (66), Expect = 2.4 Identities = 21/75 (28%), Positives = 22/75 (29%) Frame = +2 Query: 446 PPPXXFRGNXXFXKLEXXXKKIFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPX 625 PPP G + G P PP PP P P P P P P Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPP---PPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Query: 626 XPPPXXPXPPPXXPP 670 P P P PP Sbjct: 571 MPGMMRPGGGPPPPP 585 Score = 30.7 bits (66), Expect = 2.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PPP P PP P P PPPP P Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 29.1 bits (62), Expect = 7.4 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPP 638 P PPPP P P PP P P PP Sbjct: 548 PGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 28.7 bits (61), Expect = 9.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P P P PP P PPPP P P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 >M85049-1|AAA19661.1| 1638|Drosophila melanogaster brahma protein protein. Length = 1638 Score = 37.5 bits (83), Expect = 0.021 Identities = 25/91 (27%), Positives = 26/91 (28%), Gaps = 1/91 (1%) Frame = +2 Query: 521 PXPPXXXPPXPX-PPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXX 697 P PP P P PPP P P P PPP PP PP + Sbjct: 215 PGPPIGPPGAPGGPPPGSQHAGQPPVP----PQQQQQPPPSAGTPPQCSTPPASNPYGPP 270 Query: 698 XXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P P PP P P Sbjct: 271 VPGQKMQVAPPPPHMQQGQPLPPQPPQVGGP 301 >BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p protein. Length = 1091 Score = 37.5 bits (83), Expect = 0.021 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = +2 Query: 521 PXPPXXX---PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP PP P P P P P P PPP P P PPP Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPP 568 Score = 33.5 bits (73), Expect = 0.35 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P P P PP P PPP P P Sbjct: 539 PPPPPPPPMPGRAGGP----PPPPPPPGMGGPPPPPMP 572 Score = 31.1 bits (67), Expect = 1.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 552 PXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P P P P P PPPP PPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPP 546 Score = 31.1 bits (67), Expect = 1.8 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +3 Query: 543 PPPPXPXPX-----PXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P P PP PP P P PPP Sbjct: 541 PPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPP 583 Score = 30.7 bits (66), Expect = 2.4 Identities = 24/93 (25%), Positives = 24/93 (25%), Gaps = 5/93 (5%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXP-----PPXXPPPXAXXXX 691 P P P PP P P PPP P P PP PPP Sbjct: 507 PKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPG---- 562 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P PPPP P P Sbjct: 563 --MGGPPPPPMPGMMRPGGGPPPPPMMMGPMVP 593 Score = 30.7 bits (66), Expect = 2.4 Identities = 21/75 (28%), Positives = 22/75 (29%) Frame = +2 Query: 446 PPPXXFRGNXXFXKLEXXXKKIFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPX 625 PPP G + G P PP PP P P P P P P Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPP---PPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Query: 626 XPPPXXPXPPPXXPP 670 P P P PP Sbjct: 571 MPGMMRPGGGPPPPP 585 Score = 30.7 bits (66), Expect = 2.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PPP P PP P P PPPP P Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 29.1 bits (62), Expect = 7.4 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPP 638 P PPPP P P PP P P PP Sbjct: 548 PGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 28.7 bits (61), Expect = 9.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P P P PP P PPPP P P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 >BT009972-1|AAQ22441.1| 1634|Drosophila melanogaster RE61274p protein. Length = 1634 Score = 37.5 bits (83), Expect = 0.021 Identities = 25/91 (27%), Positives = 26/91 (28%), Gaps = 1/91 (1%) Frame = +2 Query: 521 PXPPXXXPPXPX-PPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXX 697 P PP P P PPP P P P PPP PP PP + Sbjct: 211 PGPPIGPPGAPGGPPPGSQHAGQPPVP----PQQQQQPPPSAGTPPQCSTPPASNPYGPP 266 Query: 698 XXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P P PP P P Sbjct: 267 VPGQKMQVAPPPPHMQQGQPLPPQPPQVGGP 297 >BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p protein. Length = 687 Score = 37.5 bits (83), Expect = 0.021 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +3 Query: 543 PPPPXPX--PXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P PP PP P PPP PPP Sbjct: 440 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 479 Score = 36.7 bits (81), Expect = 0.037 Identities = 26/87 (29%), Positives = 26/87 (29%), Gaps = 1/87 (1%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP-XXPXPPPXXPPPXAXXXX 691 G PP PP P P P P PPP PPP P P A Sbjct: 403 GPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPA---- 458 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPP 772 P P PPPPPP Sbjct: 459 ------MGGGPPPAPGGPGAPPPPPPP 479 Score = 32.3 bits (70), Expect = 0.80 Identities = 22/78 (28%), Positives = 24/78 (30%), Gaps = 3/78 (3%) Frame = +2 Query: 446 PPPXXFRGNXXFXKLEXXXKKIF-GXPXPPXXX--PPXPXPPPXXXXXXXPXXPXXXXPX 616 PPP F G ++F G P PP PP P P P P Sbjct: 414 PPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAP 473 Query: 617 XPXXPPPXXPXPPPXXPP 670 P PPP P P Sbjct: 474 PPPPPPPGLGGAPKKEDP 491 Score = 32.3 bits (70), Expect = 0.80 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPP 641 PP PPP P P P P P P PPP Sbjct: 442 PPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 480 >AY095048-1|AAM11376.1| 1638|Drosophila melanogaster LD36356p protein. Length = 1638 Score = 37.5 bits (83), Expect = 0.021 Identities = 25/91 (27%), Positives = 26/91 (28%), Gaps = 1/91 (1%) Frame = +2 Query: 521 PXPPXXXPPXPX-PPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXX 697 P PP P P PPP P P P PPP PP PP + Sbjct: 215 PGPPIGPPGAPGGPPPGSQHAGQPPVP----PQQQQQPPPSAGTPPQCSTPPASNPYGPP 270 Query: 698 XXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P P PP P P Sbjct: 271 VPGQKMQVAPPPPHMQQGQPLPPQPPQVGGP 301 >AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p protein. Length = 831 Score = 37.5 bits (83), Expect = 0.021 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +3 Query: 543 PPPPXPX--PXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P PP PP P PPP PPP Sbjct: 583 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 622 Score = 36.7 bits (81), Expect = 0.037 Identities = 26/87 (29%), Positives = 26/87 (29%), Gaps = 1/87 (1%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP-XXPXPPPXXPPPXAXXXX 691 G PP PP P P P P PPP PPP P P A Sbjct: 546 GPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPA---- 601 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPP 772 P P PPPPPP Sbjct: 602 ------MGGGPPPAPGGPGAPPPPPPP 622 Score = 32.3 bits (70), Expect = 0.80 Identities = 22/78 (28%), Positives = 24/78 (30%), Gaps = 3/78 (3%) Frame = +2 Query: 446 PPPXXFRGNXXFXKLEXXXKKIF-GXPXPPXXX--PPXPXPPPXXXXXXXPXXPXXXXPX 616 PPP F G ++F G P PP PP P P P P Sbjct: 557 PPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAP 616 Query: 617 XPXXPPPXXPXPPPXXPP 670 P PPP P P Sbjct: 617 PPPPPPPGLGGAPKKEDP 634 Score = 32.3 bits (70), Expect = 0.80 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPP 641 PP PPP P P P P P P PPP Sbjct: 585 PPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 623 >AE014298-2543|AAF48712.2| 237|Drosophila melanogaster CG12997-PA protein. Length = 237 Score = 37.5 bits (83), Expect = 0.021 Identities = 26/88 (29%), Positives = 26/88 (29%), Gaps = 2/88 (2%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXP--PPXAXXX 688 G P P P P PPP P P P P P P PP P PP Sbjct: 114 GQPEDPPEDQP-PEPPPLFQPLEPP--PLFQPPPDPPDDQPPPPSPPLFHPPDPPPEDQP 170 Query: 689 XXXXXXXXXXXXPXXPXXAXXXPPPPPP 772 P PPPPPP Sbjct: 171 PPPLEGQALIMTLLPPDPPEDQPPPPPP 198 Score = 35.5 bits (78), Expect = 0.086 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 510 FLXXXPPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPP 644 F PP PPP P P PP PP P PPPP Sbjct: 131 FQPLEPPPLFQPPPDPPDDQPPPPSPPLFHPPDPP--PEDQPPPP 173 Score = 34.3 bits (75), Expect = 0.20 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +3 Query: 525 PPXXXXP-PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PP P PPP P P PP P PPPP P Sbjct: 156 PPLFHPPDPPPEDQPPPPLEGQALIMTLLPPDPPEDQPPPPPP 198 Score = 30.7 bits (66), Expect = 2.4 Identities = 18/64 (28%), Positives = 18/64 (28%), Gaps = 3/64 (4%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPP---XXPXXP 790 P PPP PPP P P P PP PP P P Sbjct: 15 PLPPPPPGDQPPPPPPEDQPLLILLGQAEDPPEDQPPDPPPLFQPPPEEPPDDQPPPPPP 74 Query: 791 FFFP 802 F P Sbjct: 75 LFQP 78 Score = 30.7 bits (66), Expect = 2.4 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPP 670 P PP P P PP P PPP PPP PP Sbjct: 17 PPPPPGDQPPPPPPEDQPLLILLGQAEDPPEDQPPDPPPLF-QPPPEEPP 65 Score = 30.3 bits (65), Expect = 3.2 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 3/54 (5%) Frame = +2 Query: 521 PXPPXXXPPXPXP---PPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP PP P P P P P P P PP PPP Sbjct: 18 PPPPGDQPPPPPPEDQPLLILLGQAEDPPEDQPPDPPPLFQPPPEEPPDDQPPP 71 Score = 30.3 bits (65), Expect = 3.2 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 12/56 (21%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXX------PPXXXXXXPPXX---PXPXPP---PPXPPP 656 PP PPPP P P PP PP P PP PP PPP Sbjct: 19 PPPGDQPPPPPPEDQPLLILLGQAEDPPEDQPPDPPPLFQPPPEEPPDDQPPPPPP 74 Score = 30.3 bits (65), Expect = 3.2 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 8/59 (13%) Frame = +2 Query: 521 PXPPXXXPPXPXPP----PXXXXXXXPXXPXXXXPXX----PXXPPPXXPXPPPXXPPP 673 P PP PP P PP P P P P PP P PPP P Sbjct: 144 PDPPDDQPPPPSPPLFHPPDPPPEDQPPPPLEGQALIMTLLPPDPPEDQPPPPPPLLQP 202 >AE014296-2605|AAF49557.1| 1638|Drosophila melanogaster CG5942-PB, isoform B protein. Length = 1638 Score = 37.5 bits (83), Expect = 0.021 Identities = 25/91 (27%), Positives = 26/91 (28%), Gaps = 1/91 (1%) Frame = +2 Query: 521 PXPPXXXPPXPX-PPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXX 697 P PP P P PPP P P P PPP PP PP + Sbjct: 215 PGPPIGPPGAPGGPPPGSQHAGQPPVP----PQQQQQPPPSAGTPPQCSTPPASNPYGPP 270 Query: 698 XXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P P PP P P Sbjct: 271 VPGQKMQVAPPPPHMQQGQPLPPQPPQVGGP 301 >AE014296-2604|AAF49558.3| 1638|Drosophila melanogaster CG5942-PA, isoform A protein. Length = 1638 Score = 37.5 bits (83), Expect = 0.021 Identities = 25/91 (27%), Positives = 26/91 (28%), Gaps = 1/91 (1%) Frame = +2 Query: 521 PXPPXXXPPXPX-PPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXX 697 P PP P P PPP P P P PPP PP PP + Sbjct: 215 PGPPIGPPGAPGGPPPGSQHAGQPPVP----PQQQQQPPPSAGTPPQCSTPPASNPYGPP 270 Query: 698 XXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P P PP P P Sbjct: 271 VPGQKMQVAPPPPHMQQGQPLPPQPPQVGGP 301 >AE014296-2603|AAN11774.1| 1634|Drosophila melanogaster CG5942-PD, isoform D protein. Length = 1634 Score = 37.5 bits (83), Expect = 0.021 Identities = 25/91 (27%), Positives = 26/91 (28%), Gaps = 1/91 (1%) Frame = +2 Query: 521 PXPPXXXPPXPX-PPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXX 697 P PP P P PPP P P P PPP PP PP + Sbjct: 211 PGPPIGPPGAPGGPPPGSQHAGQPPVP----PQQQQQPPPSAGTPPQCSTPPASNPYGPP 266 Query: 698 XXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P P PP P P Sbjct: 267 VPGQKMQVAPPPPHMQQGQPLPPQPPQVGGP 297 >AE014296-2602|AAN11773.1| 1634|Drosophila melanogaster CG5942-PC, isoform C protein. Length = 1634 Score = 37.5 bits (83), Expect = 0.021 Identities = 25/91 (27%), Positives = 26/91 (28%), Gaps = 1/91 (1%) Frame = +2 Query: 521 PXPPXXXPPXPX-PPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXX 697 P PP P P PPP P P P PPP PP PP + Sbjct: 211 PGPPIGPPGAPGGPPPGSQHAGQPPVP----PQQQQQPPPSAGTPPQCSTPPASNPYGPP 266 Query: 698 XXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P P PP P P Sbjct: 267 VPGQKMQVAPPPPHMQQGQPLPPQPPQVGGP 297 >AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB, isoform B protein. Length = 1091 Score = 37.5 bits (83), Expect = 0.021 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = +2 Query: 521 PXPPXXX---PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP PP P P P P P P PPP P P PPP Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPP 568 Score = 33.5 bits (73), Expect = 0.35 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P P P PP P PPP P P Sbjct: 539 PPPPPPPPMPGRAGGP----PPPPPPPGMGGPPPPPMP 572 Score = 31.1 bits (67), Expect = 1.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 552 PXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P P P P P PPPP PPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPP 546 Score = 31.1 bits (67), Expect = 1.8 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +3 Query: 543 PPPPXPXPX-----PXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P P PP PP P P PPP Sbjct: 541 PPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPP 583 Score = 30.7 bits (66), Expect = 2.4 Identities = 24/93 (25%), Positives = 24/93 (25%), Gaps = 5/93 (5%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXP-----PPXXPPPXAXXXX 691 P P P PP P P PPP P P PP PPP Sbjct: 507 PKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPG---- 562 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P PPPP P P Sbjct: 563 --MGGPPPPPMPGMMRPGGGPPPPPMMMGPMVP 593 Score = 30.7 bits (66), Expect = 2.4 Identities = 21/75 (28%), Positives = 22/75 (29%) Frame = +2 Query: 446 PPPXXFRGNXXFXKLEXXXKKIFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPX 625 PPP G + G P PP PP P P P P P P Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPP---PPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Query: 626 XPPPXXPXPPPXXPP 670 P P P PP Sbjct: 571 MPGMMRPGGGPPPPP 585 Score = 30.7 bits (66), Expect = 2.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PPP P PP P P PPPP P Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 29.1 bits (62), Expect = 7.4 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPP 638 P PPPP P P PP P P PP Sbjct: 548 PGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 28.7 bits (61), Expect = 9.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P P P PP P PPPP P P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 >AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA, isoform A protein. Length = 1091 Score = 37.5 bits (83), Expect = 0.021 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = +2 Query: 521 PXPPXXX---PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP PP P P P P P P PPP P P PPP Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPP 568 Score = 33.5 bits (73), Expect = 0.35 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P P P PP P PPP P P Sbjct: 539 PPPPPPPPMPGRAGGP----PPPPPPPGMGGPPPPPMP 572 Score = 31.1 bits (67), Expect = 1.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 552 PXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P P P P P PPPP PPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPP 546 Score = 31.1 bits (67), Expect = 1.8 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +3 Query: 543 PPPPXPXPX-----PXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P P PP PP P P PPP Sbjct: 541 PPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPP 583 Score = 30.7 bits (66), Expect = 2.4 Identities = 24/93 (25%), Positives = 24/93 (25%), Gaps = 5/93 (5%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXP-----PPXXPPPXAXXXX 691 P P P PP P P PPP P P PP PPP Sbjct: 507 PKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPG---- 562 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P PPPP P P Sbjct: 563 --MGGPPPPPMPGMMRPGGGPPPPPMMMGPMVP 593 Score = 30.7 bits (66), Expect = 2.4 Identities = 21/75 (28%), Positives = 22/75 (29%) Frame = +2 Query: 446 PPPXXFRGNXXFXKLEXXXKKIFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPX 625 PPP G + G P PP PP P P P P P P Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPP---PPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Query: 626 XPPPXXPXPPPXXPP 670 P P P PP Sbjct: 571 MPGMMRPGGGPPPPP 585 Score = 30.7 bits (66), Expect = 2.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PPP P PP P P PPPP P Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 29.1 bits (62), Expect = 7.4 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPP 638 P PPPP P P PP P P PP Sbjct: 548 PGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 28.7 bits (61), Expect = 9.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P P P PP P PPPP P P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 >AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-PB, isoform B protein. Length = 829 Score = 37.5 bits (83), Expect = 0.021 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +3 Query: 543 PPPPXPX--PXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P PP PP P PPP PPP Sbjct: 582 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 621 Score = 36.7 bits (81), Expect = 0.037 Identities = 26/87 (29%), Positives = 26/87 (29%), Gaps = 1/87 (1%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP-XXPXPPPXXPPPXAXXXX 691 G PP PP P P P P PPP PPP P P A Sbjct: 545 GPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPA---- 600 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPP 772 P P PPPPPP Sbjct: 601 ------MGGGPPPAPGGPGAPPPPPPP 621 Score = 32.3 bits (70), Expect = 0.80 Identities = 22/78 (28%), Positives = 24/78 (30%), Gaps = 3/78 (3%) Frame = +2 Query: 446 PPPXXFRGNXXFXKLEXXXKKIF-GXPXPPXXX--PPXPXPPPXXXXXXXPXXPXXXXPX 616 PPP F G ++F G P PP PP P P P P Sbjct: 556 PPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAP 615 Query: 617 XPXXPPPXXPXPPPXXPP 670 P PPP P P Sbjct: 616 PPPPPPPGLGGAPKKEDP 633 Score = 32.3 bits (70), Expect = 0.80 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPP 641 PP PPP P P P P P P PPP Sbjct: 584 PPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 622 >AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-PE, isoform E protein. Length = 684 Score = 37.5 bits (83), Expect = 0.021 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +3 Query: 543 PPPPXPX--PXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P PP PP P PPP PPP Sbjct: 437 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 476 Score = 36.7 bits (81), Expect = 0.037 Identities = 26/87 (29%), Positives = 26/87 (29%), Gaps = 1/87 (1%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP-XXPXPPPXXPPPXAXXXX 691 G PP PP P P P P PPP PPP P P A Sbjct: 400 GPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPA---- 455 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPP 772 P P PPPPPP Sbjct: 456 ------MGGGPPPAPGGPGAPPPPPPP 476 Score = 32.3 bits (70), Expect = 0.80 Identities = 22/78 (28%), Positives = 24/78 (30%), Gaps = 3/78 (3%) Frame = +2 Query: 446 PPPXXFRGNXXFXKLEXXXKKIF-GXPXPPXXX--PPXPXPPPXXXXXXXPXXPXXXXPX 616 PPP F G ++F G P PP PP P P P P Sbjct: 411 PPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAP 470 Query: 617 XPXXPPPXXPXPPPXXPP 670 P PPP P P Sbjct: 471 PPPPPPPGLGGAPKKEDP 488 Score = 32.3 bits (70), Expect = 0.80 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPP 641 PP PPP P P P P P P PPP Sbjct: 439 PPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 477 >AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-PC, isoform C protein. Length = 684 Score = 37.5 bits (83), Expect = 0.021 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +3 Query: 543 PPPPXPX--PXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P PP PP P PPP PPP Sbjct: 437 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 476 Score = 36.7 bits (81), Expect = 0.037 Identities = 26/87 (29%), Positives = 26/87 (29%), Gaps = 1/87 (1%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP-XXPXPPPXXPPPXAXXXX 691 G PP PP P P P P PPP PPP P P A Sbjct: 400 GPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPA---- 455 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPP 772 P P PPPPPP Sbjct: 456 ------MGGGPPPAPGGPGAPPPPPPP 476 Score = 32.3 bits (70), Expect = 0.80 Identities = 22/78 (28%), Positives = 24/78 (30%), Gaps = 3/78 (3%) Frame = +2 Query: 446 PPPXXFRGNXXFXKLEXXXKKIF-GXPXPPXXX--PPXPXPPPXXXXXXXPXXPXXXXPX 616 PPP F G ++F G P PP PP P P P P Sbjct: 411 PPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAP 470 Query: 617 XPXXPPPXXPXPPPXXPP 670 P PPP P P Sbjct: 471 PPPPPPPGLGGAPKKEDP 488 Score = 32.3 bits (70), Expect = 0.80 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPP 641 PP PPP P P P P P P PPP Sbjct: 439 PPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 477 >AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-PA, isoform A protein. Length = 684 Score = 37.5 bits (83), Expect = 0.021 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +3 Query: 543 PPPPXPX--PXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P PP PP P PPP PPP Sbjct: 437 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 476 Score = 36.7 bits (81), Expect = 0.037 Identities = 26/87 (29%), Positives = 26/87 (29%), Gaps = 1/87 (1%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP-XXPXPPPXXPPPXAXXXX 691 G PP PP P P P P PPP PPP P P A Sbjct: 400 GPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPA---- 455 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPP 772 P P PPPPPP Sbjct: 456 ------MGGGPPPAPGGPGAPPPPPPP 476 Score = 32.3 bits (70), Expect = 0.80 Identities = 22/78 (28%), Positives = 24/78 (30%), Gaps = 3/78 (3%) Frame = +2 Query: 446 PPPXXFRGNXXFXKLEXXXKKIF-GXPXPPXXX--PPXPXPPPXXXXXXXPXXPXXXXPX 616 PPP F G ++F G P PP PP P P P P Sbjct: 411 PPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAP 470 Query: 617 XPXXPPPXXPXPPPXXPP 670 P PPP P P Sbjct: 471 PPPPPPPGLGGAPKKEDP 488 Score = 32.3 bits (70), Expect = 0.80 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPP 641 PP PPP P P P P P P PPP Sbjct: 439 PPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 477 >AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-PD, isoform D protein. Length = 687 Score = 37.5 bits (83), Expect = 0.021 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +3 Query: 543 PPPPXPX--PXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P P PP PP P PPP PPP Sbjct: 440 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 479 Score = 36.7 bits (81), Expect = 0.037 Identities = 26/87 (29%), Positives = 26/87 (29%), Gaps = 1/87 (1%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP-XXPXPPPXXPPPXAXXXX 691 G PP PP P P P P PPP PPP P P A Sbjct: 403 GPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPA---- 458 Query: 692 XXXXXXXXXXXPXXPXXAXXXPPPPPP 772 P P PPPPPP Sbjct: 459 ------MGGGPPPAPGGPGAPPPPPPP 479 Score = 32.3 bits (70), Expect = 0.80 Identities = 22/78 (28%), Positives = 24/78 (30%), Gaps = 3/78 (3%) Frame = +2 Query: 446 PPPXXFRGNXXFXKLEXXXKKIF-GXPXPPXXX--PPXPXPPPXXXXXXXPXXPXXXXPX 616 PPP F G ++F G P PP PP P P P P Sbjct: 414 PPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAP 473 Query: 617 XPXXPPPXXPXPPPXXPP 670 P PPP P P Sbjct: 474 PPPPPPPGLGGAPKKEDP 491 Score = 32.3 bits (70), Expect = 0.80 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPP 641 PP PPP P P P P P P PPP Sbjct: 442 PPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 480 >X71974-1|CAA50794.1| 196|Drosophila melanogaster GCR 17 protein. Length = 196 Score = 37.1 bits (82), Expect = 0.028 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GG GGG G GG G G G G GGG GG GG G Sbjct: 55 GGGLGGGLGGLSGGLGGKLG-GGGGGGGYSGGYSNGGGYSGGGGYSGGGG 103 Score = 33.5 bits (73), Expect = 0.35 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G GG GGG G G G + GGG GGG GGG G G Sbjct: 53 GLGGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGG 109 Score = 33.1 bits (72), Expect = 0.46 Identities = 20/53 (37%), Positives = 21/53 (39%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPK 511 GG GGG G GGG G G G GGG GG GG P+ Sbjct: 70 GGKLGGGGG--GGGYSG--GYSNGGGYSGGGGYSGGGGYSGGGGYSGGYAAPR 118 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 657 GGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GG G GGG G G G GG GG GG G Sbjct: 52 GGLGGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGG 97 >AY113490-1|AAM29495.1| 158|Drosophila melanogaster RE47308p protein. Length = 158 Score = 37.1 bits (82), Expect = 0.028 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G GGG Sbjct: 91 GGGGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDGGG 127 Score = 35.1 bits (77), Expect = 0.11 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GG GGGG G G GG G G G GGG Sbjct: 91 GGGGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDGGG 127 Score = 30.3 bits (65), Expect = 3.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXG 595 GGG GGG G GGG G G G Sbjct: 93 GGGGGGGGGGSGGGGRGGGSGARAGG 118 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXG 586 GGG GGG G GGG G G G Sbjct: 92 GGGGGGGGGGGSGGGGRGGGSGARAGGGG 120 >AM294881-1|CAL26867.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 37.1 bits (82), Expect = 0.028 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G GG G G G G GGGG Sbjct: 55 GGGGGGGGGGSGGGGG-----GGSGSGGGSGSGDGGGG 87 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXG 586 GGG GGG G GGG G G G G Sbjct: 57 GGGGGGGGSGGGGGGGSGSGGGSGSGDGG 85 Score = 29.5 bits (63), Expect = 5.6 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGG 541 GG GGG G GGG G G G GGG GG Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSG------DGGGGAIGG 91 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG 569 GGG GGGG G GG GG G Sbjct: 62 GGGSGGGGGGGSGSGGGSGSGDGGGGAIG 90 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG 569 GG GGGG G G GG GG G Sbjct: 63 GGSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 >AM294880-1|CAL26866.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 37.1 bits (82), Expect = 0.028 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G GG G G G G GGGG Sbjct: 55 GGGGGGGGGGSGGGGG-----GGSGSGGGSGSGDGGGG 87 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXG 586 GGG GGG G GGG G G G G Sbjct: 57 GGGGGGGGSGGGGGGGSGSGGGSGSGDGG 85 Score = 29.5 bits (63), Expect = 5.6 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGG 541 GG GGG G GGG G G G GGG GG Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSG------DGGGGAIGG 91 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG 569 GGG GGGG G GG GG G Sbjct: 62 GGGSGGGGGGGSGSGGGSGSGDGGGGAIG 90 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG 569 GG GGGG G G GG GG G Sbjct: 63 GGSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 >AM294879-1|CAL26865.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 37.1 bits (82), Expect = 0.028 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G GG G G G G GGGG Sbjct: 55 GGGGGGGGGGSGGGGG-----GGSGSGGGSGSGDGGGG 87 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXG 586 GGG GGG G GGG G G G G Sbjct: 57 GGGGGGGGSGGGGGGGSGSGGGSGSGDGG 85 Score = 29.5 bits (63), Expect = 5.6 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGG 541 GG GGG G GGG G G G GGG GG Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSG------DGGGGAIGG 91 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG 569 GGG GGGG G GG GG G Sbjct: 62 GGGSGGGGGGGSGSGGGSGSGDGGGGAIG 90 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG 569 GG GGGG G G GG GG G Sbjct: 63 GGSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 >AM294875-1|CAL26861.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 37.1 bits (82), Expect = 0.028 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G GG G G G G GGGG Sbjct: 55 GGGGGGGGGGSGGGGG-----GGSGSGGGSGSGDGGGG 87 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXG 586 GGG GGG G GGG G G G G Sbjct: 57 GGGGGGGGSGGGGGGGSGSGGGSGSGDGG 85 Score = 29.5 bits (63), Expect = 5.6 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGG 541 GG GGG G GGG G G G GGG GG Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSG------DGGGGAIGG 91 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG 569 GGG GGGG G GG GG G Sbjct: 62 GGGSGGGGGGGSGSGGGSGSGDGGGGAIG 90 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG 569 GG GGGG G G GG GG G Sbjct: 63 GGSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 >AM294874-1|CAL26860.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 37.1 bits (82), Expect = 0.028 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G GG G G G G GGGG Sbjct: 55 GGGGGGGGGGSGGGGG-----GGSGSGGGSGSGDGGGG 87 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXG 586 GGG GGG G GGG G G G G Sbjct: 57 GGGGGGGGSGGGGGGGSGSGGGSGSGDGG 85 Score = 29.5 bits (63), Expect = 5.6 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGG 541 GG GGG G GGG G G G GGG GG Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSG------DGGGGAIGG 91 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG 569 GGG GGGG G GG GG G Sbjct: 62 GGGSGGGGGGGSGSGGGSGSGDGGGGAIG 90 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG 569 GG GGGG G G GG GG G Sbjct: 63 GGSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 >AF067153-1|AAC18395.1| 1171|Drosophila melanogaster PIP82 protein protein. Length = 1171 Score = 37.1 bits (82), Expect = 0.028 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXP--PXXXXXXPPXXPXPXPPPP 644 PP PPPP P P P P PP P PPPP Sbjct: 872 PPSESPPPPPLPQRRPPTKRPATPPIYDAVPPSLPVSKPPPP 913 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +1 Query: 526 PPXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPPXXPP 669 PP PP PP P P P PP P P P PP Sbjct: 872 PPSESPPPPPLPQRRPPTKRP-----ATPPIYDAVPPSLPVSKPPPPP 914 >AE014298-1899|AAF48264.2| 158|Drosophila melanogaster CG1987-PA protein. Length = 158 Score = 37.1 bits (82), Expect = 0.028 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G GG G G G GGG Sbjct: 91 GGGGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDGGG 127 Score = 35.1 bits (77), Expect = 0.11 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GG GGGG G G GG G G G GGG Sbjct: 91 GGGGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDGGG 127 Score = 30.3 bits (65), Expect = 3.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXG 595 GGG GGG G GGG G G G Sbjct: 93 GGGGGGGGGGSGGGGRGGGSGARAGG 118 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXG 586 GGG GGG G GGG G G G Sbjct: 92 GGGGGGGGGGGSGGGGRGGGSGARAGGGG 120 >AE014298-1194|AAF46386.3| 1195|Drosophila melanogaster CG11219-PA protein. Length = 1195 Score = 37.1 bits (82), Expect = 0.028 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXP--PXXXXXXPPXXPXPXPPPP 644 PP PPPP P P P P PP P PPPP Sbjct: 896 PPSESPPPPPLPQRRPPTKRPATPPIYDAVPPPLPVSKPPPP 937 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +1 Query: 526 PPXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPPXXPP 669 PP PP PP P P P PP P P P PP Sbjct: 896 PPSESPPPPPLPQRRPPTKRP-----ATPPIYDAVPPPLPVSKPPPPP 938 >X58183-1|CAA41170.1| 386|Drosophila melanogaster heterogeneous nuclear ribonucleoproteinprotein. Length = 386 Score = 36.7 bits (81), Expect = 0.037 Identities = 29/93 (31%), Positives = 29/93 (31%), Gaps = 3/93 (3%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXG-GGXGXXGGGXXGXX 613 G G GG GG G G G GGG G G GG G Sbjct: 204 GRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGRGGGGGFGNSGGNFGGGQGGGSG 263 Query: 612 GXXXXGXXGXXXXXXXGGGXG--XGGXXXGGXG 520 G G G GGG G GG GG G Sbjct: 264 GWNQQGGTGGGPWNNQGGGNGGWNGGGGGGGYG 296 Score = 33.9 bits (74), Expect = 0.26 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG G GG G GG GG G GGG GG Sbjct: 200 GGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGRGG 243 Score = 33.9 bits (74), Expect = 0.26 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G GG G GGGG GG Sbjct: 255 GGGQGGGSGGWNQQGGTGGGPWNNQGGGNGGWNGGGGGGGYGGG 298 Score = 33.5 bits (73), Expect = 0.35 Identities = 25/78 (32%), Positives = 25/78 (32%), Gaps = 1/78 (1%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXG-GGXGGGGXGXGXXGGXXX 599 G G G G G G G G GG GGG G G GG Sbjct: 242 GGGGGFGNSGGNFGGGQGGGSGGWNQQGGTGGGPWNNQGGGNGGWNGGGGGGGYGGGNSN 301 Query: 598 XXXGGXXXXGXGXGXGGG 545 GG G G G GGG Sbjct: 302 GSWGG---NGGGGGGGGG 316 Score = 33.1 bits (72), Expect = 0.46 Identities = 22/77 (28%), Positives = 23/77 (29%), Gaps = 1/77 (1%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGX-GXGXXGGXXXXX 593 G GGG G G + G G G GG G G GG Sbjct: 240 GRGGGGGFGNSGGNFGGGQGGGSGGWNQQGGTGGGPWNNQGGGNGGWNGGGGGGGYGGGN 299 Query: 592 XGGXXXXGXGXGXGGGG 542 G G G GGGG Sbjct: 300 SNGSWGGNGGGGGGGGG 316 Score = 31.1 bits (67), Expect = 1.8 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGX-XGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 GGG GG GGG G G G G GGG G G G P Sbjct: 222 GGGGWGGQNRQNGGGNWGGRGGGGGFGNSGGNFGGGQGGGSGGWNQQGGTGGGP 275 Score = 29.9 bits (64), Expect = 4.3 Identities = 22/78 (28%), Positives = 22/78 (28%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GGG G G G G GGG GGG G GG Sbjct: 251 GGNFGGGQGGGSGGWNQQGGTGGGPWNNQGGGNGGWNGGGGGGGYGGGNSNGSWGGNGGG 310 Query: 595 XXGGXXXXGXGXGXGGGG 542 GG GGG Sbjct: 311 GGGGGGFGNEYQQSYGGG 328 Score = 29.5 bits (63), Expect = 5.6 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -2 Query: 657 GGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GGG G G G G G G GG GG GG Sbjct: 202 GGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGRGGGG 245 >BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p protein. Length = 145 Score = 36.7 bits (81), Expect = 0.037 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PPPP P P P P P P PPPP P Sbjct: 43 PPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAP 79 Score = 34.7 bits (76), Expect = 0.15 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 5/50 (10%) Frame = +2 Query: 545 PXPXPP-PXXXXXXXPXXPXXXXPXXPXXPPPXXP----XPPPXXPPPXA 679 P P PP P P P P PPP P PPP PPP A Sbjct: 29 PQPAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPA 78 Score = 33.9 bits (74), Expect = 0.26 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP P PPP P P PPP P P PP Sbjct: 36 PVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIPP 86 Score = 31.9 bits (69), Expect = 1.1 Identities = 20/62 (32%), Positives = 21/62 (33%), Gaps = 1/62 (1%) Frame = +2 Query: 620 PXXPPPXXPX-PPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXPFF 796 P P P PPP PPP A P P A PPPPPP + Sbjct: 31 PAPPAPVKSYIPPPPPPPPPAPKNTYIPP-------PAAPAKAYIPPPPPPPPPAPKNTY 83 Query: 797 FP 802 P Sbjct: 84 IP 85 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP P PPP P P P PP P P P P Sbjct: 63 PAKAYIPPPPPPPPPAPKNTYIPPAPAPVAPVETYI-PPAAPAPAYIPPAP 112 Score = 29.5 bits (63), Expect = 5.6 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 542 PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 PP P P P P P P PPP P P P Sbjct: 45 PPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIPPAP 88 Score = 28.7 bits (61), Expect = 9.8 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = +1 Query: 526 PPXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPPXXPP 669 PP PP P P P PP P P PP P Sbjct: 43 PPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIPPAPAP 90 >AY118420-1|AAM48449.1| 250|Drosophila melanogaster RE74758p protein. Length = 250 Score = 36.7 bits (81), Expect = 0.037 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 643 GGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGGG G G GG GG G G GGG GG Sbjct: 21 GGGGGGGGYGGGGSSHGGGGDGGYSYGGGGGGGSDHHGGG 60 Score = 35.1 bits (77), Expect = 0.11 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGGG G G GG GG G GGGG GG Sbjct: 17 GFIGGGGGGGGGYGGGGSSHGGGGDGGYSYGGGGGGGSDHHGG 59 Score = 33.5 bits (73), Expect = 0.35 Identities = 24/84 (28%), Positives = 24/84 (28%), Gaps = 4/84 (4%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX----AXGGGXXGGGXGXXGGGXX 622 G G GGGGG G G A GG GGG G GG Sbjct: 80 GSGGWQSGGGGGSGWTAGGGGGHGGGGGGQEIKIIKIISQQASSGGHGGGGYGGSSGGYG 139 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXG 550 G G GGG G Sbjct: 140 GASGGGWSSGGASSGGWSSGGGGG 163 Score = 33.1 bits (72), Expect = 0.46 Identities = 20/53 (37%), Positives = 21/53 (39%) Frame = -2 Query: 666 GXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKI 508 G GGG G GGG G G G G GGG G GG G P + Sbjct: 17 GFIGGGGG--GGGGYG-GGGSSHGGGGDGGYSYGGGGGGGSDHHGGGGGSPPV 66 Score = 32.7 bits (71), Expect = 0.60 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G GG GG G GGGG Sbjct: 26 GGGYGGGGSSHG-GGGDGGYSYGGGGGGGSDHHGGGGG 62 Score = 29.5 bits (63), Expect = 5.6 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGG 556 GGG GGG GGG G G G G GGG Sbjct: 25 GGGGYGGGGSSHGGG--GDGGYSYGGGGGGGSDHHGGGG 61 Score = 29.5 bits (63), Expect = 5.6 Identities = 26/91 (28%), Positives = 26/91 (28%), Gaps = 7/91 (7%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXG-GGXXGGGXG------XXGGGXXGXX 613 GGGGGG G G A G GG GG G GGG G Sbjct: 47 GGGGGGGSDHHGGGGGSPPVKVIKVIHETAPAGGSGGWQSGGGGGSGWTAGGGGGHGGGG 106 Query: 612 GXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GG G GG G Sbjct: 107 GGQEIKIIKIISQQASSGGHGGGGYGGSSGG 137 Score = 29.5 bits (63), Expect = 5.6 Identities = 21/77 (27%), Positives = 21/77 (27%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G G G G G G G GGG GG G Sbjct: 87 GGGGGSGWTAGGGGGHGGGGGGQEIKIIKIISQQASSGGHGGGGYGGSSGGYGGASGGGW 146 Query: 595 XXGGXXXXGXGXGXGGG 545 GG G G GGG Sbjct: 147 SSGGASSGGWSSGGGGG 163 >AY058341-1|AAL13570.1| 1024|Drosophila melanogaster GH11706p protein. Length = 1024 Score = 36.7 bits (81), Expect = 0.037 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXGGXXXKNF 506 GGG GGGG G GG GG G G G GGG GG K F Sbjct: 842 GGGIGGGGGARGVLGGGRSARGGGAGGGGFRGPGGPGGG---PGGGAWKGF 889 Score = 34.7 bits (76), Expect = 0.15 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G G GG G G GG G G G GGGG GG Sbjct: 835 GVGAGGDGGGIGGGGGARGVLGGGRSARGGGAGGGGFRGPGG 876 Score = 31.9 bits (69), Expect = 1.1 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 G G GGG G G GG G G G GG GG GG Sbjct: 837 GAGGDGGGIGGGGGARGVLGG-GRSARGGGAGGGGFRGPGGPGGGPGGG 884 Score = 30.7 bits (66), Expect = 2.4 Identities = 24/82 (29%), Positives = 24/82 (29%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GG GG G G A GGG GGG GG G G Sbjct: 832 GAWGVGAGGDGGGIGGGGGARGVLGGGRS--------ARGGGAGGGGFRGPGGPGGGPGG 883 Query: 609 XXXXGXXGXXXXXXXGGGXGXG 544 G G G G G Sbjct: 884 GAWKGFPTAAVGKAQGQGKGKG 905 Score = 29.5 bits (63), Expect = 5.6 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 666 GXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG G G G G GG G G GG G Sbjct: 832 GAWGVGAGGDGGGIGG--GGGARGVLGGGRSARGGGAGGGGFRGPGGPG 878 >AE014297-1806|AAF55026.1| 1024|Drosophila melanogaster CG14355-PA protein. Length = 1024 Score = 36.7 bits (81), Expect = 0.037 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG-XGXGXGGGGXXXXGGXXXKNF 506 GGG GGGG G GG GG G G G GGG GG K F Sbjct: 842 GGGIGGGGGARGVLGGGRSARGGGAGGGGFRGPGGPGGG---PGGGAWKGF 889 Score = 34.7 bits (76), Expect = 0.15 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G G GG G G GG G G G GGGG GG Sbjct: 835 GVGAGGDGGGIGGGGGARGVLGGGRSARGGGAGGGGFRGPGG 876 Score = 31.9 bits (69), Expect = 1.1 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 G G GGG G G GG G G G GG GG GG Sbjct: 837 GAGGDGGGIGGGGGARGVLGG-GRSARGGGAGGGGFRGPGGPGGGPGGG 884 Score = 30.7 bits (66), Expect = 2.4 Identities = 24/82 (29%), Positives = 24/82 (29%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GG GG G G A GGG GGG GG G G Sbjct: 832 GAWGVGAGGDGGGIGGGGGARGVLGGGRS--------ARGGGAGGGGFRGPGGPGGGPGG 883 Query: 609 XXXXGXXGXXXXXXXGGGXGXG 544 G G G G G Sbjct: 884 GAWKGFPTAAVGKAQGQGKGKG 905 Score = 29.5 bits (63), Expect = 5.6 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 666 GXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G GGG G G G G GG G G GG G Sbjct: 832 GAWGVGAGGDGGGIGG--GGGARGVLGGGRSARGGGAGGGGFRGPGGPG 878 >AE014296-2355|AAF49762.2| 1155|Drosophila melanogaster CG32138-PB, isoform B protein. Length = 1155 Score = 36.7 bits (81), Expect = 0.037 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXP-XXXXPXXPXXPPPXXPXPPPXXPPPXA 679 P PP PP P PPP P P P PP PP PPP A Sbjct: 606 PPPPPPAPPAPPPPPGFSPLGSPSGSLASTAPSPPHAPPMLSSFQPP--PPPVA 657 Score = 31.5 bits (68), Expect = 1.4 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 2/56 (3%) Frame = +2 Query: 629 PPPXXPXPPPXXPPPX--AXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 PPP P PP PPP P P PPPPP P Sbjct: 606 PPPPPPAPPAPPPPPGFSPLGSPSGSLASTAPSPPHAPPMLSSFQPPPPPVAGFMP 661 >AE014296-2354|AAF49761.2| 1165|Drosophila melanogaster CG32138-PA, isoform A protein. Length = 1165 Score = 36.7 bits (81), Expect = 0.037 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXP-XXXXPXXPXXPPPXXPXPPPXXPPPXA 679 P PP PP P PPP P P P PP PP PPP A Sbjct: 606 PPPPPPAPPAPPPPPGFSPLGSPSGSLASTAPSPPHAPPMLSSFQPP--PPPVA 657 Score = 31.5 bits (68), Expect = 1.4 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 2/56 (3%) Frame = +2 Query: 629 PPPXXPXPPPXXPPPX--AXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 PPP P PP PPP P P PPPPP P Sbjct: 606 PPPPPPAPPAPPPPPGFSPLGSPSGSLASTAPSPPHAPPMLSSFQPPPPPVAGFMP 661 >AE014296-1850|AAF50135.2| 250|Drosophila melanogaster CG12523-PA protein. Length = 250 Score = 36.7 bits (81), Expect = 0.037 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 643 GGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGGG G G GG GG G G GGG GG Sbjct: 21 GGGGGGGGYGGGGSSHGGGGDGGYSYGGGGGGGSDHHGGG 60 Score = 35.1 bits (77), Expect = 0.11 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 G GGGG G G GG GG G GGGG GG Sbjct: 17 GFIGGGGGGGGGYGGGGSSHGGGGDGGYSYGGGGGGGSDHHGG 59 Score = 33.5 bits (73), Expect = 0.35 Identities = 24/84 (28%), Positives = 24/84 (28%), Gaps = 4/84 (4%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGX----AXGGGXXGGGXGXXGGGXX 622 G G GGGGG G G A GG GGG G GG Sbjct: 80 GSGGWQSGGGGGSGWTAGGGGGHGGGGGGQEIKIIKIISQQASSGGHGGGGYGGSSGGYG 139 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXG 550 G G GGG G Sbjct: 140 GASGGGWSSGGASSGGWSSGGGGG 163 Score = 33.1 bits (72), Expect = 0.46 Identities = 20/53 (37%), Positives = 21/53 (39%) Frame = -2 Query: 666 GXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKI 508 G GGG G GGG G G G G GGG G GG G P + Sbjct: 17 GFIGGGGG--GGGGYG-GGGSSHGGGGDGGYSYGGGGGGGSDHHGGGGGSPPV 66 Score = 32.7 bits (71), Expect = 0.60 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G GG GG G GGGG Sbjct: 26 GGGYGGGGSSHG-GGGDGGYSYGGGGGGGSDHHGGGGG 62 Score = 29.5 bits (63), Expect = 5.6 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGG 556 GGG GGG GGG G G G G GGG Sbjct: 25 GGGGYGGGGSSHGGG--GDGGYSYGGGGGGGSDHHGGGG 61 Score = 29.5 bits (63), Expect = 5.6 Identities = 26/91 (28%), Positives = 26/91 (28%), Gaps = 7/91 (7%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXG-GGXXGGGXG------XXGGGXXGXX 613 GGGGGG G G A G GG GG G GGG G Sbjct: 47 GGGGGGGSDHHGGGGGSPPVKVIKVIHETAPAGGSGGWQSGGGGGSGWTAGGGGGHGGGG 106 Query: 612 GXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GG G GG G Sbjct: 107 GGQEIKIIKIISQQASSGGHGGGGYGGSSGG 137 Score = 29.5 bits (63), Expect = 5.6 Identities = 21/77 (27%), Positives = 21/77 (27%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G G G G G G G G GGG GG G Sbjct: 87 GGGGGSGWTAGGGGGHGGGGGGQEIKIIKIISQQASSGGHGGGGYGGSSGGYGGASGGGW 146 Query: 595 XXGGXXXXGXGXGXGGG 545 GG G G GGG Sbjct: 147 SSGGASSGGWSSGGGGG 163 >AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-PA protein. Length = 145 Score = 36.7 bits (81), Expect = 0.037 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PPPP P P P P P P PPPP P Sbjct: 43 PPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAP 79 Score = 34.7 bits (76), Expect = 0.15 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 5/50 (10%) Frame = +2 Query: 545 PXPXPP-PXXXXXXXPXXPXXXXPXXPXXPPPXXP----XPPPXXPPPXA 679 P P PP P P P P PPP P PPP PPP A Sbjct: 29 PQPAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPA 78 Score = 33.9 bits (74), Expect = 0.26 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP P PPP P P PPP P P PP Sbjct: 36 PVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIPP 86 Score = 31.9 bits (69), Expect = 1.1 Identities = 20/62 (32%), Positives = 21/62 (33%), Gaps = 1/62 (1%) Frame = +2 Query: 620 PXXPPPXXPX-PPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXPFF 796 P P P PPP PPP A P P A PPPPPP + Sbjct: 31 PAPPAPVKSYIPPPPPPPPPAPKNTYIPP-------PAAPAKAYIPPPPPPPPPAPKNTY 83 Query: 797 FP 802 P Sbjct: 84 IP 85 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP P PPP P P P PP P P P P Sbjct: 63 PAKAYIPPPPPPPPPAPKNTYIPPAPAPVAPVETYI-PPAAPAPAYIPPAP 112 Score = 29.5 bits (63), Expect = 5.6 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 542 PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 PP P P P P P P PPP P P P Sbjct: 45 PPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIPPAP 88 Score = 28.7 bits (61), Expect = 9.8 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = +1 Query: 526 PPXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPPXXPP 669 PP PP P P P PP P P PP P Sbjct: 43 PPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIPPAPAP 90 >AY075468-1|AAL68280.1| 127|Drosophila melanogaster RE28280p protein. Length = 127 Score = 36.3 bits (80), Expect = 0.049 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G GG G G G G GG GG Sbjct: 46 GGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGGGRRHGGGRGGGG 89 Score = 34.7 bits (76), Expect = 0.15 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 4/55 (7%) Frame = -2 Query: 672 GGGXXGGGXGXX--GGGXXGXX--GXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G GGG G G G G GGG G G GG G Sbjct: 32 GGGPYGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGGGRRHGGGRG 86 Score = 33.9 bits (74), Expect = 0.26 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGG-XXXXXXGGXXXXGXGXGXGGGG 542 GGG GGG G G GG GG G G G GGG Sbjct: 28 GGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGGGPYGGG 66 Score = 33.1 bits (72), Expect = 0.46 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGG G G G GG G G G GGG Sbjct: 55 GGGFGGGPYGGGF-GNPYGGGFGGGRRHGGGRGGGGG 90 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G GG G G GG GG Sbjct: 41 GGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGGGRRHGGGRGGGG 89 >AY052130-1|AAK93554.1| 455|Drosophila melanogaster SD08037p protein. Length = 455 Score = 36.3 bits (80), Expect = 0.049 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G GG GG G G G GGGG Sbjct: 336 GGGRGGGGNFRGGRGGGGGGGFGG----GRGGGGGGGG 369 Score = 30.3 bits (65), Expect = 3.2 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 G GGG G GG GG G G G GGGG G Sbjct: 333 GPPGGGRG---GGGNFRGGRGGGGGGGFGGGRGGGGGGGGG 370 >AE014298-3143|AAF50813.1| 183|Drosophila melanogaster CG10918-PA protein. Length = 183 Score = 36.3 bits (80), Expect = 0.049 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 A GGG GG G GGG G G G GG G GG GG G Sbjct: 18 AQGGGGRRGGRGGGGGGGRSLGGFGGRGGGGFGGRGGPGGTGGPGG--FGGPG 68 Score = 31.5 bits (68), Expect = 1.4 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG-GGXXXXGG 524 GGG GG G G GG GG G G GG GG GG Sbjct: 29 GGGGGG-GRSLGGFGGRGGGGFGGRGGPGGTGGPGGFGGPGRFGG 72 Score = 31.1 bits (67), Expect = 1.8 Identities = 26/83 (31%), Positives = 27/83 (32%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGGGG + G G G GG G G GG G G Sbjct: 23 GRRGGRGGGGGG-GRSLGGFGGRGGGGFGGRGGPGGTGGPGGFGGPGRFGGPGGLGGGGG 81 Query: 609 XXXXGXXGXXXXXXXGGGXGXGG 541 G G GG G GG Sbjct: 82 FGGPGRFG-GPGSFNGGFGGPGG 103 Score = 30.7 bits (66), Expect = 2.4 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -1 Query: 652 GGXGGGGXG-XGXXGG-XXXXXXGGXXXXGXGXGXGGGG 542 GG GGGG G G GG GG G G GGGG Sbjct: 42 GGRGGGGFGGRGGPGGTGGPGGFGGPGRFGGPGGLGGGG 80 >AE014297-3872|AAF56525.1| 454|Drosophila melanogaster CG5913-PA protein. Length = 454 Score = 36.3 bits (80), Expect = 0.049 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G GG GG G G G GGGG Sbjct: 336 GGGRGGGGNFRGGRGGGGGGGFGG----GRGGGGGGGG 369 Score = 30.3 bits (65), Expect = 3.2 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 649 GXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 G GGG G GG GG G G G GGGG G Sbjct: 333 GPPGGGRG---GGGNFRGGRGGGGGGGFGGGRGGGGGGGGG 370 >AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-PA protein. Length = 290 Score = 36.3 bits (80), Expect = 0.049 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P PPPP P P P PP P P PP P P Sbjct: 68 PKAKLPPPPPPPPPPPPPPPPPPPSPPGVPANPVSLPPQPVIVP 111 Score = 34.3 bits (75), Expect = 0.20 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 570 PXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P PP P P PPPP PPP Sbjct: 62 PRHVGKPKAKLPPPPPPPPPPPPPPPPPP 90 Score = 32.7 bits (71), Expect = 0.60 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 504 KKFLXXXPPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 K L PP PPPP P P P P PP P P P P Sbjct: 69 KAKLPPPPPPPPPPPPPPPPPPPSPPGVPANPVSLPP-QPVIVPLNPADP 117 Score = 32.3 bits (70), Expect = 0.80 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 596 PXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P PPP P PPP P P Sbjct: 68 PKAKLPPPPPPPPPPPPPPPPPPPSP 93 Score = 31.5 bits (68), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPPXXPP 670 P P PPP P PPP PP Sbjct: 75 PPPPPPPPPPPPPPPPPSPP 94 Score = 31.1 bits (67), Expect = 1.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPPXXPPP 673 P P PPP P PPP PP Sbjct: 74 PPPPPPPPPPPPPPPPPPSPP 94 Score = 27.5 bits (58), Expect(2) = 0.51 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +2 Query: 725 PXXPXXAXXXPPPPPPXXPXXP 790 P P PPPPPP P P Sbjct: 76 PPPPPPPPPPPPPPPPSPPGVP 97 Score = 24.2 bits (50), Expect(2) = 0.51 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPPXXPPP 673 P P P PPP PPP Sbjct: 62 PRHVGKPKAKLPPPPPPPPPP 82 >AE014134-1931|AAF52991.1| 127|Drosophila melanogaster CG7294-PA protein. Length = 127 Score = 36.3 bits (80), Expect = 0.049 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G GG G G G G GG GG Sbjct: 46 GGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGGGRRHGGGRGGGG 89 Score = 34.7 bits (76), Expect = 0.15 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 4/55 (7%) Frame = -2 Query: 672 GGGXXGGGXGXX--GGGXXGXX--GXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 GGG GGG G GGG G G G G GGG G G GG G Sbjct: 32 GGGPYGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGGGRRHGGGRG 86 Score = 33.9 bits (74), Expect = 0.26 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGG-XXXXXXGGXXXXGXGXGXGGGG 542 GGG GGG G G GG GG G G G GGG Sbjct: 28 GGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGGGPYGGG 66 Score = 33.1 bits (72), Expect = 0.46 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGG G G G GG G G G GGG Sbjct: 55 GGGFGGGPYGGGF-GNPYGGGFGGGRRHGGGRGGGGG 90 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGG 525 GGG GGG G G GG G G GG GG Sbjct: 41 GGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGGGRRHGGGRGGGG 89 >X71976-1|CAA50796.1| 188|Drosophila melanogaster GCR 1 protein protein. Length = 188 Score = 35.9 bits (79), Expect = 0.065 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G GG GG G G GG Sbjct: 29 GGGGGGGGFGGGFGGGFGGGLGGGGGGGGGGYQAVSGG 66 Score = 31.5 bits (68), Expect = 1.4 Identities = 25/91 (27%), Positives = 25/91 (27%), Gaps = 4/91 (4%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXG----CXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G GGGGGG A G G GGG G GGG Sbjct: 47 GGLGGGGGGGGGGYQAVSGGFQTSEGQNVDPQLLEQVRQILLNEESKQGGGGGGGGGGGG 106 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXG 529 G G G G GG G Sbjct: 107 GGYPSGPSSSYGPPSTSYGAPGIGGGGRVVG 137 Score = 30.3 bits (65), Expect = 3.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G G GGGG Sbjct: 96 GGGGGGGGGGGGGYPSGPSSSYGPPSTSYGAPGIGGGG 133 >AY119132-1|AAM50992.1| 188|Drosophila melanogaster RE35358p protein. Length = 188 Score = 35.9 bits (79), Expect = 0.065 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G GG GG G G GG Sbjct: 29 GGGGGGGGFGGGFGGGFGGGLGGGGGGGGGGYQAVSGG 66 Score = 31.5 bits (68), Expect = 1.4 Identities = 25/91 (27%), Positives = 25/91 (27%), Gaps = 4/91 (4%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXG----CXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G GGGGGG A G G GGG G GGG Sbjct: 47 GGLGGGGGGGGGGYQAVSGGFQTSEGQNVDPQLLEQVRQILLNEESKQGGGGGGGGGGGG 106 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXG 529 G G G G GG G Sbjct: 107 GGYPSGPSSSYGPPSTSYGAPGIGGGGRVVG 137 Score = 30.3 bits (65), Expect = 3.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G G GGGG Sbjct: 96 GGGGGGGGGGGGGYPSGPSSSYGPPSTSYGAPGIGGGG 133 >AY119041-1|AAM50901.1| 393|Drosophila melanogaster LP06455p protein. Length = 393 Score = 35.9 bits (79), Expect = 0.065 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G GG GG G G G GGG GG Sbjct: 164 GGGLLGGGGGLGGNGG------GGGGLLGGGGGDNGGGGGLLGG 201 >AE014298-1193|AAF46385.1| 679|Drosophila melanogaster CG33181-PA protein. Length = 679 Score = 35.9 bits (79), Expect = 0.065 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXG 557 GGG GGGG G G GG GG G G G Sbjct: 193 GGGGGGGGGGGGGIGGAGGGGGGGGGNGGIGSG 225 Score = 32.7 bits (71), Expect = 0.60 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 G GGGG G G GG GG G G G G G Sbjct: 188 GAVSGGGGGGGGGGGGGGIGGAGGGGGGGGGNGGIGSG 225 Score = 30.3 bits (65), Expect = 3.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXG 595 GGG GGG G GGG G G G Sbjct: 198 GGGGGGGGIGGAGGGGGGGGGNGGIG 223 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXG 586 GGG GGG G GG G G G G Sbjct: 195 GGGGGGGGGGGIGGAGGGGGGGGGNGGIG 223 Score = 29.1 bits (62), Expect = 7.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGGGXXGXXGXXXXG 595 A GG GGG G GGG G G G Sbjct: 189 AVSGGGGGGGGGGGGGGIGGAGGGGGGG 216 >AE014297-4805|AAF57194.1| 188|Drosophila melanogaster CG2150-PA protein. Length = 188 Score = 35.9 bits (79), Expect = 0.065 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G GG GG G G GG Sbjct: 29 GGGGGGGGFGGGFGGGFGGGLGGGGGGGGGGYQAVSGG 66 Score = 31.5 bits (68), Expect = 1.4 Identities = 25/91 (27%), Positives = 25/91 (27%), Gaps = 4/91 (4%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXG----CXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G GGGGGG A G G GGG G GGG Sbjct: 47 GGLGGGGGGGGGGYQAVSGGFQTSEGQNVDPQLLEQVRQILLNEESKQGGGGGGGGGGGG 106 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXG 529 G G G G GG G Sbjct: 107 GGYPSGPSSSYGPPSTSYGAPGIGGGGRVVG 137 Score = 30.3 bits (65), Expect = 3.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G G GGGG Sbjct: 96 GGGGGGGGGGGGGYPSGPSSSYGPPSTSYGAPGIGGGG 133 >AE014297-416|AAF51905.3| 393|Drosophila melanogaster CG10303-PA protein. Length = 393 Score = 35.9 bits (79), Expect = 0.065 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGG G G GG GG G G G GGG GG Sbjct: 164 GGGLLGGGGGLGGNGG------GGGGLLGGGGGDNGGGGGLLGG 201 >AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-PA protein. Length = 239 Score = 35.9 bits (79), Expect = 0.065 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P PPPP P P PP P P P PPPP PPP Sbjct: 180 PNHGQYPPPPPPPPY----YPPY------PYYPPPPPPPPLPPP 213 Score = 30.3 bits (65), Expect = 3.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 587 PXXPXXXXPXXPXXPPPXXPXPPPXXPP 670 P P P P PPP P PPP PP Sbjct: 188 PPPPPPYYPPYPYYPPP--PPPPPLPPP 213 Score = 29.9 bits (64), Expect = 4.3 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +3 Query: 504 KKFLXXXPPXXXXPP--PPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 KK P PP PP P P P P P P P PP P P P Sbjct: 94 KKSKTTKRPYYPYPPKYPPYP-PYPHYSPYPAPPYPYPGYYPPPPPPYPYPYP 145 Score = 28.7 bits (61), Expect = 9.8 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 Query: 755 PPPPPPXXPXXPFFFP 802 PPPPPP P P++ P Sbjct: 188 PPPPPPYYPPYPYYPP 203 Score = 25.8 bits (54), Expect(2) = 3.3 Identities = 11/22 (50%), Positives = 11/22 (50%), Gaps = 1/22 (4%) Frame = +2 Query: 611 PXXPXXPP-PXXPXPPPXXPPP 673 P P PP P P PPP P P Sbjct: 190 PPPPYYPPYPYYPPPPPPPPLP 211 Score = 25.0 bits (52), Expect(2) = 9.4 Identities = 11/23 (47%), Positives = 11/23 (47%), Gaps = 2/23 (8%) Frame = +2 Query: 611 PXXPXXPPPXXPXP--PPXXPPP 673 P P PP P P PP PPP Sbjct: 186 PPPPPPPPYYPPYPYYPPPPPPP 208 Score = 23.0 bits (47), Expect(2) = 3.3 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 755 PPPPPPXXP 781 PPPPPP P Sbjct: 204 PPPPPPLPP 212 Score = 22.2 bits (45), Expect(2) = 9.4 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 758 PPPPPXXPXXP 790 PPPPP P P Sbjct: 202 PPPPPPPPLPP 212 >AY058599-1|AAL13828.1| 773|Drosophila melanogaster LD29226p protein. Length = 773 Score = 35.5 bits (78), Expect = 0.086 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXX--PXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 PP P PPP P P P P PP P PPP PP Sbjct: 178 PPMMMPTTNMPPPMMMPPTMMPPGFPGIGGPPHPMALPPGAPFPPPGAVPP 228 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P P PP PP P P PP PPP Sbjct: 188 PPPMMMPPTMMPPGFPGIGGPP-HPMALPPGAPFP-PPGAVPPP 229 Score = 31.1 bits (67), Expect = 1.8 Identities = 25/105 (23%), Positives = 28/105 (26%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G G GGGG G GG G G GGG Sbjct: 452 GPSGGGPGGAGTGGGGPGGRQQGPGFFNPRNPFNDNQRGRGGQSGGGVRGVGGGGGGGPG 511 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKIFXXKXSN 487 G G GG G GG G ++ + N Sbjct: 512 GRGRWSDDEDEGGNNFKRRGGPGGPGGNRFRGERGGEMMDDRRGN 556 Score = 29.9 bits (64), Expect = 4.3 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 PP P P PP P P PP PPP PP Sbjct: 125 PPPVGPVGPVGPPPGPGAPPPGLMGMVRGQFPMAPPMGINMPPPIMMPP 173 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 542 PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPP 658 P PPP P P P PPP PPP Sbjct: 107 PSVGVPPPNLIFGIDTTQPPPVGPVGPVGPPPGPGAPPP 145 Score = 29.5 bits (63), Expect = 5.6 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPP 658 PP P PP P P P P PP P P P Sbjct: 188 PPPMMMPPTMMPPGFPGIGGPPHPMALPPGAPFPPPGAVPPPIP 231 >AM294878-1|CAL26864.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 35.5 bits (78), Expect = 0.086 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G GG GG G G G GG Sbjct: 57 GGGGGGGGSGGGGGGG---SGSGGGSGSGDGGGGANGG 91 Score = 35.1 bits (77), Expect = 0.11 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GG GGGG G G GG GG G G GG Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGANGG 91 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G GG G G G G GGGG Sbjct: 56 GGGGGGGGGSGGGGGG------GSGSGGGSGSGDGGGG 87 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXG 586 GGG GGG G GGG G G G G Sbjct: 57 GGGGGGGGSGGGGGGGSGSGGGSGSGDGG 85 >AM294877-1|CAL26863.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 35.5 bits (78), Expect = 0.086 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G GG GG G G G GG Sbjct: 57 GGGGGGGGSGGGGGGG---SGSGGGSGSGDGGGGANGG 91 Score = 35.1 bits (77), Expect = 0.11 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GG GGGG G G GG GG G G GG Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGANGG 91 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G GG G G G G GGGG Sbjct: 56 GGGGGGGGGSGGGGGG------GSGSGGGSGSGDGGGG 87 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXG 586 GGG GGG G GGG G G G G Sbjct: 57 GGGGGGGGSGGGGGGGSGSGGGSGSGDGG 85 >AM294876-1|CAL26862.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 35.5 bits (78), Expect = 0.086 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GGGG G G GG GG G G G G GG GG Sbjct: 55 GGGGGGGGGGSG--GG-----SGGGSGSGGGSGSGDGGGGAIGG 91 Score = 29.5 bits (63), Expect = 5.6 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 669 GGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGG 541 GG GGG G GGG G G G GGG GG Sbjct: 55 GGGGGGGGGGSGGGSGGGSGSGGGSGSG------DGGGGAIGG 91 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXG 586 GGG GGG G GG G G G G Sbjct: 57 GGGGGGGGSGGGSGGGSGSGGGSGSGDGG 85 >AJ243904-1|CAB64937.1| 773|Drosophila melanogaster SF1 protein protein. Length = 773 Score = 35.5 bits (78), Expect = 0.086 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P PP P P PPP P P P PP PP PPP Sbjct: 689 PAPPGTQAPPPMPPPLMPWMSAPQPP--PPATEPLNPPIPGTLPPLIPPPP 737 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXP-PXXXXXXPPXXPXPXPPPPXPPP 656 PP PPP P P P P P P P PP PP Sbjct: 691 PPGTQAPPPMPPPLMPWMSAPQPPPPATEPLNPPIPGTLPPLIPP 735 >AE014296-862|AAF47912.1| 707|Drosophila melanogaster CG13722-PA protein. Length = 707 Score = 35.5 bits (78), Expect = 0.086 Identities = 25/100 (25%), Positives = 28/100 (28%) Frame = +2 Query: 503 KKIFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAX 682 K+ + P P PP PP P P P P P P P PPP Sbjct: 366 KQGYDYPKPAVPFPPPTNPPQKYLPPVVPTTP--PQPKYLPPPKPTNPPQPKYLPPPQPK 423 Query: 683 XXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXPFFFP 802 P P PP P P P + P Sbjct: 424 SGYDYPKPAIPFPPPTNPPQKYL--PPVVPTSPPQPKYLP 461 Score = 34.7 bits (76), Expect = 0.15 Identities = 25/93 (26%), Positives = 25/93 (26%), Gaps = 10/93 (10%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXP------XXPPPXXPXPPPXXPP---- 670 P PP PP PP P P P P P P PPP PP Sbjct: 330 PFPPPTAPPQKYLPPVTTTKAPPPPPTVKYLPPPQVKQGYDYPKPAVPFPPPTNPPQKYL 389 Query: 671 PXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPP 769 P P P PPP P Sbjct: 390 PPVVPTTPPQPKYLPPPKPTNPPQPKYLPPPQP 422 Score = 33.9 bits (74), Expect = 0.26 Identities = 24/85 (28%), Positives = 24/85 (28%), Gaps = 3/85 (3%) Frame = +3 Query: 525 PPXXXXPPPPXPX--PXPXXXXPPXXXXXXP-PXXPXPXPPPPXPPPXXXXXXXXXXXXX 695 PP PPP P P P PP P P PPP PP Sbjct: 397 PPQPKYLPPPKPTNPPQPKYLPPPQPKSGYDYPKPAIPFPPPTNPPQKYLPPVVPTSPPQ 456 Query: 696 XXXXXXXXPXQXXPXXPXXXPPPXP 770 P P P PPP P Sbjct: 457 PKYLPPPKPTN--PPQPKYLPPPQP 479 Score = 33.5 bits (73), Expect = 0.35 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 5/55 (9%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXP-----XXPPPXXPXPPPXXPP 670 P PP PP PP P P P P P P PPP PP Sbjct: 284 PFPPPTAPPQKYLPPVTTTQAPPPPPPKYLPPPQVKQGYDYPKPAIPFPPPTAPP 338 Score = 33.1 bits (72), Expect = 0.46 Identities = 26/98 (26%), Positives = 26/98 (26%), Gaps = 8/98 (8%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXP--------XXPPPXXPXPPPXXPPPX 676 P PP PP PP P P P P P P PPP PP Sbjct: 184 PFPPPTAPPQKYLPPVTTTPAPPPPPPPTKKYLPPPQVKQGYDYPKPAIPFPPPTNPP-- 241 Query: 677 AXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXP 790 P P PPP P P P Sbjct: 242 --------QKYLPPVVPTSPPVPKYVPPPTPTYIPPPP 271 Score = 33.1 bits (72), Expect = 0.46 Identities = 24/87 (27%), Positives = 25/87 (28%), Gaps = 6/87 (6%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP------XXPXPPPXXPPPXAX 682 P PP PP PP P P P PPP P P PPP A Sbjct: 546 PFPPPTAPPQKYLPPVTTTQAPPPPP----PTSKYLPPPQVKQGYDYPKPAIPFPPPTAP 601 Query: 683 XXXXXXXXXXXXXXPXXPXXAXXXPPP 763 P P + PPP Sbjct: 602 PQKYLPPVTTTQAPPPPPPTSKYLPPP 628 Score = 32.7 bits (71), Expect = 0.60 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +3 Query: 525 PPXXXXP-PPPXPXPXPXXXXPPXXXXXXP-PXXPXPXPPPPXPP 653 PP P PPP P P PP P P PPP PP Sbjct: 197 PPVTTTPAPPPPPPPTKKYLPPPQVKQGYDYPKPAIPFPPPTNPP 241 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 7/57 (12%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXP-------XXPPPXXPXPPPXXPP 670 P PP PP PP P P P P P P PPP PP Sbjct: 594 PFPPPTAPPQKYLPPVTTTQAPPPPPPTSKYLPPPQVKQGYDYPKPAIPFPPPTNPP 650 Score = 30.3 bits (65), Expect = 3.2 Identities = 21/90 (23%), Positives = 23/90 (25%) Frame = +2 Query: 503 KKIFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAX 682 K+ + P P PP PP P P P P P PP Sbjct: 222 KQGYDYPKPAIPFPPPTNPPQKYLPPVVPTSP-PVPKYVPPPTPTYIPPPPKKQGYDYPK 280 Query: 683 XXXXXXXXXXXXXXPXXPXXAXXXPPPPPP 772 P PPPPPP Sbjct: 281 PAIPFPPPTAPPQKYLPPVTTTQAPPPPPP 310 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/51 (31%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +3 Query: 504 KKFLXXXPPXXXXPPPPXPXPXPXXXXPPXXXXXXP-PXXPXPXPPPPXPP 653 +K+L P P P P P PP P P PPP PP Sbjct: 242 QKYLPPVVPTSPPVPKYVPPPTPTYIPPPPKKQGYDYPKPAIPFPPPTAPP 292 Score = 29.5 bits (63), Expect = 5.6 Identities = 21/82 (25%), Positives = 22/82 (26%), Gaps = 4/82 (4%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPP----XPPPXXXXXXXXXXXXXXXXXX 710 P P P P P PP P PPPP PPP Sbjct: 541 PKPAIPFPPPTA--PPQKYLPPVTTTQAPPPPPPTSKYLPPPQVKQGYDYPKPAIPFPPP 598 Query: 711 XXXPXQXXPXXPXXXPPPXPXP 776 P + P PP P P Sbjct: 599 TAPPQKYLPPVTTTQAPPPPPP 620 Score = 28.7 bits (61), Expect = 9.8 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P PP P PP P P P P PP PP Sbjct: 455 PQPKYLPPPKPTNPPQPKYLPPPQPKSGYDYPKPAIPFPAPTNPPQKYLPP 505 Score = 28.7 bits (61), Expect = 9.8 Identities = 24/100 (24%), Positives = 25/100 (25%), Gaps = 6/100 (6%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXP--PPXAXXXXX 694 P P PP P P P P PP PPP P PP Sbjct: 461 PPPKPTNPPQPKYLPPPQPKSGYDYPKPAIPFPAPTNPPQKYLPPPVIPTSPPVPKYLPP 520 Query: 695 XXXXXXXXXXPXXPXXAXXXPPP----PPPXXPXXPFFFP 802 P P P PPP P + P Sbjct: 521 TNPPTPQYLPPVQVKQGYDYPKPAIPFPPPTAPPQKYLPP 560 Score = 28.7 bits (61), Expect = 9.8 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P P PP P PPP PP Sbjct: 559 PPVTTTQAPPPPPPTSKYLPPPQVKQGYDYPKPAIPFPPPTAPP 602 >AE013599-3146|AAF46686.2| 1215|Drosophila melanogaster CG4266-PA protein. Length = 1215 Score = 35.5 bits (78), Expect = 0.086 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXX--PXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 PP P PPP P P P P PP P PPP PP Sbjct: 620 PPMMMPTTNMPPPMMMPPTMMPPGFPGIGGPPHPMALPPGAPFPPPGAVPP 670 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PP P P PP PP P P PP PPP Sbjct: 630 PPPMMMPPTMMPPGFPGIGGPP-HPMALPPGAPFP-PPGAVPPP 671 Score = 31.1 bits (67), Expect = 1.8 Identities = 25/105 (23%), Positives = 28/105 (26%) Frame = -2 Query: 801 GKKKGXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXX 622 G G G G GGGG G GG G G GGG Sbjct: 894 GPSGGGPGGAGTGGGGPGGRQQGPGFFNPRNPFNDNQRGRGGQSGGGVRGVGGGGGGGPG 953 Query: 621 GXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXPKIFXXKXSN 487 G G GG G GG G ++ + N Sbjct: 954 GRGRWSDDEDEGGNNFKRRGGPGGPGGNRFRGERGGEMMDDRRGN 998 Score = 29.9 bits (64), Expect = 4.3 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 PP P P PP P P PP PPP PP Sbjct: 567 PPPVGPVGPVGPPPGPGAPPPGLMGMVRGQFPMAPPMGINMPPPIMMPP 615 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 542 PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPP 658 P PPP P P P PPP PPP Sbjct: 549 PSVGVPPPNLIFGIDTTQPPPVGPVGPVGPPPGPGAPPP 587 Score = 29.5 bits (63), Expect = 5.6 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPP 658 PP P PP P P P P PP P P P Sbjct: 630 PPPMMMPPTMMPPGFPGIGGPPHPMALPPGAPFPPPGAVPPPIP 673 >AE014297-426|AAF51896.2| 171|Drosophila melanogaster CG15597-PA protein. Length = 171 Score = 35.1 bits (77), Expect = 0.11 Identities = 27/93 (29%), Positives = 27/93 (29%), Gaps = 5/93 (5%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GG GGG G GGG GG G GGG G G Sbjct: 54 GGGGYGGGYGGGYGGGYGGGGYGGESTVKVIKVITDSGAGGGYRGGYAGGYGGGYGGGYG 113 Query: 609 XXXXGXXG-----XXXXXXXGGGXGXGGXXXGG 526 G G G G GG GG Sbjct: 114 GAYGGGYGGGSTVKIIKVITDSGSGYGGGYGGG 146 Score = 31.1 bits (67), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGG 584 GGG GGGG G G GG GG Sbjct: 50 GGGGGGGGYGGGYGGGYGGGYGGG 73 Score = 30.3 bits (65), Expect = 3.2 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGG 526 GGG GG G GGG G G G G GG GG Sbjct: 51 GGGGGGGYGGGYGGGYGGGYGGGGYGGESTVKVIKVITDSGAGGGYRGG 99 Score = 29.9 bits (64), Expect = 4.3 Identities = 18/62 (29%), Positives = 19/62 (30%) Frame = -1 Query: 769 GXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXXXX 590 G GG G G + G GGG GGGG G GG Sbjct: 102 GGYGGGYGGGYGGAYGGGYGGGSTVKIIKVITDSGSGYGGGYGGGGWTSGSYGGSYAGGY 161 Query: 589 GG 584 GG Sbjct: 162 GG 163 >AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-PA protein. Length = 1644 Score = 34.7 bits (76), Expect = 0.15 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXP-----PPPXPPP 656 PPPP P PP PP P P PPP PPP Sbjct: 273 PPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 32.7 bits (71), Expect = 0.60 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = +2 Query: 545 PXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP---XXPXPPPXXPP 670 P P PPP P P P PPP PPP PP Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 29.5 bits (63), Expect = 5.6 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 542 PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 PP P PP P P P PP P PPP Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPP 314 Score = 28.7 bits (61), Expect = 9.8 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P PPP P PP PPP P P PPPP P Sbjct: 272 PPPPPPMAPAAPPPPPPPI----------NGAAPPPPPPPMINGGALPPPPPPP 315 >AE014134-2469|AAS64704.1| 1853|Drosophila melanogaster CG32972-PA, isoform A protein. Length = 1853 Score = 34.7 bits (76), Expect = 0.15 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +2 Query: 629 PPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPXXPFF 796 PPP P PPP P + P P A PPP PP P FF Sbjct: 1798 PPPRFPLPPPPFPFIGSLPEADSAVIAILPIPPPPPIPAFPRPPPRPP-LPFGNFF 1852 Score = 32.3 bits (70), Expect = 0.80 Identities = 19/60 (31%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +2 Query: 506 KIFGXPXPPXXXPPXPXPPPXXXXXXX-PXXPXXXXPXXPXXPPPXXPX---PPPXXPPP 673 ++ G P P P P PPP P P PPP P PPP P P Sbjct: 1788 EVIGPPAFPLPPPRFPLPPPPFPFIGSLPEADSAVIAILPIPPPPPIPAFPRPPPRPPLP 1847 >AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. Length = 1644 Score = 34.7 bits (76), Expect = 0.15 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXP-----PPPXPPP 656 PPPP P PP PP P P PPP PPP Sbjct: 273 PPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 32.7 bits (71), Expect = 0.60 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = +2 Query: 545 PXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP---XXPXPPPXXPP 670 P P PPP P P P PPP PPP PP Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 29.5 bits (63), Expect = 5.6 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 542 PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 PP P PP P P P PP P PPP Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPP 314 Score = 28.7 bits (61), Expect = 9.8 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 P PPP P PP PPP P P PPPP P Sbjct: 272 PPPPPPMAPAAPPPPPPPI----------NGAAPPPPPPPMINGGALPPPPPPP 315 >X62638-1|CAA44504.1| 345|Drosophila melanogaster hrp40.2 protein. Length = 345 Score = 34.3 bits (75), Expect = 0.20 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGG--GGXXXXGG 524 GGG G G G G GG GG G G GG GG GG Sbjct: 291 GGGFEGNGYGGGGGGGNMGGGRGGPRGGGGPKGGGGFNGGKQRGGG 336 Score = 30.7 bits (66), Expect = 2.4 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GG G GG G GG G G G G G G GG Sbjct: 262 GGYGAGGYGDYYAGGYYNGYDYGYDGYGYGGGFEGNGYGGGGG 304 Score = 30.7 bits (66), Expect = 2.4 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = -3 Query: 671 GGGXXGGGXGXXGXGXXXXGGXXXXXXXGXXXXGXXXGXGGXGGXXXGGXXXQK 510 GGG G G G G G GG G G G G GG GG Q+ Sbjct: 291 GGGFEGNGYGGGGGGGNMGGGRGGPRGGG----GPKGGGGFNGGKQRGGGGRQQ 340 Score = 30.7 bits (66), Expect = 2.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGG G G G G G GGGG Sbjct: 300 GGGGGGGNMGGGRGGPRGGGGPKGGGGFNGGKQRGGGG 337 >BT029607-1|ABL75666.1| 337|Drosophila melanogaster IP17050p protein. Length = 337 Score = 34.3 bits (75), Expect = 0.20 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P P P PP P P P PPPP PPP Sbjct: 207 PTPGAYYPPPPPFYPPYYGYP-PYYPPYPYPPPPPPPP 243 Score = 30.7 bits (66), Expect = 2.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPP P P PP P P P PPPP P Sbjct: 214 PPPPPFYPPYYGYPPYYP---PYPYPPPPPPPPTHKP 247 >AM294872-1|CAL26858.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G GG G G G G GGGG Sbjct: 56 GGGGGGGGGSGGGGGG------GSGSGGGSGSGDGGGG 87 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXG 586 GGG GGG G GGG G G G G Sbjct: 57 GGGGGGGGSGGGGGGGSGSGGGSGSGDGG 85 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG 569 GGG GGGG G GG GG G Sbjct: 62 GGGSGGGGGGGSGSGGGSGSGDGGGGAIG 90 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG 569 GG GGGG G G GG GG G Sbjct: 63 GGSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 >AE014298-2877|AAF48974.1| 348|Drosophila melanogaster CG14218-PA protein. Length = 348 Score = 34.3 bits (75), Expect = 0.20 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = +2 Query: 542 PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXX 721 PP P PP P P P P P PPP PP Sbjct: 114 PPAPRPPAPAPPTTQP--PRRVRPQVRPRPRPTTLAPPP---PPNYDYDYDYDAQPAAPA 168 Query: 722 XPXXPXXAXXXPPPPPPXXPXXP 790 P P PPPPPP P P Sbjct: 169 EPPPPP-----PPPPPPTAPPRP 186 Score = 34.3 bits (75), Expect = 0.20 Identities = 21/78 (26%), Positives = 21/78 (26%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXXXXXXXXP 722 P P P P P PP P P P P PPP P Sbjct: 115 PAPRPPAPAPPTTQPP--RRVRPQVRPRPRPTTLAPPPPPNYDYDYDYDAQPAAPAEPPP 172 Query: 723 XQXXPXXPXXXPPPXPXP 776 P P P P P P Sbjct: 173 PPPPPPPPTAPPRPRPRP 190 Score = 31.9 bits (69), Expect = 1.1 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 7/56 (12%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXX-------PXXPXXPPPXXPXPPPXXPPP 673 PP P P P P P P P PPP P PPP PP Sbjct: 129 PPRRVRPQVRPRPRPTTLAPPPPPNYDYDYDYDAQPAAPAEPPPPPPPPPPPTAPP 184 Score = 29.9 bits (64), Expect = 4.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 P PPP P P P PP P P P P P P Sbjct: 164 PAAPAEPPPPPPPPPPPTAPP-----RPRPRPRPRPQQPDP 199 Score = 29.5 bits (63), Expect = 5.6 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P P P P P P PPPP PPP Sbjct: 135 PQVRPRPRPTTLAPPPPPNYDYDYDYDAQPAAPAEPPPPPPPPP 178 Score = 28.7 bits (61), Expect = 9.8 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 542 PPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 PP P P P P P PPP P P P P Sbjct: 149 PPPPNYDYDYDYDAQPAAPAEPPPPPPPPPPPTAPPRPRPRPRP 192 >AE014298-1168|AAF46366.1| 926|Drosophila melanogaster CG10555-PA protein. Length = 926 Score = 34.3 bits (75), Expect = 0.20 Identities = 23/92 (25%), Positives = 25/92 (27%), Gaps = 1/92 (1%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXX 700 P P PP PPP P P PPP P PPP Sbjct: 548 PVPGQQQPPPGPPPPGQPPTGGQQQPPPGPPQSQYGPPP--PQNSAGGPPPMGYAGYPPN 605 Query: 701 XXXXXXXXP-XXPXXAXXXPPPPPPXXPXXPF 793 P + PPPPP P+ Sbjct: 606 PGQYGQAGAGGGPPPSGYWPPPPPTSSAQSPY 637 Score = 30.3 bits (65), Expect = 3.2 Identities = 25/90 (27%), Positives = 26/90 (28%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGG G G GG G GGG G G Sbjct: 57 GVGPGGGGGGIPGGGGILSMGMQQQQQRPPMGVPGSPGSIISGGGG--GGGVIGGGGMPG 114 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGGXGXPK 511 G GG GG GG G P+ Sbjct: 115 GGMMVTPTSTPRGGANMQGG---GGGGVPQ 141 Score = 30.3 bits (65), Expect = 3.2 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP PPPP PP PP P PPPP PP Sbjct: 532 PPPGAYPPPPG-----SQQVPPVPGQQQPP----PGPPPPGQPP 566 >M23221-1|AAA28540.1| 2038|Drosophila melanogaster fsh protein. Length = 2038 Score = 33.9 bits (74), Expect = 0.26 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GG GGGG G GG GG G G GGGG Sbjct: 1819 GGSGGGGGSGPASAGG-PNSGGGGTANSNSGGGGGGGG 1855 Score = 28.7 bits (61), Expect = 9.8 Identities = 24/90 (26%), Positives = 24/90 (26%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGG G A G GGG GGG G G Sbjct: 1817 GSGGSGGGGGSGPASAGGPNSGGGGTANSNS--------GGGGGGGGPALLNAGSNSNSG 1868 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GG G GG G Sbjct: 1869 VGSGGAASSNSNSSVGGIVGSGGPGSNSQG 1898 >M15762-1|AAA70424.1| 50|Drosophila melanogaster unknown protein protein. Length = 50 Score = 33.9 bits (74), Expect = 0.26 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GG GGGG G GG GG G G GGGG Sbjct: 8 GGSGGGGGSGPASAGG-PNSGGGGTANSNSGGGGGGGG 44 >BT011110-1|AAR82777.1| 1777|Drosophila melanogaster LD32107p protein. Length = 1777 Score = 33.9 bits (74), Expect = 0.26 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P PP P P PP PP P PPPP PPP Sbjct: 1271 PTPPKPVAAPV---PPPPLPLTPPAAP---PPPPPPPP 1302 Score = 29.1 bits (62), Expect(2) = 0.59 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 596 PXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P PPP P PP PPP Sbjct: 1271 PTPPKPVAAPVPPPPLPLTPPAAPPP 1296 Score = 22.2 bits (45), Expect(2) = 0.59 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 Query: 743 AXXXPPPPPPXXPXXP 790 A PPPPPP P Sbjct: 1292 AAPPPPPPPPPEADDP 1307 >AY119164-1|AAM51024.1| 192|Drosophila melanogaster RH23514p protein. Length = 192 Score = 33.9 bits (74), Expect = 0.26 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PPPP P P P PP P P PP P Sbjct: 97 PPPPPPPPHPQQAPPPSMYPPDPSGYPGGYPPQGAP 132 Score = 25.4 bits (53), Expect(2) = 9.6 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 725 PXXPXXAXXXPPPPPPXXP 781 P P PPPPPP P Sbjct: 88 PSYPYNLYMPPPPPPPPHP 106 Score = 21.8 bits (44), Expect(2) = 9.6 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 755 PPPPPPXXPXXP 790 PPPPPP P Sbjct: 99 PPPPPPHPQQAP 110 >AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p protein. Length = 499 Score = 33.9 bits (74), Expect = 0.26 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 552 PXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P P PP P P PPPP PPP Sbjct: 316 PGPVRRKSVGQCPSPVTAAPPPPPPPPPPPPPPPP 350 Score = 32.7 bits (71), Expect = 0.60 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 6/57 (10%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXP-----XXXXPXXPXXPPP-XXPXPPPXXPPP 673 P PP PP P PPP P P P P P P PPP P Sbjct: 335 PPPPPPPPPPPPPPPPAQTSAIPSPPPFPTKGAVKPLSPSLATPLNMPQPPPATEDP 391 Score = 32.3 bits (70), Expect = 0.80 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXP 629 P PPPP P P P PP P P P Sbjct: 330 PVTAAPPPPPPPPPPPPPPPPAQTSAIPSPPPFP 363 Score = 31.5 bits (68), Expect = 1.4 Identities = 18/62 (29%), Positives = 19/62 (30%), Gaps = 2/62 (3%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPPXXPPP--XAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPX 784 P PPP P PPP PPP + P P A P PP Sbjct: 330 PVTAAPPPPPPPPPPPPPPPPAQTSAIPSPPPFPTKGAVKPLSPSLATPLNMPQPPPATE 389 Query: 785 XP 790 P Sbjct: 390 DP 391 >AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p protein. Length = 295 Score = 33.9 bits (74), Expect = 0.26 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +3 Query: 510 FLXXXPPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 +L PP PPP P P PP PPPP PPP Sbjct: 168 YLPPSPPESKYLPPPTPEVK--YLPPAPVARYLPPKVAPSLPPPPPPPP 214 Score = 32.3 bits (70), Expect = 0.80 Identities = 25/92 (27%), Positives = 27/92 (29%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXX 706 PP P P PPP P P PPP P P P A Sbjct: 146 PPKVAPSLPPPPPPPVVAPKPTYLPPSPPESKYLPPP-TPEVKYLPPAPVA--------- 195 Query: 707 XXXXXXPXXPXXAXXXPPPPPPXXPXXPFFFP 802 P + PPPPPP P + P Sbjct: 196 ---RYLPPKVAPSLPPPPPPPPVAPKKLYLPP 224 Score = 31.9 bits (69), Expect = 1.1 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 9/53 (16%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXP--PXXXXXXP-------PXXPXPXPPPPXPPP 656 PP PPPP P P P P P P P PPP PPP Sbjct: 108 PPKVSLPPPPPPPPKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPPP 160 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 5/52 (9%) Frame = +2 Query: 632 PPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXP-----XXPXXAXXXPPPPPP 772 PP PPP PPP A P A PPPPPP Sbjct: 108 PPKVSLPPPPPPPPKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPP 159 Score = 28.7 bits (61), Expect = 9.8 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = +1 Query: 529 PXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPPXXPPP 672 P PP PP P P P P PP PPP Sbjct: 166 PTYLPPSPPESKYLPPPTPEVKYLPPAPVARYLPPKVAPSLPPPPPPP 213 >AM412919-1|CAL85542.1| 181|Drosophila melanogaster CG16743 protein protein. Length = 181 Score = 33.9 bits (74), Expect = 0.26 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PPPP P P P PP P P PP P Sbjct: 97 PPPPPPPPHPQQAPPPSMYPPGPSGYPGGYPPQGAP 132 >AM412918-1|CAL85541.1| 178|Drosophila melanogaster CG16743 protein protein. Length = 178 Score = 33.9 bits (74), Expect = 0.26 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PPPP P P P PP P P PP P Sbjct: 94 PPPPPPPPHPQQAPPPSMYPPGPSGYPGGYPPQGAP 129 >AM412917-1|CAL85540.1| 181|Drosophila melanogaster CG16743 protein protein. Length = 181 Score = 33.9 bits (74), Expect = 0.26 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PPPP P P P PP P P PP P Sbjct: 97 PPPPPPPPHPQQAPPPSMYPPGPSGYPGGYPPQGAP 132 >AE014298-1311|AAF46472.2| 1837|Drosophila melanogaster CG12124-PA protein. Length = 1837 Score = 33.9 bits (74), Expect = 0.26 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P PP P P PP PP P PPPP PPP Sbjct: 1331 PTPPKPVAAPV---PPPPLPLTPPAAP---PPPPPPPP 1362 Score = 29.1 bits (62), Expect(2) = 0.59 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 596 PXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P PPP P PP PPP Sbjct: 1331 PTPPKPVAAPVPPPPLPLTPPAAPPP 1356 Score = 22.2 bits (45), Expect(2) = 0.59 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 Query: 743 AXXXPPPPPPXXPXXP 790 A PPPPPP P Sbjct: 1352 AAPPPPPPPPPEADDP 1367 >AE014298-1107|AAF46312.3| 2038|Drosophila melanogaster CG2252-PB, isoform B protein. Length = 2038 Score = 33.9 bits (74), Expect = 0.26 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GG GGGG G GG GG G G GGGG Sbjct: 1819 GGSGGGGGSGPASAGG-PNSGGGGTANSNSGGGGGGGG 1855 Score = 28.7 bits (61), Expect = 9.8 Identities = 24/90 (26%), Positives = 24/90 (26%) Frame = -2 Query: 789 GXXGXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXG 610 G G GGGG G A G GGG GGG G G Sbjct: 1817 GSGGSGGGGGSGPASAGGPNSGGGGTANSNS--------GGGGGGGGPALLNAGSNSNSG 1868 Query: 609 XXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G GG G GG G Sbjct: 1869 VGSGGAASSNSNSSVGGIVGSGGPGSNSQG 1898 >AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA protein. Length = 295 Score = 33.9 bits (74), Expect = 0.26 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +3 Query: 510 FLXXXPPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 +L PP PPP P P PP PPPP PPP Sbjct: 168 YLPPSPPESKYLPPPTPEVK--YLPPAPVARYLPPKVAPSLPPPPPPPP 214 Score = 32.3 bits (70), Expect = 0.80 Identities = 25/92 (27%), Positives = 27/92 (29%) Frame = +2 Query: 527 PPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXX 706 PP P P PPP P P PPP P P P A Sbjct: 146 PPKVAPSLPPPPPPPVVAPKPTYLPPSPPESKYLPPP-TPEVKYLPPAPVA--------- 195 Query: 707 XXXXXXPXXPXXAXXXPPPPPPXXPXXPFFFP 802 P + PPPPPP P + P Sbjct: 196 ---RYLPPKVAPSLPPPPPPPPVAPKKLYLPP 224 Score = 31.9 bits (69), Expect = 1.1 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 9/53 (16%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXP--PXXXXXXP-------PXXPXPXPPPPXPPP 656 PP PPPP P P P P P P P PPP PPP Sbjct: 108 PPKVSLPPPPPPPPKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPPP 160 Score = 29.9 bits (64), Expect = 4.3 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 5/52 (9%) Frame = +2 Query: 632 PPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXP-----XXPXXAXXXPPPPPP 772 PP PPP PPP A P A PPPPPP Sbjct: 108 PPKVSLPPPPPPPPKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPP 159 Score = 28.7 bits (61), Expect = 9.8 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = +1 Query: 529 PXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXPXPXXPXPPPXXPPP 672 P PP PP P P P P PP PPP Sbjct: 166 PTYLPPSPPESKYLPPPTPEVKYLPPAPVARYLPPKVAPSLPPPPPPP 213 >AE014134-1996|AAF53039.1| 192|Drosophila melanogaster CG16743-PA protein. Length = 192 Score = 33.9 bits (74), Expect = 0.26 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXP 650 PPPP P P P PP P P PP P Sbjct: 97 PPPPPPPPHPQQAPPPSMYPPDPSGYPGGYPPQGAP 132 Score = 25.4 bits (53), Expect(2) = 9.6 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 725 PXXPXXAXXXPPPPPPXXP 781 P P PPPPPP P Sbjct: 88 PSYPYNLYMPPPPPPPPHP 106 Score = 21.8 bits (44), Expect(2) = 9.6 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 755 PPPPPPXXPXXP 790 PPPPPP P Sbjct: 99 PPPPPPHPQQAP 110 >AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-PA protein. Length = 499 Score = 33.9 bits (74), Expect = 0.26 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 552 PXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P P PP P P PPPP PPP Sbjct: 316 PGPVRRKSVGQCPSPVTAAPPPPPPPPPPPPPPPP 350 Score = 32.7 bits (71), Expect = 0.60 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 6/57 (10%) Frame = +2 Query: 521 PXPPXXXPPXPXPPPXXXXXXXPXXP-----XXXXPXXPXXPPP-XXPXPPPXXPPP 673 P PP PP P PPP P P P P P P PPP P Sbjct: 335 PPPPPPPPPPPPPPPPAQTSAIPSPPPFPTKGAVKPLSPSLATPLNMPQPPPATEDP 391 Score = 32.3 bits (70), Expect = 0.80 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXP 629 P PPPP P P P PP P P P Sbjct: 330 PVTAAPPPPPPPPPPPPPPPPAQTSAIPSPPPFP 363 Score = 31.5 bits (68), Expect = 1.4 Identities = 18/62 (29%), Positives = 19/62 (30%), Gaps = 2/62 (3%) Frame = +2 Query: 611 PXXPXXPPPXXPXPPPXXPPP--XAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXPX 784 P PPP P PPP PPP + P P A P PP Sbjct: 330 PVTAAPPPPPPPPPPPPPPPPAQTSAIPSPPPFPTKGAVKPLSPSLATPLNMPQPPPATE 389 Query: 785 XP 790 P Sbjct: 390 DP 391 >AE013599-399|AAM68891.2| 409|Drosophila melanogaster CG11112-PB, isoform B protein. Length = 409 Score = 33.9 bits (74), Expect = 0.26 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 564 PXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P P P PP P P PPPP PP Sbjct: 213 PRPPPFYKPSRPNRRPPPPPPPPPPPPPPP 242 Score = 33.9 bits (74), Expect = 0.26 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 587 PXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P P PP P PPP PPP Sbjct: 213 PRPPPFYKPSRPNRRPPPPPPPPPPPPPP 241 Score = 32.7 bits (71), Expect = 0.60 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 585 PPXXXXXXPPXXPXPXPPPPXPPP 656 PP P P P PPPP PPP Sbjct: 216 PPFYKPSRPNRRPPPPPPPPPPPP 239 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 551 PXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPP 670 P PPP P P P P PPP P PPP P Sbjct: 213 PRPPPFYK----PSRPNRRPPPPPPPPPP--PPPPPTLSP 246 Score = 29.9 bits (64), Expect = 4.3 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPP P PP PP P P PPPP P Sbjct: 215 PPPFYKPSRPNRRPPP-----PPPPPPPPPPPPTLSP 246 Score = 28.7 bits (61), Expect = 9.8 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 725 PXXPXXAXXXPPPPPPXXPXXPFFFP 802 P P PPPPPP P P P Sbjct: 221 PSRPNRRPPPPPPPPPPPPPPPTLSP 246 >X97197-1|CAA65831.1| 366|Drosophila melanogaster spliceosomal protein protein. Length = 366 Score = 33.5 bits (73), Expect = 0.35 Identities = 21/78 (26%), Positives = 21/78 (26%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXXXXXXXXP 722 PPPP P P P P PP P PP PP Sbjct: 279 PPPPVPQPAPFPATIP-----PPPLPPMTGGQPPLPPAMGIPPPPRMMQPNAWAPPGMPA 333 Query: 723 XQXXPXXPXXXPPPXPXP 776 P PPP P P Sbjct: 334 PPPRPPPTNWRPPPVPFP 351 Score = 29.5 bits (63), Expect = 5.6 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 530 PXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P PPP P P P PPP PPP PP Sbjct: 306 PPLPPAMGIPPPPRMMQPNAWAP-PGMPAPPPRPPPTNWRPPPVPFPP 352 Score = 28.7 bits (61), Expect = 9.8 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPP 644 PP P P P P PP P PPPP Sbjct: 279 PPPPVPQPAPFPATIPPPPLPPMTGGQPPLPPAMGIPPPP 318 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 4/51 (7%) Frame = +1 Query: 529 PXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXP----XPXXPXPPPXXPP 669 P PP P P P PP P P P PPP PP Sbjct: 290 PATIPPPPLPPMTGGQPPLPPAMGIPPPPRMMQPNAWAPPGMPAPPPRPPP 340 >BT023489-1|AAY84889.1| 347|Drosophila melanogaster RE50839p protein. Length = 347 Score = 33.5 bits (73), Expect = 0.35 Identities = 21/78 (26%), Positives = 21/78 (26%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXXXXXXXXP 722 PPPP P P P P PP P PP PP Sbjct: 260 PPPPVPQPAPFPATIP-----PPPLPPMTGGQPPLPPAMGIPPPPRMMQPNAWAPPGMPA 314 Query: 723 XQXXPXXPXXXPPPXPXP 776 P PPP P P Sbjct: 315 PPPRPPPTNWRPPPVPFP 332 Score = 29.5 bits (63), Expect = 5.6 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 530 PXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P PPP P P P PPP PPP PP Sbjct: 287 PPLPPAMGIPPPPRMMQPNAWAP-PGMPAPPPRPPPTNWRPPPVPFPP 333 Score = 28.7 bits (61), Expect = 9.8 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPP 644 PP P P P P PP P PPPP Sbjct: 260 PPPPVPQPAPFPATIPPPPLPPMTGGQPPLPPAMGIPPPP 299 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 4/51 (7%) Frame = +1 Query: 529 PXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXP----XPXXPXPPPXXPP 669 P PP P P P PP P P P PPP PP Sbjct: 271 PATIPPPPLPPMTGGQPPLPPAMGIPPPPRMMQPNAWAPPGMPAPPPRPPP 321 >BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p protein. Length = 478 Score = 33.5 bits (73), Expect = 0.35 Identities = 25/89 (28%), Positives = 25/89 (28%), Gaps = 5/89 (5%) Frame = +2 Query: 521 PXPPXXXPPXPXPP---PXXXXXXXPXXPXXXXPXXPXXPP--PXXPXPPPXXPPPXAXX 685 P PP PP P P P P P P PP P P PPP Sbjct: 174 PSPPAMAPPLPAKPYPYPDLAAMPFPDRPPAYTPTPDPMPPVGGVMVMPSPTPPPPAG-- 231 Query: 686 XXXXXXXXXXXXXPXXPXXAXXXPPPPPP 772 P P PPPPP Sbjct: 232 ---GVLVMPRPPPPPPPAGGVLVMPPPPP 257 Score = 31.9 bits (69), Expect = 1.1 Identities = 21/84 (25%), Positives = 21/84 (25%) Frame = +2 Query: 530 PXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXX 709 P PP P PP P P P P PP P P Sbjct: 167 PLSPPPPPSPP-----AMAPPLPAKPYPYPDLAAMPFPDRPPAYTPTPDPMPPVGGVMVM 221 Query: 710 XXXXXPXXPXXAXXXPPPPPPXXP 781 P P PPPP P Sbjct: 222 PSPTPPPPAGGVLVMPRPPPPPPP 245 Score = 30.3 bits (65), Expect = 3.2 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P PPPP P P PP P P P P P Sbjct: 149 PGWQLPPPPPPLEEPEKCPLSPPPPPSPPAMAPPLPAKPYPYP 191 >BT001672-1|AAN71427.1| 315|Drosophila melanogaster RE50346p protein. Length = 315 Score = 33.5 bits (73), Expect = 0.35 Identities = 26/92 (28%), Positives = 26/92 (28%), Gaps = 2/92 (2%) Frame = -2 Query: 789 GXXGXXGGGGGGXXX--AXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGX 616 G G GG GG A G A GGG G G GG G Sbjct: 54 GARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFINPWANGGGGDVDGFGNNAGGAGGF 113 Query: 615 XGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G GG G G Sbjct: 114 AGNSFGGGAGGPFGGGSFGNNGFGGGPSGFGG 145 >AY129464-1|AAM76206.1| 981|Drosophila melanogaster SD10723p protein. Length = 981 Score = 33.5 bits (73), Expect = 0.35 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 G G G GG G G GG GG G GGGG Sbjct: 823 GSGSGNGGGGGGGAGGSQVGGNGGGNGVGSVGQSGGGG 860 Score = 30.3 bits (65), Expect = 3.2 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXG--GGXGXG 544 G G G G G GGG G G G G G GG G G Sbjct: 818 GSGAVGSGSGNGGGGGGGAGGSQVGGNGGGNGVGSVGQSGGGGQG 862 >AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p protein. Length = 1211 Score = 33.5 bits (73), Expect = 0.35 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 564 PXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P P P PP P P PPPP PP Sbjct: 461 PEPEPLSPVKKPAAAPPPPPPPPPPPPPPP 490 Score = 30.3 bits (65), Expect = 3.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P PP P P PPPP PPP Sbjct: 447 PAPLSSTPVKCDVPPEPEPLSPVKKPAAAPPPPPPPP 483 Score = 30.3 bits (65), Expect = 3.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 549 PPXPXPXPXXXXPPXXXXXXPPXXPXPXPPP 641 PP P P P PP P P PPP Sbjct: 460 PPEPEPLSPVKKPAAAPPPPPPPPPPPPPPP 490 Score = 30.3 bits (65), Expect = 3.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 629 PPPXXPXPPPXXPPP 673 PPP P PPP PPP Sbjct: 476 PPPPPPPPPPPPPPP 490 Score = 29.9 bits (64), Expect = 4.3 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +2 Query: 587 PXXPXXXXPXX-PXXPPPXXPXPPPXXPPP 673 P P P P PP P PPP PPP Sbjct: 460 PPEPEPLSPVKKPAAAPPPPPPPPPPPPPP 489 Score = 29.5 bits (63), Expect(2) = 0.47 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 557 PPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P P P P P PPP PPP Sbjct: 447 PAPLSSTPVKCDVPPEPEPLSPVKKPAAAPPPPPPPPPP 485 Score = 28.7 bits (61), Expect = 9.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 503 KKIFGXPXPPXXXPPXPXPPP 565 KK P PP PP P PPP Sbjct: 470 KKPAAAPPPPPPPPPPPPPPP 490 Score = 22.2 bits (45), Expect(2) = 0.47 Identities = 8/21 (38%), Positives = 9/21 (42%) Frame = +2 Query: 734 PXXAXXXPPPPPPXXPXXPFF 796 P PPPPPP P + Sbjct: 478 PPPPPPPPPPPPPGWWHAPIY 498 >AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p protein. Length = 1294 Score = 33.5 bits (73), Expect = 0.35 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 564 PXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P P P PP P P PPPP PP Sbjct: 643 PEPEPLSPVKKPAAAPPPPPPPPPPPPPPP 672 Score = 30.3 bits (65), Expect = 3.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P PP P P PPPP PPP Sbjct: 629 PAPLSSTPVKCDVPPEPEPLSPVKKPAAAPPPPPPPP 665 Score = 30.3 bits (65), Expect = 3.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 549 PPXPXPXPXXXXPPXXXXXXPPXXPXPXPPP 641 PP P P P PP P P PPP Sbjct: 642 PPEPEPLSPVKKPAAAPPPPPPPPPPPPPPP 672 Score = 30.3 bits (65), Expect = 3.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 629 PPPXXPXPPPXXPPP 673 PPP P PPP PPP Sbjct: 658 PPPPPPPPPPPPPPP 672 Score = 29.9 bits (64), Expect = 4.3 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +2 Query: 587 PXXPXXXXPXX-PXXPPPXXPXPPPXXPPP 673 P P P P PP P PPP PPP Sbjct: 642 PPEPEPLSPVKKPAAAPPPPPPPPPPPPPP 671 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 557 PPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P P P P P PPP PPP Sbjct: 629 PAPLSSTPVKCDVPPEPEPLSPVKKPAAAPPPPPPPPPP 667 Score = 28.7 bits (61), Expect = 9.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 503 KKIFGXPXPPXXXPPXPXPPP 565 KK P PP PP P PPP Sbjct: 652 KKPAAAPPPPPPPPPPPPPPP 672 >AY051892-1|AAK93316.1| 349|Drosophila melanogaster LD38046p protein. Length = 349 Score = 33.5 bits (73), Expect = 0.35 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G G G GGGG Sbjct: 24 GGGGGGGGGGSKTTYNVIATPSSGGGGGGGGGGGGGGG 61 Score = 33.5 bits (73), Expect = 0.35 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G G GG G G G G Sbjct: 47 GGGGGGGGGGGGGGGHGYSYAQGGGGGHGYAQGHGYG 83 Score = 33.5 bits (73), Expect = 0.35 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G G GG G G G G Sbjct: 49 GGGGGGGGGGGGGHGYSYAQGGGGGHGYAQGHGYGHG 85 Score = 30.3 bits (65), Expect = 3.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 643 GGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 GGGG G G G G G G GGGG G Sbjct: 23 GGGGGGGGGGGSKTTYNVIATPSSGGGGGGGGGGGGGGG 61 Score = 29.5 bits (63), Expect = 5.6 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G G G G GG Sbjct: 51 GGGGGGGGGGGHGYSYAQGGGGGHGYAQGHGYGHGHGG 88 Score = 28.7 bits (61), Expect = 9.8 Identities = 23/69 (33%), Positives = 24/69 (34%), Gaps = 14/69 (20%) Frame = -2 Query: 672 GGGXXGGGXGXX-----------GGGXXGXXGXXXXGXXGXXXXXXXGGGXGXG---GXX 535 GGG GGG G GGG G G G G GGG G G Sbjct: 24 GGGGGGGGGGSKTTYNVIATPSSGGGGGGGGGGGGGGGHGYSYAQGGGGGHGYAQGHGYG 83 Query: 534 XGGXGXPKI 508 G G P+I Sbjct: 84 HGHGGSPQI 92 >AE014298-2744|AAF48863.1| 1895|Drosophila melanogaster CG15040-PA protein. Length = 1895 Score = 33.5 bits (73), Expect = 0.35 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPP 644 P PPP P P P PP PP P P PPPP Sbjct: 588 PTPSPVPPPAPVPAP---APPAPPAHGPP--PTPGPPPP 621 Score = 30.3 bits (65), Expect = 3.2 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPP-PXPPP 656 P P P P P P PP P PPP P PPP Sbjct: 588 PTPSPVPPPAPVPAPA-----PPAPPAHGPPPTPGPPP 620 Score = 29.9 bits (64), Expect = 4.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP 637 G P P PP P P P P P P P PPP Sbjct: 586 GVPTPSPVPPPAPVPAP-----APPAPPAHGPPPTPGPPPP 621 >AE014298-2546|AAF48714.1| 250|Drosophila melanogaster CG10597-PA protein. Length = 250 Score = 33.5 bits (73), Expect = 0.35 Identities = 24/85 (28%), Positives = 25/85 (29%), Gaps = 1/85 (1%) Frame = -2 Query: 771 GGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXX-GXXXXG 595 GG GG G G + GGG G G GG G G G Sbjct: 117 GGSAGGAGAYGGGAASYGGGAGAAYGGGAGASYGGGAASYGGGRGSGGWQGAGAGAGRGG 176 Query: 594 XXGXXXXXXXGGGXGXGGXXXGGXG 520 G G G G G GG G Sbjct: 177 AGGAGGWQGAGAGRGGAGGWQGGAG 201 Score = 32.3 bits (70), Expect = 0.80 Identities = 23/85 (27%), Positives = 23/85 (27%) Frame = -2 Query: 780 GXXGGGGGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXGGGXXGXXGXXX 601 G GGGGGG G GG GG G GGG G Sbjct: 81 GGRGGGGGGFGGRP--AIGAGLVSHVSQSQGNTKVHIGGGSAGGAGAYGGGAASYGGGAG 138 Query: 600 XGXXGXXXXXXXGGGXGXGGXXXGG 526 G GG GG G Sbjct: 139 AAYGGGAGASYGGGAASYGGGRGSG 163 Score = 32.3 bits (70), Expect = 0.80 Identities = 25/90 (27%), Positives = 26/90 (28%), Gaps = 4/90 (4%) Frame = -2 Query: 801 GKKKGXXGXXGGG----GGGXXXAXXGCXGXXXXXXXXXXXXXGXAXGGGXXGGGXGXXG 634 G G G GGG GGG A G G + G G G G G Sbjct: 117 GGSAGGAGAYGGGAASYGGGAGAAYGGGAGASYGGGAASYGGGRGSGGWQGAGAGAGRGG 176 Query: 633 GGXXGXXGXXXXGXXGXXXXXXXGGGXGXG 544 G G G G GG G G Sbjct: 177 AGGAGGWQGAGAGRGGAGGWQGGAGGAGAG 206 Score = 31.1 bits (67), Expect = 1.8 Identities = 20/83 (24%), Positives = 21/83 (25%) Frame = -1 Query: 775 GXGXGGGXXXGXXGXXWXGXXXXXXXXXXXXXXXXXXGXXGGGXGGGGXGXGXXGGXXXX 596 G GG G + G GGG G GG G Sbjct: 117 GGSAGGAGAYGGGAASYGGGAGAAYGGGAGASYGGGAASYGGGRGSGGWQGAGAGAGRGG 176 Query: 595 XXGGXXXXGXGXGXGGGGXXXXG 527 G G G G GG G G Sbjct: 177 AGGAGGWQGAGAGRGGAGGWQGG 199 Score = 29.1 bits (62), Expect = 7.4 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXGG 524 GGG GG G G G G GGG GG Sbjct: 116 GGGSAGGAGAYGGGAASYGGGAGAAYGGGAGASYGGGAASYGGG 159 >AE014298-1457|AAN09261.3| 2309|Drosophila melanogaster CG17255-PB, isoform B protein. Length = 2309 Score = 33.5 bits (73), Expect = 0.35 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 G G G GG G G GG GG G GGGG Sbjct: 2151 GSGSGNGGGGGGGAGGSQVGGNGGGNGVGSVGQSGGGG 2188 Score = 30.3 bits (65), Expect = 3.2 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXG--GGXGXG 544 G G G G G GGG G G G G G GG G G Sbjct: 2146 GSGAVGSGSGNGGGGGGGAGGSQVGGNGGGNGVGSVGQSGGGGQG 2190 Score = 29.1 bits (62), Expect = 7.4 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG--GXXXXGGXXXKNFFXXXFQ 488 GGG GGGG G G G G GGG GG + F FQ Sbjct: 759 GGGQGGGGGLNRRPRGSISSLGSGVTPTGGAGGGGGGVSSSSSAGGDYGQKNFLTHFQ 816 >AE014298-1456|AAF46591.4| 2309|Drosophila melanogaster CG17255-PA, isoform A protein. Length = 2309 Score = 33.5 bits (73), Expect = 0.35 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 G G G GG G G GG GG G GGGG Sbjct: 2151 GSGSGNGGGGGGGAGGSQVGGNGGGNGVGSVGQSGGGG 2188 Score = 30.3 bits (65), Expect = 3.2 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXG--GGXGXG 544 G G G G G GGG G G G G G GG G G Sbjct: 2146 GSGAVGSGSGNGGGGGGGAGGSQVGGNGGGNGVGSVGQSGGGGQG 2190 Score = 29.1 bits (62), Expect = 7.4 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG--GXXXXGGXXXKNFFXXXFQ 488 GGG GGGG G G G G GGG GG + F FQ Sbjct: 759 GGGQGGGGGLNRRPRGSISSLGSGVTPTGGAGGGGGGVSSSSSAGGDYGQKNFLTHFQ 816 >AE014298-1424|AAF46566.2| 349|Drosophila melanogaster CG2961-PA protein. Length = 349 Score = 33.5 bits (73), Expect = 0.35 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G G G GGGG Sbjct: 24 GGGGGGGGGGSKTTYNVIATPSSGGGGGGGGGGGGGGG 61 Score = 33.5 bits (73), Expect = 0.35 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G G GG G G G G Sbjct: 47 GGGGGGGGGGGGGGGHGYSYAQGGGGGHGYAQGHGYG 83 Score = 33.5 bits (73), Expect = 0.35 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGG 545 GGG GGGG G G G GG G G G G Sbjct: 49 GGGGGGGGGGGGGHGYSYAQGGGGGHGYAQGHGYGHG 85 Score = 30.3 bits (65), Expect = 3.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 643 GGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGGXXXXG 527 GGGG G G G G G G GGGG G Sbjct: 23 GGGGGGGGGGGSKTTYNVIATPSSGGGGGGGGGGGGGGG 61 Score = 29.5 bits (63), Expect = 5.6 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG GGGG G G G G G G GG Sbjct: 51 GGGGGGGGGGGHGYSYAQGGGGGHGYAQGHGYGHGHGG 88 Score = 28.7 bits (61), Expect = 9.8 Identities = 23/69 (33%), Positives = 24/69 (34%), Gaps = 14/69 (20%) Frame = -2 Query: 672 GGGXXGGGXGXX-----------GGGXXGXXGXXXXGXXGXXXXXXXGGGXGXG---GXX 535 GGG GGG G GGG G G G G GGG G G Sbjct: 24 GGGGGGGGGGSKTTYNVIATPSSGGGGGGGGGGGGGGGHGYSYAQGGGGGHGYAQGHGYG 83 Query: 534 XGGXGXPKI 508 G G P+I Sbjct: 84 HGHGGSPQI 92 >AE014298-857|AAF46136.1| 347|Drosophila melanogaster CG3780-PA protein. Length = 347 Score = 33.5 bits (73), Expect = 0.35 Identities = 21/78 (26%), Positives = 21/78 (26%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPPXXXXXXXXXXXXXXXXXXXXXP 722 PPPP P P P P PP P PP PP Sbjct: 260 PPPPVPQPAPFPATIP-----PPPLPPMTGGQPPLPPAMGIPPPPRMMQPNAWAPPGMPA 314 Query: 723 XQXXPXXPXXXPPPXPXP 776 P PPP P P Sbjct: 315 PPPRPPPTNWRPPPVPFP 332 Score = 29.5 bits (63), Expect = 5.6 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 530 PXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P PPP P P P PPP PPP PP Sbjct: 287 PPLPPAMGIPPPPRMMQPNAWAP-PGMPAPPPRPPPTNWRPPPVPFPP 333 Score = 28.7 bits (61), Expect = 9.8 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPP 644 PP P P P P PP P PPPP Sbjct: 260 PPPPVPQPAPFPATIPPPPLPPMTGGQPPLPPAMGIPPPP 299 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 4/51 (7%) Frame = +1 Query: 529 PXXXPPXPPXPXXXPXXXXPXXXXXXXPPXXXXP----XPXXPXPPPXXPP 669 P PP P P P PP P P P PPP PP Sbjct: 271 PATIPPPPLPPMTGGQPPLPPAMGIPPPPRMMQPNAWAPPGMPAPPPRPPP 321 >AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-PB, isoform B protein. Length = 1294 Score = 33.5 bits (73), Expect = 0.35 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 564 PXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P P P PP P P PPPP PP Sbjct: 643 PEPEPLSPVKKPAAAPPPPPPPPPPPPPPP 672 Score = 30.3 bits (65), Expect = 3.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P PP P P PPPP PPP Sbjct: 629 PAPLSSTPVKCDVPPEPEPLSPVKKPAAAPPPPPPPP 665 Score = 30.3 bits (65), Expect = 3.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 549 PPXPXPXPXXXXPPXXXXXXPPXXPXPXPPP 641 PP P P P PP P P PPP Sbjct: 642 PPEPEPLSPVKKPAAAPPPPPPPPPPPPPPP 672 Score = 30.3 bits (65), Expect = 3.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 629 PPPXXPXPPPXXPPP 673 PPP P PPP PPP Sbjct: 658 PPPPPPPPPPPPPPP 672 Score = 29.9 bits (64), Expect = 4.3 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +2 Query: 587 PXXPXXXXPXX-PXXPPPXXPXPPPXXPPP 673 P P P P PP P PPP PPP Sbjct: 642 PPEPEPLSPVKKPAAAPPPPPPPPPPPPPP 671 Score = 29.5 bits (63), Expect(2) = 0.46 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 557 PPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P P P P P PPP PPP Sbjct: 629 PAPLSSTPVKCDVPPEPEPLSPVKKPAAAPPPPPPPPPP 667 Score = 28.7 bits (61), Expect = 9.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 503 KKIFGXPXPPXXXPPXPXPPP 565 KK P PP PP P PPP Sbjct: 652 KKPAAAPPPPPPPPPPPPPPP 672 Score = 22.2 bits (45), Expect(2) = 0.46 Identities = 8/21 (38%), Positives = 9/21 (42%) Frame = +2 Query: 734 PXXAXXXPPPPPPXXPXXPFF 796 P PPPPPP P + Sbjct: 660 PPPPPPPPPPPPPGWWHAPIY 680 >AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-PA, isoform A protein. Length = 1393 Score = 33.5 bits (73), Expect = 0.35 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 564 PXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P P P PP P P PPPP PP Sbjct: 643 PEPEPLSPVKKPAAAPPPPPPPPPPPPPPP 672 Score = 30.3 bits (65), Expect = 3.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P P PP P P PPPP PPP Sbjct: 629 PAPLSSTPVKCDVPPEPEPLSPVKKPAAAPPPPPPPP 665 Score = 30.3 bits (65), Expect = 3.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 549 PPXPXPXPXXXXPPXXXXXXPPXXPXPXPPP 641 PP P P P PP P P PPP Sbjct: 642 PPEPEPLSPVKKPAAAPPPPPPPPPPPPPPP 672 Score = 30.3 bits (65), Expect = 3.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 629 PPPXXPXPPPXXPPP 673 PPP P PPP PPP Sbjct: 658 PPPPPPPPPPPPPPP 672 Score = 29.9 bits (64), Expect = 4.3 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +2 Query: 587 PXXPXXXXPXX-PXXPPPXXPXPPPXXPPP 673 P P P P PP P PPP PPP Sbjct: 642 PPEPEPLSPVKKPAAAPPPPPPPPPPPPPP 671 Score = 29.5 bits (63), Expect(2) = 0.46 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 557 PPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 P P P P P P P PPP PPP Sbjct: 629 PAPLSSTPVKCDVPPEPEPLSPVKKPAAAPPPPPPPPPP 667 Score = 28.7 bits (61), Expect = 9.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 503 KKIFGXPXPPXXXPPXPXPPP 565 KK P PP PP P PPP Sbjct: 652 KKPAAAPPPPPPPPPPPPPPP 672 Score = 22.2 bits (45), Expect(2) = 0.46 Identities = 8/21 (38%), Positives = 9/21 (42%) Frame = +2 Query: 734 PXXAXXXPPPPPPXXPXXPFF 796 P PPPPPP P + Sbjct: 660 PPPPPPPPPPPPPGWWHAPIY 680 >AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA, isoform A protein. Length = 478 Score = 33.5 bits (73), Expect = 0.35 Identities = 25/89 (28%), Positives = 25/89 (28%), Gaps = 5/89 (5%) Frame = +2 Query: 521 PXPPXXXPPXPXPP---PXXXXXXXPXXPXXXXPXXPXXPP--PXXPXPPPXXPPPXAXX 685 P PP PP P P P P P P PP P P PPP Sbjct: 174 PSPPAMAPPLPAKPYPYPDLAAMPFPDRPPAYTPTPDPMPPVGGVMVMPSPTPPPPAG-- 231 Query: 686 XXXXXXXXXXXXXPXXPXXAXXXPPPPPP 772 P P PPPPP Sbjct: 232 ---GVLVMPRPPPPPPPAGGVLVMPPPPP 257 Score = 31.9 bits (69), Expect = 1.1 Identities = 21/84 (25%), Positives = 21/84 (25%) Frame = +2 Query: 530 PXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXX 709 P PP P PP P P P P PP P P Sbjct: 167 PLSPPPPPSPP-----AMAPPLPAKPYPYPDLAAMPFPDRPPAYTPTPDPMPPVGGVMVM 221 Query: 710 XXXXXPXXPXXAXXXPPPPPPXXP 781 P P PPPP P Sbjct: 222 PSPTPPPPAGGVLVMPRPPPPPPP 245 Score = 30.3 bits (65), Expect = 3.2 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 528 PXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 P PPPP P P PP P P P P P Sbjct: 149 PGWQLPPPPPPLEEPEKCPLSPPPPPSPPAMAPPLPAKPYPYP 191 >AY069509-1|AAL39654.1| 481|Drosophila melanogaster LD22957p protein. Length = 481 Score = 28.3 bits (60), Expect(2) = 0.38 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 621 PXPXPPPPXPPP 656 P P PPPP PPP Sbjct: 90 PPPPPPPPPPPP 101 Score = 23.8 bits (49), Expect(2) = 0.38 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +3 Query: 528 PXXXXPPPPXPXPXP 572 P PPPP P P P Sbjct: 84 PEQLEPPPPPPPPPP 98 >AF260583-1|AAG13285.1| 481|Drosophila melanogaster cyclin D protein. Length = 481 Score = 28.3 bits (60), Expect(2) = 0.38 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 621 PXPXPPPPXPPP 656 P P PPPP PPP Sbjct: 90 PPPPPPPPPPPP 101 Score = 23.8 bits (49), Expect(2) = 0.38 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +3 Query: 528 PXXXXPPPPXPXPXP 572 P PPPP P P P Sbjct: 84 PEQLEPPPPPPPPPP 98 >AE014298-2283|AAF48537.1| 481|Drosophila melanogaster CG9096-PC, isoform C protein. Length = 481 Score = 28.3 bits (60), Expect(2) = 0.38 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 621 PXPXPPPPXPPP 656 P P PPPP PPP Sbjct: 90 PPPPPPPPPPPP 101 Score = 23.8 bits (49), Expect(2) = 0.38 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +3 Query: 528 PXXXXPPPPXPXPXP 572 P PPPP P P P Sbjct: 84 PEQLEPPPPPPPPPP 98 >AE014298-2282|AAN09375.1| 481|Drosophila melanogaster CG9096-PB, isoform B protein. Length = 481 Score = 28.3 bits (60), Expect(2) = 0.38 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 621 PXPXPPPPXPPP 656 P P PPPP PPP Sbjct: 90 PPPPPPPPPPPP 101 Score = 23.8 bits (49), Expect(2) = 0.38 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +3 Query: 528 PXXXXPPPPXPXPXP 572 P PPPP P P P Sbjct: 84 PEQLEPPPPPPPPPP 98 >AE014298-2281|AAN09374.1| 481|Drosophila melanogaster CG9096-PA, isoform A protein. Length = 481 Score = 28.3 bits (60), Expect(2) = 0.38 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 621 PXPXPPPPXPPP 656 P P PPPP PPP Sbjct: 90 PPPPPPPPPPPP 101 Score = 23.8 bits (49), Expect(2) = 0.38 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +3 Query: 528 PXXXXPPPPXPXPXP 572 P PPPP P P P Sbjct: 84 PEQLEPPPPPPPPPP 98 >U41808-1|AAC47016.1| 452|Drosophila melanogaster Cyclin D protein. Length = 452 Score = 28.3 bits (60), Expect(2) = 0.38 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 621 PXPXPPPPXPPP 656 P P PPPP PPP Sbjct: 61 PPPPPPPPPPPP 72 Score = 23.8 bits (49), Expect(2) = 0.38 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +3 Query: 528 PXXXXPPPPXPXPXP 572 P PPPP P P P Sbjct: 55 PEQLEPPPPPPPPPP 69 >X15586-1|CAA33611.1| 1443|Drosophila melanogaster protein ( D.melanogaster 75B mRNAencoding hypothetical 75B protein. ). Length = 1443 Score = 33.1 bits (72), Expect = 0.46 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 PP P P PPPP PPP Sbjct: 267 PPLAPPPPPPPPPPPP 282 Score = 32.3 bits (70), Expect = 0.80 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPP 673 P PPP P PPP PPP Sbjct: 268 PLAPPPPPPPPPPPPPPP 285 Score = 30.3 bits (65), Expect = 3.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 609 PPXXPXPXPPPPXPP 653 PP P P PPPP PP Sbjct: 271 PPPPPPPPPPPPPPP 285 Score = 30.3 bits (65), Expect = 3.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 612 PXXPXPXPPPPXPPP 656 P P P PPPP PPP Sbjct: 271 PPPPPPPPPPPPPPP 285 Score = 29.1 bits (62), Expect = 7.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPP 673 P PP P PPP PPP Sbjct: 267 PPLAPPPPPPPPPPPPPP 284 Score = 29.1 bits (62), Expect = 7.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 P P P PPPP PPP Sbjct: 268 PLAPPPPPPPPPPPPP 283 >BT011093-1|AAR82759.1| 236|Drosophila melanogaster RE40656p protein. Length = 236 Score = 33.1 bits (72), Expect = 0.46 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 A G G GG G GGG G G G G G G GG G G P Sbjct: 172 AGGAGYVGGFGGALGGGLGGY-GSSFGGGAALPASYGYGAGYGAGGGFGLGFGAP 225 >AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p protein. Length = 993 Score = 33.1 bits (72), Expect = 0.46 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 4/48 (8%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXP--XPPPP--XPPP 656 P PPPP P P P PP P P PPP PPP Sbjct: 123 PAQQYGPPPPKPAPQYGPPPQPAPQYGPPPPKPAPQYGPPPTQYGPPP 170 Score = 33.1 bits (72), Expect = 0.46 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPP---XXPPP 673 +G P PP P PPP P P P P PPP PPP Sbjct: 444 YGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPP 500 Score = 32.7 bits (71), Expect = 0.60 Identities = 26/102 (25%), Positives = 26/102 (25%), Gaps = 4/102 (3%) Frame = +2 Query: 488 LEXXXKKIFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXP----P 655 L K FG P P PP P P P P P P P P Sbjct: 99 LHEQIKTHFGVPKP-FYGPPHIQHKPAQQYGPPPPKPAPQYGPPPQPAPQYGPPPPKPAP 157 Query: 656 PXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 PPP P PPPPP P Sbjct: 158 QYGPPPTQYGPPPPLKIQHRPAPQYGPPKLQYGPPPPPQLLP 199 Score = 32.7 bits (71), Expect = 0.60 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PP PPP P PP PP P PP PP Sbjct: 450 PPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPP 492 Score = 32.3 bits (70), Expect = 0.80 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P PPPP P PP PP P PP PP Sbjct: 440 PSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPP 482 Score = 31.9 bits (69), Expect = 1.1 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 G P PP P PPP P P P PPP PP PPP Sbjct: 434 GPPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPP--PPPSGNYGPP--PPP 482 Score = 31.5 bits (68), Expect = 1.4 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPP 769 P PPP PP PPP + P P PPPPP Sbjct: 435 PPPPPPSGNYGPP--PPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPP 482 Score = 31.1 bits (67), Expect = 1.8 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +3 Query: 525 PPXXXXPP--PPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP P PP P P P PP PP P P PP Sbjct: 140 PPPQPAPQYGPPPPKPAPQYGPPPTQYGPPPPLKIQHRPAPQYGPP 185 Score = 31.1 bits (67), Expect = 1.8 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P PP PP P P PPP Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPP 472 Score = 30.7 bits (66), Expect = 2.4 Identities = 16/58 (27%), Positives = 16/58 (27%) Frame = +2 Query: 596 PXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPP 769 P P PPP P PPP P P PPPPP Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPP 492 Score = 29.9 bits (64), Expect = 4.3 Identities = 19/71 (26%), Positives = 20/71 (28%) Frame = +2 Query: 551 PXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPX 730 P PPP P P P PPP P PPP + P Sbjct: 435 PPPPPPSGNYGPPPPP----PSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPP 490 Query: 731 XPXXAXXXPPP 763 P PPP Sbjct: 491 PPSGNYGPPPP 501 Score = 29.9 bits (64), Expect = 4.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPP 644 PP P P P P PP P P PPPP Sbjct: 642 PPGPPPPPEPQYLPPPPPLANVRPLGP---PPPP 672 Score = 29.5 bits (63), Expect = 5.6 Identities = 17/60 (28%), Positives = 18/60 (30%) Frame = +2 Query: 587 PXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPP 766 P P P PPP PP PPP + P P PPPP Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPP--PPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPP 492 Score = 28.7 bits (61), Expect = 9.8 Identities = 23/78 (29%), Positives = 25/78 (32%) Frame = +2 Query: 446 PPPXXFRGNXXFXKLEXXXKKIFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPX 625 PPP GN + +G P PP P PPP P P Sbjct: 435 PPPPPPSGN--YGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGP---- 488 Query: 626 XPPPXXPXPPPXXPPPXA 679 PPP PP PP A Sbjct: 489 PPPPSGNYGPP--PPQFA 504 >AE014298-2723|AAX52506.1| 991|Drosophila melanogaster CG32547-PA protein. Length = 991 Score = 33.1 bits (72), Expect = 0.46 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXG 551 GG GGGG G G GG GG G G G Sbjct: 23 GGAGGGGGGGGGGGGGGGLGGYGGGGSGGDAGGSG 57 Score = 33.1 bits (72), Expect = 0.46 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 652 GGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GG GGGG G G GG GG G G GG G Sbjct: 23 GGAGGGGGGGG--GGGGGGGLGGYGGGGSGGDAGGSG 57 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXG 586 GGG GGG G GGG G G G G Sbjct: 26 GGGGGGGGGGGGGGGLGGYGGGGSGGDAG 54 Score = 30.7 bits (66), Expect = 2.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGGGXXGXXGXXXXGXXG 586 A GG GGG G GGG G G G G Sbjct: 20 ASSGGAGGGGGGGGGGGGGGGLGGYGGGGSG 50 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 672 GGGXXGGGXGXXGGGXXGXXGXXXXGXXG 586 GG GGG G GGG G G G G Sbjct: 23 GGAGGGGGGGGGGGGGGGLGGYGGGGSGG 51 >AE014298-2533|AAF48705.1| 209|Drosophila melanogaster CG5070-PA protein. Length = 209 Score = 33.1 bits (72), Expect = 0.46 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -2 Query: 678 AXGGGXXGGGXGXXGGGXXGXXGXXXXGXXGXXXXXXXGGGXGXGGXXXGGXGXP 514 A G G GG G GGG G G G G G G GG G G P Sbjct: 145 AGGAGYVGGFGGALGGGLGGY-GSSFGGGAALPASYGYGAGYGAGGGFGLGFGAP 198 >AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA protein. Length = 993 Score = 33.1 bits (72), Expect = 0.46 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 4/48 (8%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXP--XPPPP--XPPP 656 P PPPP P P P PP P P PPP PPP Sbjct: 123 PAQQYGPPPPKPAPQYGPPPQPAPQYGPPPPKPAPQYGPPPTQYGPPP 170 Score = 33.1 bits (72), Expect = 0.46 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = +2 Query: 512 FGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPP---XXPPP 673 +G P PP P PPP P P P P PPP PPP Sbjct: 444 YGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPP 500 Score = 32.7 bits (71), Expect = 0.60 Identities = 26/102 (25%), Positives = 26/102 (25%), Gaps = 4/102 (3%) Frame = +2 Query: 488 LEXXXKKIFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXP----P 655 L K FG P P PP P P P P P P P P Sbjct: 99 LHEQIKTHFGVPKP-FYGPPHIQHKPAQQYGPPPPKPAPQYGPPPQPAPQYGPPPPKPAP 157 Query: 656 PXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPPPXXP 781 PPP P PPPPP P Sbjct: 158 QYGPPPTQYGPPPPLKIQHRPAPQYGPPKLQYGPPPPPQLLP 199 Score = 32.7 bits (71), Expect = 0.60 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 PP PPP P PP PP P PP PP Sbjct: 450 PPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPP 492 Score = 32.3 bits (70), Expect = 0.80 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 525 PPXXXXPPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPP 653 P PPPP P PP PP P PP PP Sbjct: 440 PSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPP 482 Score = 31.9 bits (69), Expect = 1.1 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +2 Query: 515 GXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPP 673 G P PP P PPP P P P PPP PP PPP Sbjct: 434 GPPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPP--PPPSGNYGPP--PPP 482 Score = 31.5 bits (68), Expect = 1.4 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPP 769 P PPP PP PPP + P P PPPPP Sbjct: 435 PPPPPPSGNYGPP--PPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPP 482 Score = 31.1 bits (67), Expect = 1.8 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +3 Query: 525 PPXXXXPP--PPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PP P PP P P P PP PP P P PP Sbjct: 140 PPPQPAPQYGPPPPKPAPQYGPPPTQYGPPPPLKIQHRPAPQYGPP 185 Score = 31.1 bits (67), Expect = 1.8 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPPP P PP PP P P PPP Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPP 472 Score = 30.7 bits (66), Expect = 2.4 Identities = 16/58 (27%), Positives = 16/58 (27%) Frame = +2 Query: 596 PXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPPP 769 P P PPP P PPP P P PPPPP Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPP 492 Score = 29.9 bits (64), Expect = 4.3 Identities = 19/71 (26%), Positives = 20/71 (28%) Frame = +2 Query: 551 PXPPPXXXXXXXPXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPX 730 P PPP P P P PPP P PPP + P Sbjct: 435 PPPPPPSGNYGPPPPP----PSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPP 490 Query: 731 XPXXAXXXPPP 763 P PPP Sbjct: 491 PPSGNYGPPPP 501 Score = 29.9 bits (64), Expect = 4.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 543 PPPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPP 644 PP P P P P PP P P PPPP Sbjct: 642 PPGPPPPPEPQYLPPPPPLANVRPLGP---PPPP 672 Score = 29.5 bits (63), Expect = 5.6 Identities = 17/60 (28%), Positives = 18/60 (30%) Frame = +2 Query: 587 PXXPXXXXPXXPXXPPPXXPXPPPXXPPPXAXXXXXXXXXXXXXXXPXXPXXAXXXPPPP 766 P P P PPP PP PPP + P P PPPP Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPP--PPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPP 492 Score = 28.7 bits (61), Expect = 9.8 Identities = 23/78 (29%), Positives = 25/78 (32%) Frame = +2 Query: 446 PPPXXFRGNXXFXKLEXXXKKIFGXPXPPXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPX 625 PPP GN + +G P PP P PPP P P Sbjct: 435 PPPPPPSGN--YGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGP---- 488 Query: 626 XPPPXXPXPPPXXPPPXA 679 PPP PP PP A Sbjct: 489 PPPPSGNYGPP--PPQFA 504 >AE014296-2989|AAF49282.3| 1412|Drosophila melanogaster CG8127-PB, isoform B protein. Length = 1412 Score = 33.1 bits (72), Expect = 0.46 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 PP P P PPPP PPP Sbjct: 265 PPLAPPPPPPPPPPPP 280 Score = 32.3 bits (70), Expect = 0.80 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPP 673 P PPP P PPP PPP Sbjct: 266 PLAPPPPPPPPPPPPPPP 283 Score = 30.3 bits (65), Expect = 3.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 609 PPXXPXPXPPPPXPP 653 PP P P PPPP PP Sbjct: 269 PPPPPPPPPPPPPPP 283 Score = 30.3 bits (65), Expect = 3.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 612 PXXPXPXPPPPXPPP 656 P P P PPPP PPP Sbjct: 269 PPPPPPPPPPPPPPP 283 Score = 29.1 bits (62), Expect = 7.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 620 PXXPPPXXPXPPPXXPPP 673 P PP P PPP PPP Sbjct: 265 PPLAPPPPPPPPPPPPPP 282 Score = 29.1 bits (62), Expect = 7.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 609 PPXXPXPXPPPPXPPP 656 P P P PPPP PPP Sbjct: 266 PLAPPPPPPPPPPPPP 281 >AE013599-1058|AAF58816.2| 2376|Drosophila melanogaster CG18408-PA, isoform A protein. Length = 2376 Score = 33.1 bits (72), Expect = 0.46 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPP P P PP PP P P PP P P Sbjct: 859 PPPPPTAQPPT--PPLRQKPAPPPVPQPVSPPAPPTP 893 >AB053478-1|BAB62017.1| 2376|Drosophila melanogaster DCAPL1 protein. Length = 2376 Score = 33.1 bits (72), Expect = 0.46 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 546 PPPXPXPXPXXXXPPXXXXXXPPXXPXPXPPPPXPPP 656 PPP P P PP PP P P PP P P Sbjct: 859 PPPPPTAQPPT--PPLRQKPAPPPVPQPVSPPAPPTP 893 >M83931-1|AAB04680.1| 1595|Drosophila melanogaster son of sevenless protein protein. Length = 1595 Score = 32.7 bits (71), Expect = 0.60 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG G G G G GG GG G G G GGGG Sbjct: 15 GGGIGLGTGGGGGSGGSGSGSQGG----GGGIGIGGGG 48 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG 569 GGG G GG G G GG GG G Sbjct: 23 GGGGGSGGSGSGSQGGGGGIGIGGGGVAG 51 >M77501-1|AAA28904.1| 1596|Drosophila melanogaster son of sevenless protein. Length = 1596 Score = 32.7 bits (71), Expect = 0.60 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXGXGXGXGGGG 542 GGG G G G G GG GG G G G GGGG Sbjct: 15 GGGIGLGTGGGGGSGGSGSGSQGG----GGGIGIGGGG 48 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 655 GGGXGGGGXGXGXXGGXXXXXXGGXXXXG 569 GGG G GG G G GG GG G Sbjct: 23 GGGGGSGGSGSGSQGGGGGIGIGGGGVAG 51 >BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p protein. Length = 468 Score = 32.7 bits (71), Expect = 0.60 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Frame = +2 Query: 530 PXXXPPXPXPPPXXXXXXXPXXPXXXXPXXPXXPPP-XXPXPPPXXP 667 P P P P P P P P PPP P PPP P Sbjct: 165 PAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPPAP 211 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,450,525 Number of Sequences: 53049 Number of extensions: 1141359 Number of successful extensions: 50173 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4236 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19865 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3757402116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -