BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_A08 (828 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0515 - 3864796-3865425 44 1e-04 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 44 1e-04 07_03_0329 + 16840051-16840917,16840999-16841342,16841444-168415... 44 2e-04 07_01_0080 + 587674-588510 44 2e-04 02_05_0686 - 30900748-30902167,30903442-30904742 43 3e-04 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 42 5e-04 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 42 6e-04 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 41 0.001 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 41 0.001 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 40 0.002 08_02_1019 - 23657175-23658047 40 0.002 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 39 0.004 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 39 0.004 01_01_0796 + 6190931-6192745 29 0.004 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 39 0.006 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 39 0.006 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 34 0.007 09_06_0125 - 21011757-21012428 38 0.010 01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827,896... 34 0.012 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 38 0.013 07_03_1382 - 26170563-26170631,26171151-26171843 38 0.013 07_03_0890 - 22332768-22333382 38 0.013 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 38 0.013 05_01_0380 + 2978256-2979284 38 0.013 01_01_0046 - 331758-332627 37 0.017 08_02_1256 + 25645085-25645396 37 0.023 08_01_0546 - 4746118-4746580,4747335-4747342 37 0.023 07_03_1136 + 24218601-24218734,24218769-24219906 37 0.023 06_03_0696 + 23617687-23617851,23618838-23619536 37 0.023 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 37 0.023 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 37 0.023 03_06_0427 - 33857008-33857137,33857224-33857258,33857966-338580... 37 0.023 03_02_0514 + 9038606-9039790,9040211-9040432,9040548-9040655,904... 37 0.023 12_02_1219 + 27096477-27096590,27096704-27097078 36 0.030 12_02_1114 - 26171876-26172493 36 0.030 10_08_0553 - 18720436-18720494,18721102-18721106,18721136-187212... 36 0.030 09_06_0283 + 22024779-22026134,22026181-22026714 36 0.030 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 36 0.030 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 36 0.030 07_03_0177 - 14770777-14772045 36 0.030 06_03_1326 - 29355467-29355817 36 0.030 06_03_0790 - 24636805-24637770 36 0.030 06_02_0175 - 12624608-12625297 36 0.030 04_04_1413 - 33386049-33386339 36 0.030 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 36 0.030 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 36 0.030 03_01_0023 + 198414-198968 36 0.030 02_05_0149 + 26290236-26290880 36 0.030 02_04_0400 - 22608519-22608844,22609044-22609122 36 0.030 01_07_0188 - 41866689-41866763,41866889-41867155,41867277-418677... 36 0.030 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 36 0.039 07_01_0516 - 3850252-3852870 36 0.039 04_04_1126 + 31095651-31096115 36 0.039 01_01_0929 - 7344911-7345978 36 0.039 02_02_0059 - 6432945-6433115,6433975-6434061,6434585-6434787,643... 29 0.046 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 36 0.052 05_05_0217 + 23366436-23367005 27 0.066 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 35 0.069 05_07_0001 + 26976510-26977382 35 0.069 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 35 0.069 03_05_0067 - 20460206-20460703,20461255-20461530 35 0.069 05_01_0364 + 2855760-2855801,2855940-2856015,2856759-2857747 35 0.082 12_01_0495 - 3935395-3937110 35 0.091 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 35 0.091 09_02_0327 - 7284829-7284889,7284946-7286126 35 0.091 08_02_0758 + 20848078-20849579,20849660-20849850,20849944-208501... 35 0.091 07_03_0965 - 22996575-22999112,22999202-22999636,22999717-229998... 35 0.091 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 35 0.091 04_03_0833 + 20147242-20147849,20147937-20148081,20148157-201482... 35 0.091 04_01_0197 + 2323790-2324098,2324145-2324774 35 0.091 03_06_0599 + 34984869-34985319,34986581-34987563 35 0.091 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 35 0.091 02_01_0400 - 2922837-2923060,2923280-2923367,2923422-2923473,292... 35 0.091 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 35 0.091 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 35 0.091 01_03_0005 + 11568545-11569119,11569179-11569191 35 0.091 01_01_1108 + 8758486-8758815,8758913-8758960,8761512-8761664,876... 35 0.091 12_02_0299 - 17051570-17052474,17053542-17053755 34 0.12 12_01_0841 - 7873458-7874225 34 0.12 12_01_0840 - 7847239-7847531,7847576-7847675,7848312-7848388,784... 34 0.12 12_01_0473 + 3708770-3710026 34 0.12 10_08_0521 + 18500105-18500529,18501216-18501284,18501467-185015... 34 0.12 10_07_0161 - 13674631-13675433,13675793-13675862 34 0.12 09_03_0130 - 12609417-12610462,12610786-12611040,12611139-126112... 34 0.12 08_02_1410 - 26876243-26876497,26877129-26877239,26877240-268773... 34 0.12 08_02_0796 - 21300251-21300373,21300846-21301721 34 0.12 06_01_0486 - 3455030-3455770 34 0.12 05_07_0280 - 28920864-28920971,28921076-28921175,28921267-289213... 34 0.12 04_04_0183 - 23384290-23384783,23385064-23385139,23385291-23385296 34 0.12 03_05_0252 - 22403504-22404676 34 0.12 03_02_0856 - 11815684-11815701,11816019-11816194,11817878-11818670 34 0.12 03_02_0786 - 11169820-11170158,11170245-11170433,11171173-111714... 34 0.12 03_02_0765 + 11000724-11002496 34 0.12 02_05_1277 - 35408097-35409080 34 0.12 01_05_0490 + 22672241-22674679 34 0.12 01_01_0995 + 7875273-7875495,7876196-7876274,7876422-7876536,787... 34 0.12 01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593,703... 34 0.12 12_02_1174 - 26696869-26698191 34 0.16 10_08_0116 + 14935582-14936089,14936850-14937188,14937914-149379... 34 0.16 09_06_0172 + 21329904-21331512,21331595-21331740,21332333-213325... 34 0.16 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 34 0.16 09_04_0608 + 18924648-18924899,18926341-18926435,18926903-189272... 34 0.16 09_04_0580 + 18681019-18681475,18682637-18682920,18683088-186833... 34 0.16 08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147,160... 34 0.16 08_01_0059 - 394001-394708 34 0.16 07_03_0560 + 19479597-19480667 34 0.16 06_03_0674 + 23422004-23422552,23423295-23423369,23424360-234244... 34 0.16 06_01_0194 + 1503350-1503554,1504399-1504490,1504835-1504935,150... 34 0.16 04_04_1628 + 34874688-34874915,34875182-34875232,34875532-348756... 34 0.16 03_05_0919 - 28792790-28792915,28793090-28793155,28794345-287945... 34 0.16 03_05_0690 + 26778567-26778804,26778950-26779024,26779995-267800... 34 0.16 02_05_0407 + 28715332-28715385,28715528-28715680,28715810-287158... 34 0.16 02_02_0240 + 8196140-8198248,8198381-8198650 34 0.16 01_07_0082 - 40965947-40967023 34 0.16 01_01_0715 - 5542648-5543219,5543352-5543544 34 0.16 07_03_1140 - 24258627-24258849,24259967-24260089,24260200-242609... 28 0.18 11_04_0307 + 16185405-16185713,16185847-16185942,16186626-161867... 33 0.21 10_08_0630 - 19410852-19411235,19411370-19412257,19412440-194129... 33 0.21 09_01_0112 + 1737438-1737777,1738441-1738511,1738974-1739052,174... 33 0.21 07_03_1530 + 27502546-27502671,27503487-27503561,27504670-275047... 33 0.21 07_01_0282 - 2070027-2070041,2074763-2075062,2075154-2075722,207... 33 0.21 06_02_0046 + 10928708-10928798,10929997-10930077,10930567-109306... 33 0.21 05_04_0303 - 20010761-20011756 33 0.21 04_04_0760 - 27837170-27837328,27837441-27837504,27837812-278381... 33 0.21 03_05_0843 + 28126480-28127007,28127092-28127457,28129388-281294... 33 0.21 03_05_0630 + 26260159-26260272,26260520-26260894 33 0.21 03_02_0350 - 7734494-7734952,7735765-7736133 33 0.21 12_02_0079 + 13310066-13310652,13310737-13310954,13311099-133113... 33 0.28 12_01_0477 + 3742751-3745200,3747192-3747502,3747886-3748232 33 0.28 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 33 0.28 09_04_0506 - 18188785-18190599 33 0.28 08_01_0202 - 1638978-1639571 33 0.28 07_03_0559 + 19475893-19476783 33 0.28 06_03_1370 + 29645598-29646288,29646364-29646752 33 0.28 06_03_0867 + 25534760-25539620,25540662-25540857,25540957-255411... 33 0.28 06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 33 0.28 06_01_0178 + 1386981-1387505 33 0.28 05_05_0313 - 24026142-24026708 33 0.28 05_05_0135 - 22626163-22626198,22626391-22626441,22626516-226266... 33 0.28 03_05_0704 - 26953474-26953643,26953770-26953801,26953915-269540... 33 0.28 03_02_0561 + 9466428-9466502,9466503-9467243,9467592-9467600 33 0.28 03_02_0457 + 8638318-8638336,8640394-8640497,8640613-8640778,864... 33 0.28 02_05_1057 + 33809982-33810366,33810436-33810687,33810727-338109... 33 0.28 02_05_0750 - 31479876-31480985 33 0.28 02_02_0525 - 11182043-11182080,11182386-11182511,11182760-11183486 33 0.28 02_01_0158 - 1103461-1104186 33 0.28 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 33 0.28 12_02_1057 + 25733376-25735439 33 0.37 08_02_1063 + 24024030-24024506,24024803-24024856,24024965-240251... 33 0.37 08_02_0839 + 21693348-21694853 33 0.37 07_03_1751 - 29215074-29216270 33 0.37 07_03_0558 + 19461369-19462448 33 0.37 07_01_0725 - 5532803-5533324,5533631-5533657,5534285-5534398,553... 33 0.37 06_03_0425 - 20659298-20659634,20659964-20660075,20660161-20660272 33 0.37 06_02_0127 + 12140843-12140966,12141170-12141567 33 0.37 06_02_0125 + 12122812-12122911,12123647-12123993 33 0.37 06_01_1050 + 8262033-8262165,8262262-8262391,8262486-8263026 33 0.37 05_04_0235 + 19291204-19291769,19291860-19292250 33 0.37 03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 33 0.37 03_06_0365 - 33399422-33399925,33400470-33400583,33400762-334009... 33 0.37 02_05_0818 + 32004749-32005347,32005905-32006415,32006539-32007300 33 0.37 02_04_0271 + 21445113-21445865,21446727-21446788,21446927-214470... 33 0.37 01_06_1602 - 38559661-38559936,38560008-38560137,38562550-385627... 33 0.37 01_06_1365 - 36690267-36692222 33 0.37 01_06_0090 + 26358051-26359157,26359582-26359701,26359968-263600... 33 0.37 01_05_0513 - 22864657-22867899 33 0.37 01_01_0570 - 4231100-4232560 33 0.37 12_02_0848 + 23636478-23638058 32 0.48 11_06_0016 - 19284810-19284926,19285527-19286879 32 0.48 09_04_0168 - 15295442-15295477,15295478-15295552,15295660-152957... 32 0.48 08_02_1330 + 26191062-26191314,26191894-26191961,26192125-261923... 32 0.48 07_03_1386 - 26192019-26192073,26192272-26192397,26192570-261926... 32 0.48 07_01_0714 - 5451246-5451408,5453401-5453534,5453608-5453796,545... 32 0.48 06_03_0447 + 20878444-20878821 32 0.48 06_02_0207 + 13017538-13017670,13019486-13019658,13020754-130208... 32 0.48 05_06_0026 - 25024807-25025300,25025432-25025495,25025567-250256... 32 0.48 05_03_0662 + 16732965-16733037,16733310-16733413,16734468-167348... 32 0.48 04_04_1414 - 33394518-33394847 32 0.48 04_03_1022 - 21778315-21779007 32 0.48 03_05_0688 + 26762668-26762893,26763027-26763101,26763865-267640... 32 0.48 02_02_0417 + 9993807-9993868,9994009-9994105,9994223-9994310,999... 32 0.48 01_06_0561 + 30251547-30252173,30252248-30252405,30253250-302541... 32 0.48 01_06_0046 + 25943183-25943590 32 0.48 01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 32 0.48 01_05_0501 + 22764978-22765896,22766087-22766349,22766613-227668... 32 0.48 01_01_0347 + 2765517-2767109,2767214-2767228 32 0.48 06_03_0214 + 18067945-18068463,18068940-18069839,18069918-18070652 29 0.49 02_01_0377 + 2728892-2729187,2729483-2729544,2730516-2730570,273... 29 0.50 05_03_0001 - 7269231-7269436,7269536-7270100,7270600-7270821,727... 26 0.63 12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758,417... 32 0.64 09_03_0145 - 12749288-12751510 32 0.64 07_03_1533 + 27523811-27524710 32 0.64 07_03_0600 + 19866757-19867218,19867920-19868429 32 0.64 07_03_0154 + 14509979-14512033 32 0.64 07_01_0479 + 3606663-3607448 32 0.64 06_03_1121 + 27767707-27768065,27768612-27769034,27770013-277701... 32 0.64 06_01_0931 + 7192519-7194075 32 0.64 05_07_0102 + 27700395-27700426,27701034-27702087,27703205-27703420 32 0.64 04_04_1687 - 35365766-35366356,35367137-35368135 32 0.64 04_04_1641 + 34993807-34994589,34994924-34995022,34995521-349956... 32 0.64 04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 32 0.64 04_04_0726 + 27588225-27588685,27588768-27588895,27590523-27591016 32 0.64 04_04_0198 + 23502657-23502900,23505228-23505298,23505690-235057... 32 0.64 03_03_0278 - 16126803-16129049 32 0.64 03_03_0139 + 14769393-14769764,14770113-14770193,14770537-14770737 32 0.64 02_04_0382 - 22501041-22501279,22501717-22501810 32 0.64 02_02_0682 - 12923103-12923747,12924607-12924870,12924953-129252... 32 0.64 02_02_0359 - 9390175-9390416,9390924-9391044,9391069-9391410,939... 32 0.64 02_01_0471 - 3364215-3364912,3365511-3365742,3365827-3366198,336... 32 0.64 01_06_1758 - 39681942-39682030,39682115-39682345,39682643-396826... 32 0.64 01_06_1377 + 36764461-36765339 32 0.64 01_01_0716 - 5548908-5549235,5549327-5549768,5549847-5549982 32 0.64 01_01_0626 - 4713943-4714515,4714645-4714853,4717310-4717628 32 0.64 06_01_0760 - 5676973-5677830 31 0.69 12_02_0370 + 18139557-18140469,18140561-18140704,18140804-181409... 31 0.85 12_01_0838 - 7830944-7831444 31 0.85 11_03_0095 - 9905323-9905793 31 0.85 10_08_0880 + 21267034-21267537 31 0.85 10_08_0338 + 16916429-16916650,16916728-16917900 31 0.85 10_08_0214 - 15915156-15915713 31 0.85 10_02_0009 + 4128909-4130123 31 0.85 10_01_0360 - 3970796-3971248,3972080-3972436 31 0.85 09_04_0616 + 18977421-18977907,18977984-18978245,18978903-18979149 31 0.85 08_02_0602 + 19183549-19184919 31 0.85 08_02_0329 - 15833124-15833825 31 0.85 08_01_0600 - 5262573-5262773,5262850-5262952,5263050-5263180,526... 31 0.85 07_01_0862 - 7172083-7172931 31 0.85 05_05_0293 + 23896011-23896207,23896309-23896366,23896502-238966... 31 0.85 04_04_0360 - 24684159-24684565,24684654-24685089 31 0.85 04_01_0500 - 6540769-6541482,6541819-6541877,6541965-6542064,654... 31 0.85 03_05_0576 + 25765137-25766420 31 0.85 03_03_0106 - 14500935-14501263,14501357-14501432,14501531-14501542 31 0.85 03_03_0008 - 13674602-13674708,13675272-13675439,13676169-136767... 31 0.85 03_02_0172 - 6131559-6131990 31 0.85 02_04_0563 - 23895573-23895614,23896330-23896390,23896901-238970... 31 0.85 02_04_0180 + 20696258-20698398,20698691-20698871,20698998-20699060 31 0.85 01_06_0357 - 28668894-28669238,28669510-28669537,28669578-286696... 31 0.85 01_05_0641 - 23881429-23881836 31 0.85 01_05_0552 - 23173106-23173184,23173266-23173411,23173543-231740... 31 0.85 01_02_0031 + 10364487-10365407 31 0.85 01_01_1125 - 8920590-8924372 31 0.85 01_01_1067 + 8403584-8404195,8404532-8404693,8404837-8405346,840... 31 0.85 01_01_0187 + 1624159-1624279,1624530-1624590,1625118-1625574 31 0.85 01_01_0179 + 1517379-1517721,1518092-1518376,1519462-1519699,151... 31 0.85 12_02_1036 - 25587313-25587890,25589209-25589272,25589356-255894... 31 1.1 11_01_0621 - 4981070-4981136,4982906-4983825 31 1.1 10_08_0232 - 16053034-16053597 31 1.1 10_08_0127 - 15010125-15011068,15011328-15011835 31 1.1 10_03_0012 - 7037088-7037282,7037453-7037954,7038079-7038081,704... 31 1.1 10_02_0067 + 4884902-4885210,4886008-4886037 31 1.1 08_01_0394 - 3487360-3488229 31 1.1 07_03_1710 - 28903614-28903673,28904982-28905146,28905453-289056... 31 1.1 07_03_1573 + 27829967-27830338,27830821-27831510,27831594-278317... 31 1.1 07_03_0594 - 19833967-19834557 31 1.1 07_01_0015 + 108338-109186 31 1.1 06_03_1363 - 29576265-29577575 31 1.1 05_07_0031 - 27183252-27183317,27183542-27184282 31 1.1 05_03_0665 - 16774043-16774522 31 1.1 05_01_0210 + 1583176-1584177 31 1.1 04_04_1542 - 34264994-34265331,34266195-34267029 31 1.1 04_04_0233 + 23801944-23802598,23802914-23803047,23803548-238037... 31 1.1 04_04_0053 + 22389227-22389613,22390528-22390981,22391618-223916... 31 1.1 04_01_0034 - 401208-402923 31 1.1 03_02_0027 + 5100865-5100878,5102241-5102708,5102795-5103021,510... 31 1.1 02_03_0120 + 15463163-15465250 31 1.1 01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 31 1.1 01_05_0024 - 17262504-17263308,17264251-17264399,17264879-172649... 31 1.1 12_02_0528 + 20059613-20061472 26 1.4 12_02_0687 + 22123216-22123760,22125021-22125330 31 1.5 11_06_0610 - 25449085-25453284 31 1.5 11_04_0415 - 17395988-17396161,17397349-17397444,17397489-173980... 31 1.5 11_01_0133 + 1121392-1122731,1123417-1123858 31 1.5 11_01_0066 - 536281-537196,537397-537452 31 1.5 10_08_0234 - 16067579-16068157 31 1.5 10_08_0233 - 16061182-16061714,16062765-16063578 31 1.5 10_08_0222 - 15983756-15984313 31 1.5 10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526,595... 31 1.5 09_01_0016 - 376742-376883,377973-378964 31 1.5 08_01_0648 + 5602454-5602513,5602913-5603000,5603128-5604248,560... 31 1.5 08_01_0531 - 4604556-4604582,4604829-4604921,4605381-4605572,460... 31 1.5 07_01_0789 - 6150257-6151046,6151167-6151390,6151816-6151991,615... 31 1.5 06_03_0743 + 24069752-24070483,24071890-24072345 31 1.5 06_03_0704 + 23706318-23707024,23707093-23707222 31 1.5 06_01_0807 - 6069998-6071326 31 1.5 06_01_0690 + 5033943-5034740 31 1.5 06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700,336... 31 1.5 06_01_0039 - 386576-387098,387173-387468,387744-388067,388165-38... 31 1.5 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 31 1.5 05_06_0078 - 25412770-25413852 31 1.5 05_03_0458 + 14280953-14281866,14281964-14282912 31 1.5 05_02_0122 - 6840840-6841307 31 1.5 05_01_0384 + 2997465-2999777,2999960-3000035,3003027-3003102,300... 31 1.5 04_04_1416 - 33411900-33412148,33412735-33412854,33412986-334132... 31 1.5 04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 31 1.5 03_05_1081 + 30235677-30236474 31 1.5 03_05_0292 + 22846273-22846377,22847161-22847823 31 1.5 03_02_0738 - 10824121-10825572 31 1.5 02_05_0246 + 27136590-27138610,27138933-27139056,27139401-271396... 31 1.5 02_04_0313 - 21947115-21948021,21948102-21948172 31 1.5 02_04_0312 - 21942310-21943356 31 1.5 02_03_0390 + 18448671-18448889,18449567-18449632,18449702-184497... 31 1.5 01_06_1321 + 36280691-36281269 31 1.5 01_06_0146 + 26969011-26969995,26970878-26970930 31 1.5 01_05_0292 + 20518668-20519090,20519213-20519281,20520204-205204... 31 1.5 08_01_0264 - 2142856-2143152,2143667-2143829,2143915-2143992,214... 26 1.5 12_02_1070 - 25814741-25815850 30 2.0 12_02_0450 + 19172812-19172920,19173020-19173088,19173168-191732... 30 2.0 12_01_0969 - 9765114-9765664,9767963-9768512,9769507-9769561,976... 30 2.0 12_01_0292 + 2193309-2193338,2193565-2193640,2193744-2195203,219... 30 2.0 11_06_0292 - 22015603-22015716,22015774-22016163 30 2.0 10_08_0514 + 18465474-18465760,18465888-18465978,18466670-184667... 30 2.0 10_08_0216 - 15942379-15942852,15942956-15943033 30 2.0 09_02_0543 + 10427321-10428315,10428440-10429154 30 2.0 08_02_1329 - 26182762-26183007,26183149-26183249,26183533-261836... 30 2.0 08_02_0937 + 22801526-22802461 30 2.0 08_02_0384 + 16552194-16552621,16552909-16553173,16553239-16553337 30 2.0 07_01_0633 - 4735298-4735485,4736083-4736114,4736203-4736297,473... 30 2.0 07_01_0180 + 1266975-1267550 30 2.0 06_03_1506 + 30641428-30642168 30 2.0 06_02_0120 + 12055076-12055175,12055322-12055725 30 2.0 04_04_1694 - 35419278-35419565,35419744-35419861,35420404-354204... 30 2.0 04_04_0057 + 22410167-22411330 30 2.0 04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 30 2.0 03_04_0231 + 19050105-19050567,19051376-19052648,19052743-19054171 30 2.0 03_02_0814 + 11467775-11468308 30 2.0 03_02_0149 + 5933134-5933207,5935039-5935267,5935370-5935468,593... 30 2.0 03_01_0252 - 1963884-1963937,1964030-1964213,1964347-1964423,196... 30 2.0 02_05_0860 - 32296743-32296769,32297328-32297357,32298432-322985... 30 2.0 02_05_0742 + 31415862-31417088 30 2.0 02_04_0021 + 18975992-18976408 30 2.0 02_02_0582 - 11798252-11798908 30 2.0 02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 30 2.0 02_01_0224 - 1461924-1462227,1462602-1462798,1463059-1463213,146... 30 2.0 01_07_0120 + 41185884-41186127,41187228-41187310,41188596-411886... 30 2.0 05_04_0011 + 17139322-17139451,17139552-17140174 30 2.0 06_03_0292 + 19207029-19207940 26 2.5 03_02_0553 - 9420960-9421164,9421634-9421812,9421902-9421970,942... 28 2.5 12_01_0421 - 3321590-3323692 30 2.6 12_01_0135 + 1042889-1044255,1045368-1045809 30 2.6 11_06_0453 + 23781803-23781814,23782700-23782781,23783334-23784160 30 2.6 11_03_0163 - 10970459-10970725 30 2.6 11_01_0359 - 2731522-2732346 30 2.6 10_08_0931 - 21647562-21649037 30 2.6 10_08_0534 + 18595520-18595828,18595917-18597149 30 2.6 10_08_0527 - 18555231-18555882,18556334-18556463,18557073-18557175 30 2.6 10_08_0213 - 15912048-15912716 30 2.6 09_05_0008 + 20042390-20042845,20043323-20043457,20043539-200436... 30 2.6 09_02_0603 - 11150739-11150746,11150791-11151340 30 2.6 09_02_0081 - 4041364-4041555,4041830-4041911,4042192-4042443,404... 30 2.6 08_02_1615 + 28257275-28258428,28258523-28259144 30 2.6 08_02_0759 - 20851828-20851932,20852190-20852285,20853231-208533... 30 2.6 08_01_0374 + 3301301-3301521,3301723-3301852,3301895-3301903,330... 30 2.6 07_03_1691 - 28726307-28726323,28726588-28726953,28727483-287275... 30 2.6 07_03_0544 + 19309026-19310105 30 2.6 07_01_0662 + 4972953-4973645,4973758-4974046,4974790-4974803,497... 30 2.6 06_03_1191 + 28286685-28287008,28287149-28287211,28287377-282874... 30 2.6 06_03_1178 + 28203466-28204590,28204745-28205652,28206189-28206258 30 2.6 06_01_0586 - 4203024-4203425,4203527-4203595,4203681-4203746,420... 30 2.6 05_06_0277 + 26885621-26886064,26886148-26886317,26887038-268879... 30 2.6 05_05_0101 - 22398814-22399164 30 2.6 05_04_0091 + 17839118-17839303,17840876-17840923,17841381-178415... 30 2.6 05_01_0142 - 940421-940701,941262-941574 30 2.6 04_04_1125 + 31085106-31085714 30 2.6 03_06_0337 + 33224333-33224479,33224603-33224663,33224740-332247... 30 2.6 03_01_0092 - 731069-731434,731569-733080 30 2.6 02_05_0914 + 32702753-32703078,32703940-32704000,32704132-327041... 30 2.6 02_02_0543 + 11360514-11361350,11361434-11361559,11361648-113619... 30 2.6 02_01_0281 - 1879519-1879605,1880761-1880851,1881343-1881849,188... 30 2.6 01_06_1731 + 39516897-39517632,39517744-39517912,39517985-395184... 30 2.6 01_01_0672 + 5147916-5147976,5148087-5148166,5148329-5148973,514... 30 2.6 01_01_0083 + 631196-631675 30 2.6 09_02_0495 + 9880714-9881196 27 2.7 12_02_1177 - 26708215-26708309,26708355-26708392,26708476-267095... 29 3.4 12_01_1007 - 10208034-10208165,10208376-10208480,10208612-102086... 29 3.4 12_01_0252 + 1868670-1869200,1870167-1871120 29 3.4 11_06_0202 - 21184217-21184503,21184622-21184982 29 3.4 11_02_0065 - 7938007-7938393,7939292-7939435,7940597-7940665,794... 29 3.4 11_01_0687 - 5651002-5651453,5651535-5651951,5652621-5653338,565... 29 3.4 11_01_0252 + 1934505-1935032,1936001-1936957 29 3.4 10_08_0543 - 18649894-18650233,18651446-18651981 29 3.4 10_08_0238 - 16093780-16094355 29 3.4 10_08_0221 - 15980370-15980927 29 3.4 10_08_0220 - 15977247-15977804 29 3.4 10_08_0219 - 15972061-15972110,15972411-15972632,15972673-15972955 29 3.4 10_08_0218 - 15967064-15967906 29 3.4 10_08_0217 - 15962192-15962884 29 3.4 10_08_0215 - 15939842-15940056,15940235-15940913 29 3.4 10_08_0095 + 14760292-14760624,14760689-14761000,14761768-147624... 29 3.4 09_06_0277 - 21983049-21983080,21983250-21984788,21986619-219866... 29 3.4 09_04_0684 - 19442335-19442990,19443774-19443839,19443935-194440... 29 3.4 09_04_0324 - 16686872-16687074,16687479-16687521,16687735-166880... 29 3.4 08_02_1237 + 25475219-25475916,25476127-25476320,25476407-254773... 29 3.4 08_01_1038 + 10540185-10540709 29 3.4 07_03_1012 + 23295976-23296264,23296475-23296548,23296972-232969... 29 3.4 07_03_0527 - 19085828-19086319 29 3.4 07_01_0577 - 4286048-4286186,4286600-4286660,4286957-4287089,428... 29 3.4 06_03_1133 - 27886823-27887088,27887837-27888629,27888674-27889000 29 3.4 06_03_0927 + 26015956-26018230,26018323-26018471,26018550-260186... 29 3.4 06_02_0339 + 14761074-14761421 29 3.4 06_02_0257 - 13533689-13533714,13533799-13533925,13534013-135341... 29 3.4 06_02_0126 + 12130409-12130532,12131015-12131373 29 3.4 05_07_0236 - 28582157-28582552,28582639-28582911,28583324-285835... 29 3.4 05_07_0219 - 28474661-28475146,28475979-28476644 29 3.4 05_05_0334 + 24156532-24156565,24156681-24156782,24157145-241572... 29 3.4 05_03_0340 + 12691974-12692155,12692248-12692312,12692816-126928... 29 3.4 05_02_0161 + 7199005-7199505,7200118-7200378,7201532-7201621 29 3.4 04_04_0832 - 28507448-28507516,28507902-28507980,28508527-28509614 29 3.4 04_04_0009 + 22134160-22134696 29 3.4 03_06_0348 - 33299824-33300234 29 3.4 03_05_1153 + 30787574-30787608,30787982-30788089,30788651-307886... 29 3.4 03_05_0269 - 22545925-22546554,22546663-22547010,22547447-22547797 29 3.4 02_04_0476 + 23248222-23248495,23249558-23249790 29 3.4 01_06_1827 + 40169001-40169263,40169358-40169472,40170090-401702... 29 3.4 01_06_1809 - 40029628-40030539 29 3.4 01_06_1808 - 40023533-40023966,40024078-40024204 29 3.4 01_06_1799 + 39948481-39948607,39948694-39948762,39948859-399489... 29 3.4 01_06_1236 + 35613123-35613816,35615809-35615952,35616032-356161... 29 3.4 01_06_0883 + 32708037-32708558,32708627-32708911,32709661-32709675 29 3.4 01_01_1162 - 9253034-9254229,9254387-9254456,9254473-9254567,925... 29 3.4 01_01_1044 + 8231933-8231941,8232091-8232166,8232423-8232871 29 3.4 01_01_0070 - 542603-542686,542803-543441 29 3.4 12_02_1119 + 26213719-26213955,26214039-26214197,26214640-262147... 29 4.5 12_02_1060 - 25752181-25754229 29 4.5 12_02_0818 - 23427625-23429022 29 4.5 12_02_0408 + 18659494-18660362,18660472-18660634,18660976-186611... 29 4.5 12_01_1079 - 11223247-11223336,11223606-11223717,11224743-112248... 29 4.5 12_01_0558 + 4521616-4522296 29 4.5 12_01_0399 + 3152219-3152721,3152995-3153127,3155013-3155097,315... 29 4.5 12_01_0373 + 2897874-2898911 29 4.5 12_01_0319 + 2440129-2440661,2440875-2440902 29 4.5 11_07_0007 - 27262229-27262638,27263252-27263312 29 4.5 11_06_0208 - 21268722-21268763,21269146-21269274,21269388-212695... 29 4.5 11_06_0188 + 21036465-21036627,21036735-21036883,21037369-210374... 29 4.5 11_04_0183 + 14642037-14642069,14642099-14642220,14642791-146429... 29 4.5 11_01_0288 + 2151552-2151581,2151818-2151893,2152019-2153460 29 4.5 10_08_1013 - 22239396-22239536,22240629-22240715,22240787-22241131 29 4.5 10_08_0738 - 20212220-20212282,20212387-20212593,20212690-202128... 29 4.5 10_08_0544 - 18655186-18655567,18656835-18657151 29 4.5 10_08_0322 + 16736013-16736072,16737200-16737305,16737436-167375... 29 4.5 10_08_0297 + 16602176-16602553 29 4.5 10_08_0242 - 16120554-16121129 29 4.5 10_08_0223 - 15986763-15987575 29 4.5 10_07_0134 + 13289641-13290216,13290435-13290914 29 4.5 10_06_0152 - 11280532-11281427,11281501-11281971,11282512-11282569 29 4.5 10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364,955... 29 4.5 10_02_0134 + 5667236-5669295,5669833-5669902,5670266-5670376 29 4.5 09_02_0366 + 7941550-7942161,7942230-7942775 29 4.5 09_02_0274 + 6611555-6611615,6612229-6612638 29 4.5 08_02_1602 - 28148255-28149413,28151927-28152087 29 4.5 08_02_1369 - 26445725-26445812,26446443-26446529,26446720-264469... 29 4.5 08_02_1084 - 24232968-24234779 29 4.5 08_02_0780 + 21148283-21148634,21148730-21149146,21150194-21150534 29 4.5 08_01_0134 + 1067826-1068158 29 4.5 08_01_0060 - 413088-413999 29 4.5 07_03_1771 - 29404972-29405175,29405282-29405677 29 4.5 07_03_1648 - 28382520-28382963,28383623-28383868 29 4.5 07_03_1381 - 26166673-26166747,26166972-26167544 29 4.5 07_03_1090 + 23891294-23892222,23892317-23892516,23895241-238954... 29 4.5 07_03_0435 + 18182657-18183509,18184477-18184574,18184663-181848... 29 4.5 07_03_0111 + 13535912-13535972,13536081-13536142,13536418-135365... 29 4.5 07_01_0753 - 5799733-5799741,5799938-5800642 29 4.5 06_03_1368 - 29612463-29612638,29613135-29613222,29613334-296134... 29 4.5 06_03_0750 - 24140988-24141037,24141108-24141345,24142158-241422... 29 4.5 06_03_0526 + 21771519-21771607,21771685-21771810,21771890-217720... 29 4.5 06_03_0464 + 21043706-21044305,21044418-21044460,21047402-21047421 29 4.5 06_02_0122 - 12095385-12095713,12096018-12096120 29 4.5 06_01_0805 + 6043248-6043551,6043654-6043755,6044858-6044964,604... 29 4.5 06_01_0800 - 5988425-5988580,5988842-5988951,5990275-5990392,599... 29 4.5 06_01_0561 - 3983308-3983564,3983652-3983775 29 4.5 06_01_0102 + 834660-834911,835460-835568,835891-836006,836116-83... 29 4.5 05_06_0063 + 25289117-25290643 29 4.5 05_05_0154 - 22774503-22774652,22774738-22774968,22775508-227756... 29 4.5 05_04_0206 + 19034259-19035462,19036870-19037045,19037752-190379... 29 4.5 05_01_0351 + 2750253-2751042,2751951-2751958,2752122-2752149,275... 29 4.5 05_01_0192 + 1394342-1396645 29 4.5 04_04_1560 - 34432491-34432837,34433097-34433292 29 4.5 04_04_1104 - 30928475-30928501,30929008-30929110,30929287-309293... 29 4.5 04_04_0887 + 29095087-29096166 29 4.5 04_04_0708 - 27441373-27442611 29 4.5 04_03_0977 + 21381857-21383757,21384299-21384458,21384669-213847... 29 4.5 04_03_0294 + 14010150-14010491,14010593-14010775 29 4.5 04_03_0243 - 13271384-13272865,13272987-13273248,13274617-13276067 29 4.5 04_03_0098 + 11183039-11183752 29 4.5 04_01_0354 - 4646826-4647314 29 4.5 03_06_0411 + 33741903-33742163,33742990-33743168,33743342-337434... 29 4.5 03_06_0218 - 32442904-32443347,32444426-32444626,32446584-32447156 29 4.5 03_05_0918 - 28785233-28786613,28786894-28787140,28787773-28788238 29 4.5 03_05_0535 + 25352283-25352562,25352661-25352788,25352928-253530... 29 4.5 03_03_0193 - 15312568-15312753,15312811-15312933,15313112-153131... 29 4.5 03_02_0784 - 11154395-11154888,11155284-11155360,11155447-111554... 29 4.5 03_02_0719 + 10654842-10654977,10655039-10655124,10655226-106570... 29 4.5 02_05_0925 - 32768815-32769654 29 4.5 02_05_0543 + 29872168-29872767,29873089-29873115 29 4.5 02_05_0410 + 28744716-28744841,28745361-28745965,28746151-287462... 29 4.5 02_05_0201 + 26687369-26689228 29 4.5 02_04_0005 - 18843061-18843201,18843309-18843440,18844457-188453... 29 4.5 02_03_0279 + 17250347-17252098 29 4.5 02_01_0035 - 220036-221419,222050-222801 29 4.5 01_07_0122 - 41196081-41196205,41197561-41198245,41198961-411993... 29 4.5 01_07_0076 + 40914237-40914315,40914415-40914677 29 4.5 >03_01_0515 - 3864796-3865425 Length = 209 Score = 44.0 bits (99), Expect = 1e-04 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 83 PPPPPLPPPPPPPAASPPPPPP 104 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP PPPPP Sbjct: 100 PPPPPSPPPPSPVKSSPPPPP 120 Score = 37.5 bits (83), Expect = 0.013 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 83 PPPPPLPPPPPPPAASPPPPP 103 Score = 36.7 bits (81), Expect = 0.023 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP P PPPP PPPP P Sbjct: 85 PPPLPPPPPPPAASPPPPPPSP 106 Score = 35.9 bits (79), Expect = 0.039 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP PPPP PPP PP Sbjct: 86 PPLPPPPPPPAASPPPPPPSPP 107 Score = 33.9 bits (74), Expect = 0.16 Identities = 18/60 (30%), Positives = 19/60 (31%), Gaps = 1/60 (1%) Frame = +2 Query: 206 PNPVNPXLGXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPP-PXPXPPPPXXPXXXPPXPP 382 P P+ P PPP PP P P PPP P PP PP Sbjct: 48 PPPLAPPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPP 107 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP PP PP Sbjct: 100 PPPPPSPPPPSPVKSSPPPPP 120 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPP--PXPPPPXXGGGXPPPPPP 434 PPP PPPP G PPPPPP Sbjct: 53 PPPSVTSSPPPPAAGPLMPPPPPP 76 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP PPPP P Sbjct: 68 PLMPPPPPPPSVTSSPPPPPLP 89 Score = 31.9 bits (69), Expect = 0.64 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPX----PPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 73 PPPPPSVTSSPPPPPL---PPPPPPP 95 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPPPXP-----PPPXXGGGXPPPPPP 434 PPPPP P PPP PPPPPP Sbjct: 71 PPPPPPPSVTSSPPPPP---LPPPPPP 94 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP P P PP Sbjct: 99 PPPPPPSPPPPSPVKSSPPPP 119 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PP PPP P Sbjct: 91 PPPPPAASPPPPPPSPPPPSP 111 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PP P PPPP Sbjct: 89 PPPPPPPAASPPPPPPSPPPP 109 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPX---PPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPP P Sbjct: 90 PPPPPPAASPPPPPPS---PPPPSP 111 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP PPP P PP P Sbjct: 92 PPPPAASPPPPPPSPPPPSP 111 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G PPP GGGG GGGGG Sbjct: 389 GGGGPGAPPPYHGGGGGGGGGG 410 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGGG Sbjct: 99 GGGGGGGRGGGGGGGGRGGGG 119 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 91 GGGGGGGYGGGGGGGRGGGGG 111 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGGGG Sbjct: 92 GGGGGGYGGGGGGGRGGGGGGG 113 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 44 GGGGGGRGRGGGGGGGGGYGGG 65 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 56 GGGGGGYGGGGVGGGYGGGGGG 77 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGGG Sbjct: 74 GGGGYGGGGGGYGGGGRGGGGG 95 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GG GG Sbjct: 79 GGGGGGYGGGGRGGGGGGGYGG 100 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGGG Sbjct: 82 GGGYGGGGRGGGGGGGYGGGGG 103 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 91 GGGGGGGYGGGGGGGRGGGGGG 112 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 45 GGGGGRGRGGGGGGGGGYGGG 65 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 55 GGGGGGGYGGGGVGGGYGGGGG 76 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 83 GGYGGGGRGGGGGGGYGGGGG 103 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 91 GGGGGGGYGGGGGGGRGGGGG 111 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG Sbjct: 203 GGGGGGYNKSGGGGGGYNRGGG 224 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G GGGG GGGG Sbjct: 46 GGGGRGRGGGGGGGGGYGGGG 66 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGG Sbjct: 99 GGGGGGGRGGGGGGGGRGGGG 119 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGGG Sbjct: 72 GGGGGGY---GGGGGGYGGGG 89 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGG GGGG GGGGG Sbjct: 63 GGGGVGGGYGGGGGGYGGGGG 83 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GG GG Sbjct: 87 GGGRGGGGGGGYGGGGGGGRGG 108 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG G GGG Sbjct: 88 GGRGGGGGGGYGGGGGGGRGGG 109 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGG G Sbjct: 100 GGGGGGRGGGGGGGGRGGGGRG 121 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGG Sbjct: 45 GGGGGRGRGGGGGGGGGYGGGG 66 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGG G Sbjct: 51 GRGGGGGGGGGYGGGGVGGGYG 72 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGG GGGGG Sbjct: 75 GGGYGGGGGGYGGGGRGGGGGG 96 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 95 GGGYGGGGGGGRGGGGGGGGRG 116 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 418 GXPPPXXGGGGXGGGG 371 G P P GGGG GGGG Sbjct: 193 GAPSPAGGGGGGGGGG 208 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG G GGG Sbjct: 60 GGYGGGGVGGGYGGGGGGYGGG 81 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGG Sbjct: 61 GYGGGGVGGGYGGGGGGYGGGG 82 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGG Sbjct: 68 GGGYGGGGGGYGGGGGGYGGGG 89 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 76 GGYGGGGGGYGGGGRGGGGGG 96 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG G GGG Sbjct: 80 GGGGGYGGGGRGGGGGGGYGGG 101 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGG Sbjct: 81 GGGGYGGGGRGGGGGGGYGGGG 102 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GG G GGGGG Sbjct: 84 GYGGGGRGGGGGGGYGGGGGGG 105 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 89 GRGGGGGGGYGGGGGGGRGGG 109 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 92 GGGGGGYGGGGGGGRGGGGGG 112 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 99 GGGGGGGRGGGGGGGGRGGGG 119 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G G GGG Sbjct: 53 GGGGGGGGGYGGGGVGGGYGGG 74 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGG Sbjct: 54 GGGGGGGGYGGGGVGGGYGGGG 75 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 56 GGGGGGYGGGGVGGGYGGGGG 76 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 57 GGGGGYGGGGVGGGYGGGGGG 77 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 61 GYGGGGVGGGYGGGGGGYGGG 81 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGG GGGGG Sbjct: 63 GGGGVGGGYGGGGGGYGGGGGG 84 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 68 GGGYGGGGGGYGGGGGGYGGG 88 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 69 GGYGGGGGGYGGGGGGYGGGG 89 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 75 GGGYGGGGGGYGGGGRGGGGG 95 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 81 GGGGYGGGGRGGGGGGGYGGG 101 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 GG GGG GGGG GGG Sbjct: 104 GGRGGGGGGGGRGGGGRGGG 123 >07_03_0329 + 16840051-16840917,16840999-16841342,16841444-16841574, 16841671-16841792,16841877-16841983,16842104-16842236, 16842342-16842458,16842560-16842667,16842716-16842742, 16842759-16842830,16843462-16843584,16843671-16843833, 16844140-16844264,16844355-16844489,16844574-16844677, 16844772-16844834,16844930-16844993,16845186-16845318, 16845414-16845487,16845603-16845697,16845799-16845830, 16846201-16846355 Length = 1097 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG PP GGGG GGGGG Sbjct: 60 GGGGGGGGPPYYGGGGGGGGGG 81 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG PP GGGG GGGGG Sbjct: 61 GGGGGGGPPYYGGGGGGGGGGG 82 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GGGG GGGGG Sbjct: 62 GGGGGGPPYYGGGGGGGGGGGG 83 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 61 GGGGGGGPPYYGGGGGGGGGG 81 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 62 GGGGGGPPYYGGGGGGGGGGG 82 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 63 GGGGGPPYYGGGGGGGGGGGG 83 >07_01_0080 + 587674-588510 Length = 278 Score = 43.6 bits (98), Expect = 2e-04 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP G PPPPPP Sbjct: 91 PPPPPPPPPSSGSPPPPPPPP 111 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PPPPPP Sbjct: 91 PPPPPPPPPSSGSPPPPPPPPP 112 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 104 PPPPPPPPPPP----PPPPPPP 121 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPX---PPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 95 PPPPPSSGSPPPPPPPPPPPPPPPP 119 Score = 35.5 bits (78), Expect = 0.052 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPXP----PPPXXGGGXPPPPPP 434 PPPPP P PPP PPPPPP Sbjct: 93 PPPPPPPSSGSPPPPPPPPPPPPPPP 118 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 104 PPPPPPPPPPPPP---PPPPP 121 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +2 Query: 320 PPPXPX---PPPPXXPXXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 95 PPPPPSSGSPPPPPPPPPPPPPPP 118 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP PP PP Sbjct: 91 PPPPPPPPPSSGSPPPPPPPP 111 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PP P PP PP Sbjct: 92 PPPPPPPPSSGSPPPPPPPPP 112 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 43.2 bits (97), Expect = 3e-04 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP G PPPPPP Sbjct: 338 PPPPKGPPPPPPAKGPPPPPPP 359 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPP---PXPPPPXXGGGXPPPPPP 434 PPPP P PPPP G PPPPPP Sbjct: 346 PPPPAKGPPPPPPPKGPSPPPPPPP 370 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPX---PPPPXXGGGXPPPPPP 434 PPPPP PPPP G PPPPPP Sbjct: 345 PPPPPAKGPPPPPPPKGPSPPPPPP 369 Score = 39.5 bits (88), Expect = 0.003 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP G PPPPPP Sbjct: 362 PSPPPPPPPGGKKGGPPPPPP 382 Score = 39.1 bits (87), Expect = 0.004 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 P PPP PPP GG PPPPP Sbjct: 362 PSPPPPPPPGGKKGGPPPPPP 382 Score = 38.7 bits (86), Expect = 0.006 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP PPPPPP Sbjct: 311 PAPPPPPPPKPAAAAPPPPPP 331 Score = 38.3 bits (85), Expect = 0.007 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PPP PPP PPPPPP Sbjct: 311 PAPPPPPPPKPAAAAPPPPPPP 332 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 3/24 (12%) Frame = +3 Query: 369 PPPPPXP---PPPXXGGGXPPPPP 431 PPPPP P PPP G PPPPP Sbjct: 326 PPPPPPPKAAPPPPPPKGPPPPPP 349 Score = 36.3 bits (80), Expect = 0.030 Identities = 16/24 (66%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPPPX--PPPPXXGGGXPPPPPP 434 PPPPP PPPP G PPPPPP Sbjct: 328 PPPPPKAAPPPPPPKG--PPPPPP 349 Score = 35.5 bits (78), Expect = 0.052 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPPPXP-----PPPXXGGGXPPPPPP 434 PPPPP P PPP PPPPPP Sbjct: 315 PPPPPKPAAAAPPPPPPPKAAPPPPPP 341 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP P PP PP Sbjct: 337 PPPPPKGPPPPPPAKGPPPPP 357 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +2 Query: 320 PPPXPX---PPPPXXPXXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 317 PPPKPAAAAPPPPPPPKAAPPPPP 340 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +2 Query: 320 PPPX---PXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 347 PPPAKGPPPPPPPKGPSPPPPPPP 370 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PP P PP PP Sbjct: 328 PPPPPKAAPPPPPPKGPPPPP 348 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP PPP P PP PP Sbjct: 329 PPPPKAAPPPPPPKGPPPPPP 349 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP PPPP PP PP Sbjct: 338 PPPPKGPPPPPPAKGPPPPPP 358 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPX------PPPPXXGGGXPPPPPP 434 PPPPP PPPP GG PP P Sbjct: 366 PPPPPGGKKGGPPPPPPKGGASRPPAAP 393 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP PPPP PP PP Sbjct: 339 PPPKGPPPPPPAKGPPPPPPP 359 Score = 29.1 bits (62), Expect = 4.5 Identities = 18/66 (27%), Positives = 18/66 (27%), Gaps = 7/66 (10%) Frame = +2 Query: 206 PNPVNPXLGXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPPPXPX-------PPPPXXPXX 364 P P P PPP PPP P PPPP Sbjct: 316 PPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKG 375 Query: 365 XPPXPP 382 PP PP Sbjct: 376 GPPPPP 381 Score = 28.7 bits (61), Expect = 6.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 326 PXPXPPPPXXPXXXPPXPP 382 P P PPPP P P PP Sbjct: 311 PAPPPPPPPKPAAAAPPPP 329 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 P P PPPP PP PP Sbjct: 311 PAPPPPPPPKPAAAAPPPPP 330 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PP P PP PP Sbjct: 313 PPPPPPPKPAAAAPPPPPPP 332 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 42.3 bits (95), Expect = 5e-04 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 357 PPPPPPPPPPPPPPPRPPPPPP 378 Score = 42.3 bits (95), Expect = 5e-04 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 358 PPPPPPPPPPPPPPRPPPPPPP 379 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 353 PPPPPPPPPPPP---PPPPPPP 371 Score = 38.7 bits (86), Expect = 0.006 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PP PPP Sbjct: 354 PPPPPPPPPPPPPPPPPPRPPP 375 Score = 38.7 bits (86), Expect = 0.006 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP P PPPP Sbjct: 355 PPPPPPPPPPPPPPPPPRPPPP 376 Score = 38.7 bits (86), Expect = 0.006 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPP Sbjct: 356 PPPPPPPPPPPPPPPPRPPPPP 377 Score = 38.7 bits (86), Expect = 0.006 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP P PPPP G PPP PP Sbjct: 369 PPPRPPPPPPPIKKGAPPPAPP 390 Score = 37.5 bits (83), Expect = 0.013 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 354 PPPPPPPPPPPPPPPPPPRPP 374 Score = 37.5 bits (83), Expect = 0.013 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 357 PPPPPPPPPPPPPPPRPPPPP 377 Score = 37.5 bits (83), Expect = 0.013 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 358 PPPPPPPPPPPPPPRPPPPPP 378 Score = 37.5 bits (83), Expect = 0.013 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 359 PPPPPPPPPPPPPRPPPPPPP 379 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP P Sbjct: 353 PPPPPPPPPPPPPPPPPPPRP 373 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P P PP Sbjct: 355 PPPPPPPPPPPPPPPPPRPPP 375 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P P PP Sbjct: 356 PPPPPPPPPPPPPPPPRPPPP 376 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +2 Query: 320 PPPXPXPPPPXXP---XXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 367 PPPPPRPPPPPPPIKKGAPPPAPP 390 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 P P PPPP P PP PP Sbjct: 349 PKLMPPPPPPPPPPPPPPPPP 369 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 41.9 bits (94), Expect = 6e-04 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP GG PPPPPP Sbjct: 926 PGAPPPPPPPGKPGGPPPPPPP 947 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/24 (66%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PP--PPPXPPPPXXGGGXPPPPPP 434 PP PPP PPP GG PPPPPP Sbjct: 925 PPGAPPPPPPPGKPGGPPPPPPPP 948 Score = 32.7 bits (71), Expect = 0.37 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 387 PPPPXXGGGXPPPPPP 434 PPPP G PPPPPP Sbjct: 920 PPPPRPPGAPPPPPPP 935 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 925 PPGAPPPPPPPGKPGGPPPPP 945 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 P P PPPP P PP PP Sbjct: 926 PGAPPPPPPPGKPGGPPPPPP 946 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 11/33 (33%) Frame = +3 Query: 369 PPPPPXP-----------PPPXXGGGXPPPPPP 434 P PPP P PPP G PPPPPP Sbjct: 902 PRPPPAPSATANTASALSPPPPRPPGAPPPPPP 934 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 40.7 bits (91), Expect = 0.001 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PPPPPP Sbjct: 106 PPPPPPPPPSPPPSAPPPPPPP 127 Score = 40.7 bits (91), Expect = 0.001 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP P PPPPPP Sbjct: 107 PPPPPPPPSPPPSAPPPPPPPP 128 Score = 35.1 bits (77), Expect = 0.069 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPP PPPPPP Sbjct: 92 PPPPPPPYGVNSSQPPPPPP 111 Score = 34.7 bits (76), Expect = 0.091 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP P PP PP Sbjct: 106 PPPPPPPPPSPPPSAPPPPP 125 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 9/31 (29%) Frame = +3 Query: 369 PPPPPXPPPP-----XXGGGXP----PPPPP 434 PPPPP PPPP G G P PPPPP Sbjct: 56 PPPPPGPPPPHQPQFNFGPGPPQQQQPPPPP 86 Score = 34.3 bits (75), Expect = 0.12 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP P PP PP Sbjct: 106 PPPPPPPPPSPPPSAPPPPPP 126 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PP PPPPPP Sbjct: 92 PPPPPPPYGVNSSQPPPPPPP 112 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPPPP PPP PPPP Sbjct: 124 PPPPPTQPPPREAQLAPPPP 143 Score = 31.9 bits (69), Expect = 0.64 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P PPPPPP Sbjct: 92 PPPPPPPYGVNSSQPPPPPPPP 113 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P P PPPP GG PP PPP Sbjct: 6 PYAPHPPPPQ--GGFPPQPPP 24 Score = 31.5 bits (68), Expect = 0.85 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PPPP PPPPPP Sbjct: 76 PPQQQQPPPPPQMYYQPPPPPP 97 Score = 31.5 bits (68), Expect = 0.85 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PPP P PP P Sbjct: 109 PPPPPPSPPPSAPPPPPPPP 128 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PP P PP PP Sbjct: 107 PPPPPPPPSPPPSAPPPPPPP 127 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P P PP PP PP Sbjct: 108 PPPPPPPSPPPSAPPPPPPPP 128 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PP PPPP Sbjct: 123 PPPPPPTQPPPREAQLAPPPP 143 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPP PPP PPPPPP Sbjct: 42 PPPQGAPPPFL--APPPPPPP 60 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP PPPP P PP P Sbjct: 48 PPPFLAPPPPPPPGPPPPHQP 68 Score = 29.1 bits (62), Expect = 4.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPP 373 PPP PPPP P PP Sbjct: 116 PPPSAPPPPPPPPTQPPP 133 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPP----PXPPPPXXGGGXPPPPPP 434 PPPP P PPP G PPP P Sbjct: 11 PPPPQGGFPPQPPPMNPYGPPPPQQP 36 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PPPP PPPPPP Sbjct: 77 PQQQQPPPPPQMYYQPPPPPPP 98 Score = 28.7 bits (61), Expect = 6.0 Identities = 17/58 (29%), Positives = 17/58 (29%) Frame = +2 Query: 206 PNPVNPXLGXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPPPXPXPPPPXXPXXXPPXP 379 P P P G PPP PPP P PPP PP P Sbjct: 92 PPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPP------PPPPPTQPPPREAQLAPPPP 143 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPP PPP G PPP P Sbjct: 48 PPPFLAPPPPPPPGPPPPHQP 68 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 40.7 bits (91), Expect = 0.001 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPP Sbjct: 356 PPPPPPPPPPKLNTAPKPPPPP 377 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PPPPPP Sbjct: 357 PPPPPPPPPKLNTAPKPPPPPP 378 Score = 39.1 bits (87), Expect = 0.004 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP P PPPP Sbjct: 355 PPPPPPPPPPPKLNTAPKPPPP 376 Score = 37.9 bits (84), Expect = 0.010 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 349 PPPPPPPPPPP-----PPPPPP 365 Score = 35.9 bits (79), Expect = 0.039 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP PPPPPP Sbjct: 358 PPPPPPPPKLNTAPKPPPPPPP 379 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 718 PXXXPPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 P PPPP P A P PPPPPP Sbjct: 345 PSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPP 380 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +2 Query: 320 PPPXPXPPPP---XXPXXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 356 PPPPPPPPPPKLNTAPKPPPPPPP 379 Score = 31.5 bits (68), Expect = 0.85 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P PPPPPP Sbjct: 359 PPPPPPPKLNTAPKPPPPPPPP 380 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP Sbjct: 354 PPPPPPPPPPPPKLNTAPKPP 374 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 P P PPPP P PP PP Sbjct: 345 PSNAPPPPPPPPPPPPPPPPP 365 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 730 PPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 PPPP P P PPPPPP Sbjct: 350 PPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPP 381 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 P P PPPP PPPPP Sbjct: 345 PSNAPPPPPPPPPPPPPPPPP 365 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP--PP 434 PPPPP PPP P P PP Sbjct: 373 PPPPPPPPPSVPSNNNLPKPAEPP 396 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPXPPPPXXGGG---XPPPPPP 434 PPPPP PPPP G PPPPPP Sbjct: 544 PPPPPPPPPPPSGNKPAFSPPPPPP 568 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PPPPPP Sbjct: 602 PPPPPPPPPILPNRSVPPPPPP 623 Score = 38.7 bits (86), Expect = 0.006 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PPPPPP Sbjct: 618 PPPPPPPPPLPNHSVLPPPPPP 639 Score = 37.9 bits (84), Expect = 0.010 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPXPPPPXX----GGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 565 PPPPPPPPPPLPQSNYASSQPPPPPP 590 Score = 37.9 bits (84), Expect = 0.010 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP P PPPPPP Sbjct: 619 PPPPPPPPLPNHSVLPPPPPPP 640 Score = 37.1 bits (82), Expect = 0.017 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP P PPPPPP Sbjct: 586 PPPPPPPPLPNCLVPSPPPPPP 607 Score = 36.7 bits (81), Expect = 0.023 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP PPPP Sbjct: 634 PPPPPPPPPPSLPNRLVPPPP 654 Score = 35.9 bits (79), Expect = 0.039 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP P PPPP Sbjct: 585 PPPPPPPPPLPNCLVPSPPPP 605 Score = 35.9 bits (79), Expect = 0.039 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PPPP P Sbjct: 635 PPPPPPPPPSLPNRLVPPPPAP 656 Score = 35.1 bits (77), Expect = 0.069 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P PPPPPP Sbjct: 587 PPPPPPPLPNCLVPSPPPPPPP 608 Score = 34.7 bits (76), Expect = 0.091 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP PPPPPP Sbjct: 603 PPPPPPPPILPNRSVPPPPPPP 624 Score = 34.7 bits (76), Expect = 0.091 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P PPPPPP Sbjct: 604 PPPPPPPILPNRSVPPPPPPPP 625 Score = 34.3 bits (75), Expect = 0.12 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP G P PP Sbjct: 712 PPPPPPPPPANRSNGPSAPAPP 733 Score = 33.9 bits (74), Expect = 0.16 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +2 Query: 206 PNPVNPXLGXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPPPXPXPPPPXXPXXXPPXPP 382 P P P G K PP PPP P PP P PP PP Sbjct: 548 PPPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPP 606 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P P PP Sbjct: 634 PPPPPPPPPPSLPNRLVPPPP 654 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P PPPPPP Sbjct: 620 PPPPPPPLPNHSVLPPPPPPPP 641 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/27 (59%), Positives = 16/27 (59%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPPPXPPPP---XXGGGXP--PPPPP 434 PPPPP P PP G G P PPPPP Sbjct: 690 PPPPPPPLPPANRTNGPGVPSAPPPPP 716 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPXPPPPXXGG----GXPPPPPP 434 PPPPP PP G PPPPPP Sbjct: 692 PPPPPLPPANRTNGPGVPSAPPPPPP 717 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP P P G PPPPP Sbjct: 764 PPPPPPQAPKPPGTVPPPPP 783 Score = 33.1 bits (72), Expect = 0.28 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 8/67 (11%) Frame = +2 Query: 206 PNPVNPXLGXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPPPXPXPP--------PPXXPX 361 P P P +G K PPP PPP P PP P P Sbjct: 651 PPPPAPGIGNKFPAPPPPPPPPRSSSRTPTGAATSSKGPPPPPPPPLPPANRTNGPGVPS 710 Query: 362 XXPPXPP 382 PP PP Sbjct: 711 APPPPPP 717 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PP P PPP G P PPPP Sbjct: 747 PPAPPPPPLMTGKKAPAPPPP 767 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PPP PP G PPPPP Sbjct: 762 PAPPPPPPQAPKPPGTVPPPPP 783 Score = 31.9 bits (69), Expect = 0.64 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P PPPPPP Sbjct: 622 PPPPPLPNHSVLPPPPPPPPPP 643 Score = 31.9 bits (69), Expect = 0.64 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPP Sbjct: 634 PPPPPPPPPPSLPNRLVPPPP 654 Score = 31.9 bits (69), Expect = 0.64 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 11/33 (33%) Frame = +3 Query: 369 PPPPPX------PPPPXXGGGX-----PPPPPP 434 PPPPP PPPP G G PPPPPP Sbjct: 639 PPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPPP 671 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +2 Query: 320 PPPXPXPPPP---XXPXXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 544 PPPPPPPPPPPSGNKPAFSPPPPP 567 Score = 31.5 bits (68), Expect = 0.85 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 11/33 (33%) Frame = +3 Query: 369 PPPPPXPPPPXXGG-----------GXPPPPPP 434 P PPP PPPP G PPPPPP Sbjct: 663 PAPPPPPPPPRSSSRTPTGAATSSKGPPPPPPP 695 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP P P PP Sbjct: 602 PPPPPPPPPILPNRSVPPPP 621 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 730 PPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 PPPP P + P PPPPPP Sbjct: 665 PPPPPPPPRSSSRTPTGAATSSKGPPPPPPPP 696 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 730 PPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 PPPP P + P PPPPPP Sbjct: 689 PPPPPPPPLPPANRTNGPGVPSAPPPPPPPPP 720 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/73 (24%), Positives = 18/73 (24%) Frame = +1 Query: 607 PXPPPPXXXGGXXXXXXXXXXXXXXXXXXXXXXXXXXPXXXPPPPXPXXXXXXXXXXXXX 786 P PPPP P PPP P Sbjct: 600 PSPPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAPGIG 659 Query: 787 XXAXAPXPPPPPP 825 AP PPPPPP Sbjct: 660 NKFPAPPPPPPPP 672 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PP P PP PP Sbjct: 619 PPPPPPPPLPNHSVLPPPPPP 639 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P PPPPPP Sbjct: 621 PPPPPPLPNHSVLPPPPPPPPP 642 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP PP PP Sbjct: 602 PPPPPPPPPILPNRSVPPPPP 622 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP PP PP Sbjct: 618 PPPPPPPPPLPNHSVLPPPPP 638 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP PP PPPPP Sbjct: 747 PPAPPPPPLMTGKKAPAPPPPP 768 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P G P PP P Sbjct: 714 PPPPPPPANRSNGPSAPAPPLP 735 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +1 Query: 718 PXXXPPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 P PPP P P PPPPPP Sbjct: 539 PTAAAPPPPPPPPPPPSGNKPAFSPPPPPPPPPPPP 574 Score = 28.3 bits (60), Expect = 7.9 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 8/30 (26%) Frame = +3 Query: 369 PPPPPXP--------PPPXXGGGXPPPPPP 434 PPPPP P PPP PPPPPP Sbjct: 548 PPPPPPPSGNKPAFSPPPPPP---PPPPPP 574 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 718 PXXXPPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 P PPPP P + P PPPPPP Sbjct: 559 PAFSPPPPPPPPPPPPLPQSNYAS-SQPPPPPPPPP 593 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P P P P PP PP Sbjct: 764 PPPPPPQAPKPPGTVPPPPP 783 Score = 25.0 bits (52), Expect(2) = 2.3 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 605 PPXPPPPXPXGG 640 PP PPPP P G Sbjct: 545 PPPPPPPPPPSG 556 Score = 23.4 bits (48), Expect(2) = 2.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 602 SPPXPPPPXP 631 +PP PPPP P Sbjct: 543 APPPPPPPPP 552 >08_02_1019 - 23657175-23658047 Length = 290 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P P G GG GGGGG Sbjct: 33 GGGGGGVPKPGGGVGGGGGGGG 54 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 39.1 bits (87), Expect = 0.004 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 P PP PPPP GG PPPPP Sbjct: 621 PGAPPPPPPPGKPGGPPPPPP 641 Score = 38.7 bits (86), Expect = 0.006 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP P PPPP G PPPPPP Sbjct: 620 PPGAPPPPPPPGKPGGPPPPPP 641 Score = 34.7 bits (76), Expect = 0.091 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP G PPPPPP Sbjct: 614 PPPPPRPP-----GAPPPPPPP 630 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 620 PPGAPPPPPPPGKPGGPPPPP 640 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 P P PPPP P PP PP Sbjct: 621 PGAPPPPPPPGKPGGPPPPPP 641 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 11/33 (33%) Frame = +3 Query: 369 PPPPPX-----------PPPPXXGGGXPPPPPP 434 P PPP PPPP G PPPPPP Sbjct: 597 PRPPPAPSATANTASALPPPPPRPPGAPPPPPP 629 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 39.1 bits (87), Expect = 0.004 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPP PP Sbjct: 433 PPPPPPPPPPPLPPNMPPPLPP 454 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 425 PPPPPLPPPPPP---PPPPPPP 443 Score = 38.7 bits (86), Expect = 0.006 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PP PPP Sbjct: 434 PPPPPPPPPPLPPNMPPPLPPP 455 Score = 37.5 bits (83), Expect = 0.013 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 434 PPPPPPPPPPLPPNMPPPLPP 454 Score = 35.1 bits (77), Expect = 0.069 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P PP PPPP P Sbjct: 437 PPPPPPPLPPNMPPPLPPPPEP 458 Score = 34.7 bits (76), Expect = 0.091 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP P PPPP Sbjct: 435 PPPPPPPPPLPPNMPPPLPPPP 456 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP P Sbjct: 425 PPPPPLPPPPPPPPPPPPPLP 445 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 427 PPPLP-PPPPPPPPPPPPLPP 446 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP P Sbjct: 433 PPPPPPPPPPPLPPNMPPPLP 453 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PPP PPPP PP PP Sbjct: 429 PLPPPPPPPPPPPPPLPPNMPP 450 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP P P PP Sbjct: 431 PPPPPPPPPPPPPLPPNMPP 450 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P P PP P PP P Sbjct: 437 PPPPPPPLPPNMPPPLPPPP 456 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 P P P PPPP P PP P Sbjct: 429 PLPPPPPPPPPPPPPLPPNMP 449 >01_01_0796 + 6190931-6192745 Length = 604 Score = 29.1 bits (62), Expect(2) = 0.004 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 193 PPPPPPPPPP 202 Score = 29.1 bits (62), Expect(2) = 0.036 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 194 PPPPPPPPPP 203 Score = 29.1 bits (62), Expect(2) = 0.004 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 381 PXPPPPXXGGGXPPPPPP 434 P PPP PPPPPP Sbjct: 226 PVAPPPFVADQPPPPPPP 243 Score = 27.9 bits (59), Expect(2) = 0.50 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 320 PPPXPXPPPPXXP 358 PPP P PPPP P Sbjct: 193 PPPPPPPPPPPQP 205 Score = 25.8 bits (54), Expect(2) = 1.4 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PP P Sbjct: 196 PPPPPPPPQP 205 Score = 25.8 bits (54), Expect(2) = 0.036 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PP P PPP Sbjct: 237 PPPPPPPAAGGSLWIPELPPP 257 Score = 23.4 bits (48), Expect(2) = 1.4 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPP 431 P PPP PPPPP Sbjct: 226 PVAPPPFVADQPPPPPPP 243 Score = 23.0 bits (47), Expect(2) = 0.50 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +2 Query: 332 PXPPPPXXPXXXPPXPP 382 P PPP PP PP Sbjct: 226 PVAPPPFVADQPPPPPP 242 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 38.7 bits (86), Expect = 0.006 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P PP PPPPPP Sbjct: 73 PPPPPAPRPPRRHHRIPPPPPP 94 Score = 33.1 bits (72), Expect = 0.28 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP P P PPPPP Sbjct: 57 PPPPPLPTPTVTTPTPPPPPP 77 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P P PPPPPP Sbjct: 57 PPPPPLPTPTVTTPTPPPPPP 77 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P P PP PP PP Sbjct: 73 PPPPPAPRPPRRHHRIPPPPP 93 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P PPPP P Sbjct: 99 PPPPPASISPTPAPPLPPPPAP 120 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PP PP P P PPPP Sbjct: 54 PDSPPPPPLPTPTVTTPTPPPP 75 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPX----PPPPXXGGGXPPPPPP 434 PPPPP PPPP P PP P Sbjct: 90 PPPPPLLPTPPPPPASISPTPAPPLP 115 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 38 PPPPPPPPPPPP---PPPPPPP 56 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 38 PPPPPPPPPP--PPPPPPPPP 56 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPP 425 PPPPP PPPP P P Sbjct: 46 PPPPPPPPPPPLEVVSPSP 64 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PP P PPPP P PP PP Sbjct: 116 PPRPPPPPPPHPPEDPPPHPP 136 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P P PP P PP PP Sbjct: 119 PPPPPPPHPPEDPPPHPPHPP 139 Score = 32.7 bits (71), Expect = 0.37 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PP PP PPPP PP PP Sbjct: 116 PPRPPPPPPPHPPEDPPPHPP 136 Score = 32.3 bits (70), Expect(2) = 0.007 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PP P PPPP PPP PP Sbjct: 116 PPRPPPPPPPHPPEDPPPHPP 136 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP P PP PP PP Sbjct: 119 PPPPPPPHPPEDPPPHPPHPP 139 Score = 31.9 bits (69), Expect = 0.64 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPPPXPPP-----PXXGGGXPPPPPP 434 PPPPP PP P PPPPPP Sbjct: 121 PPPPPHPPEDPPPHPPHPPDHPPPPPP 147 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PP P P PP P PP PP Sbjct: 127 PPEDPPPHPPHPPDHPPPPPP 147 Score = 29.1 bits (62), Expect(2) = 0.65 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PP P PP PP Sbjct: 119 PPPPPPPHPPEDPPPHPPHPP 139 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PP PP PPP PPPP Sbjct: 135 PPHPPDHPPPPPPCRVPPPP 154 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PP P P PPPPPP Sbjct: 68 PAPPTPSPVPEHLHHHPPPPPP 89 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PPP PPP P PP P Sbjct: 117 PRPPPPPPPHPPEDPPPHPPHP 138 Score = 25.0 bits (52), Expect(2) = 0.007 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PP P Sbjct: 85 PPPPPVPPCP 94 Score = 21.4 bits (43), Expect(2) = 0.65 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPP P PP Sbjct: 86 PPPPVPPCPP 95 >09_06_0125 - 21011757-21012428 Length = 223 Score = 37.9 bits (84), Expect = 0.010 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP P PPPP PPPPPP Sbjct: 167 PPPSPPPPPPRAPFLAPPPPPP 188 Score = 37.5 bits (83), Expect = 0.013 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 167 PPPSPPPPPPRAPFLAPPPPP 187 >01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827, 8960964-8961054,8961877-8961937,8962172-8962216, 8962318-8962391,8962565-8962637,8963288-8963345, 8963398-8963468,8963801-8963837,8964040-8964128, 8964207-8964263,8964366-8964449,8964529-8964627, 8964765-8964869,8965145-8965216,8965308-8965497, 8965810-8966207 Length = 744 Score = 34.3 bits (75), Expect(2) = 0.012 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 P PPP PPPP G PPP Sbjct: 80 PSPPPPPPPPPTNGTLTPPP 99 Score = 33.1 bits (72), Expect = 0.28 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PP PP PPPP G PPP Sbjct: 79 PPSPPPPPPPPPTNGTLTPPP 99 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP P PPP PPPPPP Sbjct: 75 PPPTPPSPPP------PPPPPP 90 Score = 22.2 bits (45), Expect(2) = 0.012 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 408 GGXPPPPPP 434 GG PPPPP Sbjct: 125 GGRAPPPPP 133 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 37.5 bits (83), Expect = 0.013 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP PPPP PPPPPP Sbjct: 1164 PPPATPPPPPPLSPSLPPPPPP 1185 Score = 35.9 bits (79), Expect = 0.039 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP P PPPP PPPPPP Sbjct: 1165 PPATPPPPPPLSPSLPPPPPPP 1186 Score = 34.3 bits (75), Expect = 0.12 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PP P PPPP P PP PP Sbjct: 1165 PPATPPPPPPLSPSLPPPPPP 1185 Score = 34.3 bits (75), Expect = 0.12 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPPP G P P PP Sbjct: 1180 PPPPPPPPLPSGPPPQPAPP 1199 Score = 32.7 bits (71), Expect = 0.37 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP G PP P P Sbjct: 1177 PSLPPPPPPPPLPSGPPPQPAP 1198 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PP P P PPP Sbjct: 1180 PPPPPPPPLPSGPPPQPAPPP 1200 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPP G P PPP Sbjct: 1180 PPPPPPPPLPSGPPPQPAPPP 1200 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP PPP PPPPPP Sbjct: 1158 PPLPPSPPP-----ATPPPPPP 1174 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP PPPP PP PP Sbjct: 1164 PPPATPPPPPPLSPSLPPPPP 1184 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +3 Query: 369 PPPPPXPPP-PXXGGGXPPPPPP 434 PPP P PPP P PPPP P Sbjct: 1192 PPPQPAPPPLPIQPPPIPPPPVP 1214 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PP P P P PP Sbjct: 1180 PPPPPPPPLPSGPPPQPAPPP 1200 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +2 Query: 320 PPPXPXPPP-PXXPXXXPPXP 379 PPP P PPP P P PP P Sbjct: 1192 PPPQPAPPPLPIQPPPIPPPP 1212 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPXP--PPPXXGGGXP--PPPPP 434 PPPPP P PPP P PP PP Sbjct: 1137 PPPPPLPEGPPPLPSDSPPCQPPLPP 1162 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = +2 Query: 320 PPPXPX--PPPPXXPXXXPPXP 379 PPP P PPPP P PP P Sbjct: 1129 PPPLPLDAPPPPPLPEGPPPLP 1150 Score = 28.7 bits (61), Expect = 6.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 326 PXPXPPPPXXPXXXPPXPP 382 P P P PP P PP PP Sbjct: 1192 PPPQPAPPPLPIQPPPIPP 1210 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PP P PPP PPPP P Sbjct: 1123 PPLPDGPPPLPLDAPPPPPLP 1143 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPP P PP P Sbjct: 1158 PPLPPSPPPATPPPPPPLSP 1177 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PPP P P P Sbjct: 1198 PPPLPIQPPPIPPPPVPSSP 1217 >07_03_1382 - 26170563-26170631,26171151-26171843 Length = 253 Score = 37.5 bits (83), Expect = 0.013 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P PPPPPP Sbjct: 184 PPPPPPPQPSGDANENPPPPPP 205 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P PPPPPP Sbjct: 185 PPPPPPQPSGDANENPPPPPPP 206 >07_03_0890 - 22332768-22333382 Length = 204 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPXPPPP----XXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 84 PPPPPPPPPPERAVPEAADTPPPPPP 109 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPXPPP----PXXGGGXPPPPPP 434 PPPPP PPP P PPPPPP Sbjct: 85 PPPPPPPPPERAVPEAADTPPPPPPP 110 Score = 31.5 bits (68), Expect = 0.85 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPX---PPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 75 PPPPPAEATPPPP------PPPPPP 93 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 2/23 (8%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPP--PPP 434 PPPP PPPP G PPP PPP Sbjct: 1931 PPPPPPPPPVEGKPKPPPHAPPP 1953 Score = 35.5 bits (78), Expect = 0.052 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPXPPP----PXXGGGXPPPPPP 434 PPPPP PPP P PPPPPP Sbjct: 1931 PPPPPPPPPVEGKPKPPPHAPPPPPP 1956 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = +3 Query: 369 PPP--PPXPPPPXXGGGXPPPPP 431 PPP PP PPPP G P PPP Sbjct: 1926 PPPHAPPPPPPPPPVEGKPKPPP 1948 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PP P PPPP P P PP Sbjct: 1927 PPHAPPPPPPPPPVEGKPKPP 1947 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 4/25 (16%) Frame = +2 Query: 320 PPPXPXPPP----PXXPXXXPPXPP 382 PPP P PPP P P PP PP Sbjct: 1931 PPPPPPPPPVEGKPKPPPHAPPPPP 1955 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPP PPPPPP Sbjct: 1926 PPPHAPPP------PPPPPP 1939 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP P PPPP P PPP Sbjct: 1927 PPHAPPPPPPPPPVEGKPKPPP 1948 >05_01_0380 + 2978256-2979284 Length = 342 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 26 PPPPPPPPPP------PPPPPP 41 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P P P Sbjct: 31 PPPPPPPPPPPRPFSRKPSEP 51 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPPPP PPPP P P Sbjct: 32 PPPPPPPPPPRPFSRKPSEP 51 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PPPP P PP P Sbjct: 26 PPPPPPPPPP--PPPPPPRP 43 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP P P Sbjct: 31 PPPPPPPPPPPRPFSRKPSEP 51 >01_01_0046 - 331758-332627 Length = 289 Score = 37.1 bits (82), Expect = 0.017 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PP PP Sbjct: 22 PPPPPPPPPPPSSSRYRPPSPP 43 Score = 34.3 bits (75), Expect = 0.12 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP PP PP Sbjct: 23 PPPPPPPPPPSSSRYRPPSPP 43 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PP P Sbjct: 21 PPPPPPPPPPPPSSSRYRPPSP 42 >08_02_1256 + 25645085-25645396 Length = 103 Score = 36.7 bits (81), Expect = 0.023 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 61 PPPPPPPPPLP--SPPPPPPP 79 Score = 31.9 bits (69), Expect = 0.64 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 326 PXPXPPPPXXPXXXPPXPP 382 P P PPPP P PP PP Sbjct: 61 PPPPPPPPPLPSPPPPPPP 79 >08_01_0546 - 4746118-4746580,4747335-4747342 Length = 156 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 74 GGGGGGGGEGGGGGGGGGGGGG 95 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 75 GGGGGGGEGGGGGGGGGGGGGG 96 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 76 GGGGGGEGGGGGGGGGGGGGGG 97 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 75 GGGGGGGEGGGGGGGGGGGGG 95 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 76 GGGGGGEGGGGGGGGGGGGGG 96 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 77 GGGGGEGGGGGGGGGGGGGGG 97 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 74 GGGGGGGGEGGGGGGGGGGG 93 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 74 GGGGGGGGEGGGGGGGGGGGG 94 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GGGG GGG G Sbjct: 175 GGGGGGGPGRAPGGGGGGGGPG 196 Score = 36.7 bits (81), Expect = 0.023 Identities = 16/23 (69%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPP-PXXGGGGXGGGGG 368 GG GG PP P GGGG GGGGG Sbjct: 339 GGAGGVFPPTPDLGGGGGGGGGG 361 Score = 35.9 bits (79), Expect = 0.039 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GGGG GGG G Sbjct: 188 GGGGGGGPGRAPGGGGGGGGLG 209 Score = 35.1 bits (77), Expect = 0.069 Identities = 16/24 (66%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXG--GGGXGGGGG 368 GGGGGG P G GGG GGGGG Sbjct: 303 GGGGGGHGAPELGFSGGGGGGGGG 326 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG P GGG GGGG Sbjct: 174 GGGGGGGGPGRAPGGGGGGGG 194 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG P GGG GGGG Sbjct: 187 GGGGGGGGPGRAPGGGGGGGG 207 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGG 377 GGGGG PP GGGG GG Sbjct: 125 GGGGGARPPAPGGGGGGG 142 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 3/25 (12%) Frame = -3 Query: 433 GGGGGGX---PPPXXGGGGXGGGGG 368 GGGGGG P GGGG GGGGG Sbjct: 189 GGGGGGPGRAPGGGGGGGGLGGGGG 213 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 GGGGGG PP G G GGG Sbjct: 110 GGGGGGGPPSLPPGAGGGGG 129 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 6/28 (21%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXG------GGGG 368 GGGGG PP GGGG G GGGG Sbjct: 125 GGGGGARPPAPGGGGGGGAPRRVLGGGG 152 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGX--PPPXXGGGGXGGGGG 368 GGGGGG P GGGG GG GG Sbjct: 376 GGGGGGMLDKPDEAGGGGGGGSGG 399 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGG 377 GGGGGG P GGGG GG Sbjct: 137 GGGGGGAPRRVLGGGGGGG 155 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 GGG GG P GGGG GGG Sbjct: 211 GGGEGGAPERVIGGGGGGGG 230 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 GGGGGG GGGG GGG Sbjct: 265 GGGGGGGTDRNKGGGGGGGG 284 Score = 31.9 bits (69), Expect = 0.64 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 4/24 (16%) Frame = -3 Query: 427 GGGGXPPPXXGGG----GXGGGGG 368 GGGG P P GGG G GGGGG Sbjct: 93 GGGGAPGPLGGGGARPPGGGGGGG 116 Score = 31.9 bits (69), Expect = 0.64 Identities = 18/32 (56%), Positives = 18/32 (56%), Gaps = 10/32 (31%) Frame = -3 Query: 433 GGGGGGXP--PPXXGGGGX--------GGGGG 368 GGGGGG P PP GGGG GGGGG Sbjct: 111 GGGGGGPPSLPPGAGGGGGARPPAPGGGGGGG 142 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 GGGGGG P GGG GGG Sbjct: 136 GGGGGGGAPRRVLGGGGGGG 155 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGG GGGG Sbjct: 264 GGGGGGGGTDRNKGGGGGGGG 284 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 210 GGGGEGGAPERVIGGGGGGGG 230 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 GGGGGG GGGG GGG Sbjct: 225 GGGGGGALKCVVGGGGGGGG 244 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGG GGGG Sbjct: 224 GGGGGGGALKCVVGGGGGGGG 244 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGG 371 GGGGG PP G GGGG Sbjct: 110 GGGGGGGPPSLPPGAGGGGG 129 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGGG Sbjct: 390 GGGGGG----GSGGGGGGGGG 406 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 7/28 (25%) Frame = -3 Query: 430 GGGGGXPPPXXGGG-------GXGGGGG 368 GGGG PP GGG G GGGGG Sbjct: 102 GGGGARPPGGGGGGGPPSLPPGAGGGGG 129 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 162 GGGRGGALGRPPGGGGGGGGPG 183 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 5/27 (18%) Frame = -3 Query: 433 GGGGGGX-----PPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 279 GGGGGGALENAREDGAEGGGGGGGGGG 305 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 193 GGPGRAPGGGGGGGGLGGGGG 213 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGG 374 GGGGG GGGG GGG Sbjct: 253 GGGGGALECEIGGGGGGGG 271 Score = 28.3 bits (60), Expect = 7.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 5/26 (19%) Frame = -3 Query: 433 GGGGGG-----XPPPXXGGGGXGGGG 371 GGGGGG P GGG GGGG Sbjct: 356 GGGGGGTKVRVCAPKDISGGGGGGGG 381 >06_03_0696 + 23617687-23617851,23618838-23619536 Length = 287 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 4/25 (16%) Frame = +3 Query: 369 PPPPPXPPPPXXGG----GXPPPPP 431 PPPPP PPPP G PPPPP Sbjct: 78 PPPPPPPPPPSPPATHDVGQPPPPP 102 Score = 35.9 bits (79), Expect = 0.039 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P PP PPPPP Sbjct: 81 PPPPPPPSPPATHDVGQPPPPP 102 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 5/26 (19%) Frame = +2 Query: 320 PPPXPXPPPPXXP-----XXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 77 PPPPPPPPPPPSPPATHDVGQPPPPP 102 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 36.7 bits (81), Expect = 0.023 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PP PP PPPP PPPPP Sbjct: 49 PPRPPPPPPPPTQPAPPPPPP 69 Score = 35.9 bits (79), Expect = 0.039 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PP P PPPP PPPPPP Sbjct: 49 PPRPPPPPPPPTQPAPPPPPP 69 Score = 33.1 bits (72), Expect = 0.28 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP P PPPP Sbjct: 47 PSPPRPPPPPPPPTQPAPPPP 67 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP PPPPP Sbjct: 47 PSPPRPPPPPPPPTQPAPPPPP 68 Score = 31.5 bits (68), Expect = 0.85 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 49 PPRPPPPPPPPTQPAPPPPP 68 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 P P P PPPP P PP P Sbjct: 50 PRPPPPPPPPTQPAPPPPPP 69 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 49 PPRPPPPPPPPTQPAPPPPPP 69 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPP P PPPPPP Sbjct: 38 PPPPARHRAPSPPRPPPPPPPP 59 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 P P PPPP P P PP Sbjct: 47 PSPPRPPPPPPPPTQPAPPP 66 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 36.7 bits (81), Expect = 0.023 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P P G G PPPPP Sbjct: 333 PPPPAPSPSAAGAGSGPPPPP 353 Score = 36.7 bits (81), Expect = 0.023 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP P P G G PPPPPP Sbjct: 334 PPPAPSPSAAGAGSGPPPPPPP 355 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 3/24 (12%) Frame = +3 Query: 372 PPPPXPPPPXXGGG---XPPPPPP 434 PPPP P PP G G PPPPP Sbjct: 302 PPPPHPLPPGAGAGAGTGAPPPPP 325 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 4/24 (16%) Frame = +3 Query: 369 PPPPPXPP----PPXXGGGXPPPP 428 PPPPP P PP G G PPPP Sbjct: 351 PPPPPAAPAAPRPPGPGPGPPPPP 374 Score = 32.7 bits (71), Expect = 0.37 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 P PPP P GGG PPPP Sbjct: 368 PGPPPPPGAAGRGGGGPPPP 387 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP P PP G G PPPP Sbjct: 303 PPPHPLPPGAGAGAGTGAPPPP 324 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPP P P G P PPPP Sbjct: 352 PPPPAAPAAPRPPGPGPGPPPP 373 Score = 31.9 bits (69), Expect = 0.64 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPXPPPP----XXGGGXPPPPPP 434 PPPPP P P G G PPPPP Sbjct: 349 PPPPPPPAAPAAPRPPGPGPGPPPPP 374 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPP PP Sbjct: 276 PPPPAGPPPPA-----PPPLPP 292 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPPPXPPPPXX-----GGGXPPPPPP 434 P P P PPPP GGG PPP P Sbjct: 364 PGPGPGPPPPPGAAGRGGGGPPPPALP 390 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +3 Query: 369 PPPPPXPPPPXXGG---GXPPPPP 431 PPPP PP G G PPPPP Sbjct: 302 PPPPHPLPPGAGAGAGTGAPPPPP 325 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 P PPP PP G PPPP Sbjct: 285 PAPPPLPPSHHHHHGHHPPPP 305 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPXPPPP---XXGGGXPPPPPP 434 PPP P P PP G PPPP P Sbjct: 283 PPPAPPPLPPSHHHHHGHHPPPPHP 307 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGG 371 G G PPP G G GGGG Sbjct: 365 GPGPGPPPPPGAAGRGGGG 383 >03_06_0427 - 33857008-33857137,33857224-33857258,33857966-33858046, 33858213-33858338,33858410-33858568,33858797-33858934, 33859084-33859155,33859359-33860273 Length = 551 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 42 GGGGGGGGGSGGGGGGGGGGGG 63 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 43 GGGGGGGGSGGGGGGGGGGGGG 64 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 44 GGGGGGGSGGGGGGGGGGGGGG 65 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 40 GGGGGGGGGGGSGGGGGGGGGG 61 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 41 GGGGGGGGGGSGGGGGGGGGGG 62 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 45 GGGGGGSGGGGGGGGGGGGGGG 66 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGGG Sbjct: 60 GGGGGGGSGGGCGGGGGGGGG 80 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 55 GGGGGGGGGGGGSGGGCGGGGG 76 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGGG Sbjct: 58 GGGGGGGGGSGGGCGGGGGGGG 79 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 59 GGGGGGGGSGGGCGGGGGGGGG 80 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 56 GGGGGGGGGGGSGGGCGGGGGG 77 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGGGG Sbjct: 57 GGGGGGGGGGSGGGCGGGGGGG 78 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 41 GGGGGGGGGGSGGGGGGGGGG 61 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 42 GGGGGGGGGSGGGGGGGGGGG 62 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 44 GGGGGGGSGGGGGGGGGGGGG 64 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 45 GGGGGGSGGGGGGGGGGGGGG 65 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 46 GGGGGSGGGGGGGGGGGGGGG 66 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGG G Sbjct: 47 GGGGSGGGGGGGGGGGGGGGSG 68 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GG GG Sbjct: 48 GGGSGGGGGGGGGGGGGGGSGG 69 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG G GGG Sbjct: 49 GGSGGGGGGGGGGGGGGGSGGG 70 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGG Sbjct: 65 GGSGGGCGGGGGGGGGSSGGGG 86 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GG GG Sbjct: 52 GGGGGGGGGGGGGGGSGGGCGG 73 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G G GGG Sbjct: 53 GGGGGGGGGGGGGGSGGGCGGG 74 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGG Sbjct: 54 GGGGGGGGGGGGGSGGGCGGGG 75 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 40 GGGGGGGGGGGSGGGGGGGGG 60 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 43 GGGGGGGGSGGGGGGGGGGGG 63 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GG Sbjct: 49 GGSGGGGGGGGGGGGGGGSGG 69 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 50 GSGGGGGGGGGGGGGGGSGGG 70 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GG G G GGG Sbjct: 54 GGGGGGGGGGGGGSGGGCGGG 74 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 56 GGGGGGGGGGGSGGGCGGGGG 76 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGG 322 GG GG G GGGG G GG Sbjct: 61 GGGGGGSGGGCGGGGGGGGG 80 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 65 GGSGGGCGGGGGGGGGSSGGG 85 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 57 GGGGGGGGGGSGGGCGGGGGG 77 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 60 GGGGGGGSGGGCGGGGGGGGG 80 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GG G Sbjct: 62 GGGGGSGGGCGGGGGGGGGSSG 83 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG G GG Sbjct: 63 GGGGSGGGCGGGGGGGGGSSGG 84 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG Sbjct: 64 GGGSGGGCGGGGGGGGGSSGGG 85 >03_02_0514 + 9038606-9039790,9040211-9040432,9040548-9040655, 9041608-9041802,9041905-9042153,9042525-9042672, 9042673-9042779,9043311-9043475,9044506-9045948 Length = 1273 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 100 GGGGGGWGAGGGGGGGGGGGGG 121 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 101 GGGGGWGAGGGGGGGGGGGGGG 122 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 101 GGGGGWGAGGGGGGGGGGGGG 121 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGG P GGGG G GGG Sbjct: 90 GFGGGAGGPLGGGGGGWGAGGG 111 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 89 GGFGGGAGGPLGGGGGGWGAGG 110 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/22 (63%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -3 Query: 430 GGGGGXPPPXXGGG-GXGGGGG 368 GGG G P GGG G GGGGG Sbjct: 92 GGGAGGPLGGGGGGWGAGGGGG 113 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 89 GGFGGGAGGPLGGGGGGWGAG 109 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 100 GGGGGGWGAGGGGGGGGGGGG 120 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 102 GGGGWGAGGGGGGGGGGGGGG 122 >12_02_1219 + 27096477-27096590,27096704-27097078 Length = 162 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 90 GGGGGGGYGQRGGGGGYGGGGG 111 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGG G Sbjct: 129 GGGGGYGGGRGGGGGYGGGYG 149 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 101 GGGGGY----GGGGGYGGGGG 117 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGG G Sbjct: 114 GGGGGGYGQRREGGYGGGGGYG 135 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 91 GGGGGGYGQRGGGGGYGGGGG 111 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 90 GGGGGGGYGQRGGGGGYGGGG 110 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXGGG-GXGGGGG 368 GGGGGG GGG G GGG G Sbjct: 91 GGGGGGYGQRGGGGGYGGGGGYG 113 >12_02_1114 - 26171876-26172493 Length = 205 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGG 84 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 64 GGGGGGGGGGGGGGGGGGGGGG 85 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 65 GGGGGGGGGGGGGGGGGGGGGG 86 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 66 GGGGGGGGGGGGGGGGGGGGGG 87 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 61 GSGGGGGGGGGGGGGGGGGGGG 82 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 63 GGGGGGGGGGGGGGGGGGGGG 83 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 64 GGGGGGGGGGGGGGGGGGGGG 84 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 65 GGGGGGGGGGGGGGGGGGGGG 85 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 66 GGGGGGGGGGGGGGGGGGGGG 86 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 67 GGGGGGGGGGGGGGGGGGGGG 87 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GGGG GGGGG Sbjct: 57 GGGSGSGGGGGGGGGGGGGGG 77 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 57 GGGSGSGGGGGGGGGGGGGGG 77 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 58 GGSGSGGGGGGGGGGGGGGGG 78 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 61 GSGGGGGGGGGGGGGGGGGGG 81 >10_08_0553 - 18720436-18720494,18721102-18721106,18721136-18721257, 18721390-18721478,18722136-18722316,18722403-18722654, 18722755-18722993,18723680-18723914,18724072-18724132, 18724632-18724987 Length = 532 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 19 GGGGGGGGGRGNGGGGFGGGGG 40 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 20 GGGGGGGGRGNGGGGFGGGGGG 41 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGGGG Sbjct: 21 GGGGGGGRGNGGGGFGGGGGGG 42 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGGG Sbjct: 22 GGGGGGRGNGGGGFGGGGGGGG 43 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G GGGG GGGG Sbjct: 24 GGGGRGNGGGGFGGGGGGGGG 44 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG G GGG Sbjct: 17 GGGGGGGGGGGRGNGGGGFGGG 38 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGG Sbjct: 18 GGGGGGGGGGRGNGGGGFGGGG 39 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G G GG G GGG Sbjct: 18 GGGGGGGGGGRGNGGGGFGGG 38 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 20 GGGGGGGGRGNGGGGFGGGGG 40 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 21 GGGGGGGRGNGGGGFGGGGGG 41 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGG 371 GGGGG GG G GGGG Sbjct: 15 GGGGGGGGGGGGGRGNGGGG 34 >09_06_0283 + 22024779-22026134,22026181-22026714 Length = 629 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 26 GGGGGGGGGGGGGGGGGGGGGG 47 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 27 GGGGGGGGGGGGGGGGGGGGGG 48 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 28 GGGGGGGGGGGGGGGGGGGGGG 49 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 29 GGGGGGGGGGGGGGGGGGGGGG 50 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 30 GGGGGGGGGGGGGGGGGGGGGG 51 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 26 GGGGGGGGGGGGGGGGGGGGG 46 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 27 GGGGGGGGGGGGGGGGGGGGG 47 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 28 GGGGGGGGGGGGGGGGGGGGG 48 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 29 GGGGGGGGGGGGGGGGGGGGG 49 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 30 GGGGGGGGGGGGGGGGGGGGG 50 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 31 GGGGGGGGGGGGGGGGGGGGG 51 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 23 GFLGGGGGGGGGGGGGGGGGG 43 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 36.3 bits (80), Expect = 0.030 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP P PPPPP Sbjct: 221 PPPPPPPPSPHRHPAAHPPPPP 242 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PP PPP Sbjct: 150 PPPPPPPPPH----APPGPPP 166 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 P PPPP PPPPPP Sbjct: 136 PGQEPPPPHVPKAAPPPPPP 155 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P P P P PP PP Sbjct: 222 PPPPPPPSPHRHPAAHPPPPP 242 Score = 29.5 bits (63), Expect = 3.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPP 373 PP P PPPP P PP Sbjct: 150 PPPPPPPPPHAPPGPPP 166 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 7/29 (24%) Frame = +3 Query: 369 PPPPPXP-------PPPXXGGGXPPPPPP 434 PPPPP P PPP P PPPP Sbjct: 224 PPPPPSPHRHPAAHPPPPPHHPAPRPPPP 252 Score = 28.7 bits (61), Expect = 6.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 326 PXPXPPPPXXPXXXPPXPP 382 P PPPP P PP PP Sbjct: 136 PGQEPPPPHVPKAAPPPPP 154 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 6/27 (22%) Frame = +3 Query: 369 PPPP------PXPPPPXXGGGXPPPPP 431 PPPP P PPPP P PPP Sbjct: 140 PPPPHVPKAAPPPPPPPPPHAPPGPPP 166 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 P PPPP P PP PP Sbjct: 146 PKAAPPPPPPPPPHAPPGPP 165 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 36.3 bits (80), Expect = 0.030 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PPP P PP PPPPPP Sbjct: 583 PVPPPEPSPPPAPKAAPPPPPP 604 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPP-----PPXPPPPXXGGGXPPPPPP 434 PPP PP PPP G G P PPPP Sbjct: 591 PPPAPKAAPPPPPPKSTGPGPPRPPPP 617 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 P P P P PP P PP PP Sbjct: 583 PVPPPEPSPPPAPKAAPPPPP 603 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PP PPP G PPPP Sbjct: 609 PGPPRPPPPAMPGSSKTRPPPP 630 >07_03_0177 - 14770777-14772045 Length = 422 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 69 GGGGGGGGGGFGGGGGFGGGGG 90 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 86 GGGGGGGLGGGGGGGLGGGGG 106 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGG Sbjct: 68 GGGGGGGGGGGFGGGGGFGGGG 89 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 70 GGGGGGGGGFGGGGGFGGGGG 90 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 86 GGGGGGGLGGGGGGGLGGGGG 106 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 362 GGGGGLGGGGGGGGGGFGGGGG 383 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 368 GGGGGGGGGGFGGGGGSGIGGG 389 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 369 GGGGGGGGGFGGGGGSGIGGG 389 Score = 31.9 bits (69), Expect = 0.64 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 70 GGGGGGGGGFGGGGGFGGGGGG 91 Score = 31.9 bits (69), Expect = 0.64 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGGGG Sbjct: 71 GGGGGGGGFGGGGGFGGGGGGG 92 Score = 31.9 bits (69), Expect = 0.64 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 77 GGFGGGGGFGGGGGGGLGGGGG 98 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GGGG GGGGG Sbjct: 186 GGGFGKSGGLGGGGGLGGGGG 206 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GGGG GGGGG Sbjct: 58 GGGYGKGGGFGGGGGGGGGGG 78 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GGGG GGGGG Sbjct: 218 GGGFGKGGGLGGGGGLGGGGG 238 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GGGG GGGGG Sbjct: 294 GGGFGKGGGLGGGGGLGGGGG 314 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GGGG GGGGG Sbjct: 352 GGGFGKGGGLGGGGGLGGGGG 372 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GG G GGGGG Sbjct: 80 GGGGGFGGGGGGGLGGGGGGG 100 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 362 GGGGGLGGGGGGGGGGFGGG 381 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGG GGGG Sbjct: 86 GGGGGGGLGGGGGGGLGGGGG 106 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 94 GGGGGGG---LGGGGGFGKGGG 112 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGG G Sbjct: 370 GGGGGGGGFGGGGGSGIGGGFG 391 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGG GGGG GGGGG Sbjct: 56 GLGGGYGKGGGFGGGGGGGGGG 77 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 62 GKGGGFGGGGGGGGGGGFGGG 82 Score = 29.1 bits (62), Expect = 4.5 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXFXFXPKXGFTGFG 205 GG GG G GGG G GGG GGG K G GFG Sbjct: 68 GGGGGGGGGGGFGGGGGFGGGGGGGLGGGGGGGLGGGGGFGKGGGVGGGFGKGG--GFG 124 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG G G GGGG GGGGG Sbjct: 394 GGFGFGVGGGGFGGGGGGGGGG 415 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 399 GVGGGGF---GGGGGGGGGGGG 417 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 58 GGGYGKGGGFGGGGGGGGGGG 78 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 64 GGGFGGGGGGGGGGGFGGGGG 84 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGG G Sbjct: 73 GGGGGGFGGGGGFGGGGGGGLG 94 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GG GG Sbjct: 74 GGGGGFGGGGGFGGGGGGGLGG 95 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG G GGG Sbjct: 75 GGGGFGGGGGFGGGGGGGLGGG 96 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GG GG Sbjct: 82 GGGFGGGGGGGLGGGGGGGLGG 103 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGG G Sbjct: 87 GGGGGGLGGGGGGGLGGGGGFG 108 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 186 GGGFGKSGGLGGGGGLGGGGG 206 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 218 GGGFGKGGGLGGGGGLGGGGG 238 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 294 GGGFGKGGGLGGGGGLGGGGG 314 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 352 GGGFGKGGGLGGGGGLGGGGG 372 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 362 GGGGGLGGGGGGGGGGFGGGG 382 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GG G GGG G Sbjct: 155 GGLGGGIGPGIGGGYGKGGGLG 176 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 196 GGGGGLGGGGGLGGGIGKGGG 216 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 228 GGGGGLGGGGGLGGGIGKGGG 248 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 304 GGGGGLGGGGGLGGGSGLGGG 324 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 310 GGGGGLGGGSGLGGGIGKGGG 330 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 358 GGGLGGGGGLGGGGGGGGGGFG 379 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GG GG Sbjct: 359 GGLGGGGGLGGGGGGGGGGFGG 380 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG G GGG Sbjct: 360 GLGGGGGLGGGGGGGGGGFGGG 381 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 363 GGGGLGGGGGGGGGGFGGGGG 383 >06_03_1326 - 29355467-29355817 Length = 116 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 7 GGGGGGKGGGGGGGGGKGGGGG 28 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 5 GGGGGGGGKGGGGGGGGGKGGG 26 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGG Sbjct: 6 GGGGGGGKGGGGGGGGGKGGGG 27 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 6 GGGGGGGKGGGGGGGGGKGGG 26 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 8 GGGGGKGGGGGGGGGKGGGGG 28 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGG 371 GGGGG GGGG GGGG Sbjct: 14 GGGGGGGGGKGGGGGSGGGG 33 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG GGGG GGGG Sbjct: 24 GGGGGSGGGGRSGGGGGGGGG 44 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GGGGG Sbjct: 24 GGGGGSGGGGRSGGGGGGGGG 44 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GG GG Sbjct: 26 GGGSGGGGRSGGGGGGGGGKGG 47 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG G GGG Sbjct: 27 GGSGGGGRSGGGGGGGGGKGGG 48 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GG GGG GGGG GGGG Sbjct: 2 GGKGGGGGGGGKGGGGGGGGG 22 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGG Sbjct: 12 GKGGGGGGGGGKGGGGGSGGGG 33 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGG Sbjct: 18 GGGGGKGGGGGSGGGGRSGGGG 39 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGG G Sbjct: 25 GGGGSGGGGRSGGGGGGGGGKG 46 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGG G Sbjct: 3 GKGGGGGGGGKGGGGGGGGGKG 24 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGG GGGGG Sbjct: 19 GGGGKGGGGGSGGGGRSGGGGG 40 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 24 GGGGGSGGGGRSGGGGGGGGG 44 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 28 GSGGGGRSGGGGGGGGGKGGG 48 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 2 GGKGGGGGGGGKGGGGGGGGG 22 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 7 GGGGGGKGGGGGGGGGKGGGG 27 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGG--GGG 368 GGGGGG GG G GG GGG Sbjct: 15 GGGGGGGGKGGGGGSGGGGRSGGG 38 Score = 28.3 bits (60), Expect = 7.9 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGG--GGXGGGGG 368 GGG GG GG GG GGGGG Sbjct: 20 GGGKGGGGGSGGGGRSGGGGGGGG 43 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GG G GGG Sbjct: 38 GGGGGGGKGGGEGGSGKYGGG 58 >06_03_0790 - 24636805-24637770 Length = 321 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGG 103 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGG 104 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGG 105 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 85 GGGGGGGGGGGGGGGGGGGGGG 106 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 86 GGGGGGGGGGGGGGGGGGGGGG 107 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGG 108 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGG 109 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 89 GGGGGGGGGGGGGGGGGGGGGG 110 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 90 GGGGGGGGGGGGGGGGGGGGGG 111 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 91 GGGGGGGGGGGGGGGGGGGGGG 112 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 92 GGGGGGGGGGGGGGGGGGGGGG 113 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 93 GGGGGGGGGGGGGGGGGGGGGG 114 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 94 GGGGGGGGGGGGGGGGGGGGGG 115 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 95 GGGGGGGGGGGGGGGGGGGGGG 116 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 96 GGGGGGGGGGGGGGGGGGGGGG 117 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 97 GGGGGGGGGGGGGGGGGGGGGG 118 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 98 GGGGGGGGGGGGGGGGGGGGGG 119 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 99 GGGGGGGGGGGGGGGGGGGGGG 120 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 105 GGGGGGGGGGGGGGGGRGGGGG 126 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 110 GGGGGGGGGGGRGGGGGGGGGG 131 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 111 GGGGGGGGGGRGGGGGGGGGGG 132 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 112 GGGGGGGGGRGGGGGGGGGGGG 133 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 113 GGGGGGGGRGGGGGGGGGGGGG 134 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 114 GGGGGGGRGGGGGGGGGGGGGG 135 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 115 GGGGGGRGGGGGGGGGGGGGGG 136 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 122 GGGGGGGGGGGGGGGGGGGGGG 143 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 123 GGGGGGGGGGGGGGGGGGGGGG 144 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 124 GGGGGGGGGGGGGGGGGGGGGG 145 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 125 GGGGGGGGGGGGGGGGGGGGGG 146 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 126 GGGGGGGGGGGGGGGGGGGGGG 147 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 128 GGGGGGGGGGGGGGGGGGGGNG 149 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GG GG Sbjct: 129 GGGGGGGGGGGGGGGGGGGNGG 150 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 101 GGGGGGGGGGGGGGGGGGGGRG 122 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GG GG Sbjct: 102 GGGGGGGGGGGGGGGGGGGRGG 123 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 103 GGGGGGGGGGGGGGGGGGRGGG 124 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGG Sbjct: 104 GGGGGGGGGGGGGGGGGRGGGG 125 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 106 GGGGGGGGGGGGGGGRGGGGGG 127 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGGGG Sbjct: 107 GGGGGGGGGGGGGGRGGGGGGG 128 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGGG Sbjct: 108 GGGGGGGGGGGGGRGGGGGGGG 129 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 109 GGGGGGGGGGGGRGGGGGGGGG 130 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 116 GGGGGRGGGGGGGGGGGGGGGG 137 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGGG Sbjct: 117 GGGGRGGGGGGGGGGGGGGGGG 138 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGGG Sbjct: 118 GGGRGGGGGGGGGGGGGGGGGG 139 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 119 GGRGGGGGGGGGGGGGGGGGGG 140 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 120 GRGGGGGGGGGGGGGGGGGGGG 141 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 82 GGGGGGGGGGGGGGGGGGGGG 102 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 83 GGGGGGGGGGGGGGGGGGGGG 103 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 84 GGGGGGGGGGGGGGGGGGGGG 104 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 85 GGGGGGGGGGGGGGGGGGGGG 105 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 86 GGGGGGGGGGGGGGGGGGGGG 106 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 87 GGGGGGGGGGGGGGGGGGGGG 107 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 88 GGGGGGGGGGGGGGGGGGGGG 108 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 89 GGGGGGGGGGGGGGGGGGGGG 109 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 90 GGGGGGGGGGGGGGGGGGGGG 110 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 91 GGGGGGGGGGGGGGGGGGGGG 111 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 92 GGGGGGGGGGGGGGGGGGGGG 112 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 93 GGGGGGGGGGGGGGGGGGGGG 113 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 94 GGGGGGGGGGGGGGGGGGGGG 114 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 95 GGGGGGGGGGGGGGGGGGGGG 115 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 96 GGGGGGGGGGGGGGGGGGGGG 116 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 97 GGGGGGGGGGGGGGGGGGGGG 117 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 98 GGGGGGGGGGGGGGGGGGGGG 118 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 99 GGGGGGGGGGGGGGGGGGGGG 119 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 100 GGGGGGGGGGGGGGGGGGGGG 120 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 104 GGGGGGGGGGGGGGGGGRGGG 124 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 106 GGGGGGGGGGGGGGGRGGGGG 126 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 111 GGGGGGGGGGRGGGGGGGGGG 131 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 112 GGGGGGGGGRGGGGGGGGGGG 132 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 114 GGGGGGGRGGGGGGGGGGGGG 134 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 115 GGGGGGRGGGGGGGGGGGGGG 135 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 116 GGGGGRGGGGGGGGGGGGGGG 136 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 119 GGRGGGGGGGGGGGGGGGGGG 139 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 122 GGGGGGGGGGGGGGGGGGGGG 142 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 123 GGGGGGGGGGGGGGGGGGGGG 143 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 124 GGGGGGGGGGGGGGGGGGGGG 144 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 125 GGGGGGGGGGGGGGGGGGGGG 145 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 126 GGGGGGGGGGGGGGGGGGGGG 146 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 127 GGGGGGGGGGGGGGGGGGGGG 147 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GGGGG Sbjct: 246 GGGGGRGDVSGAGGGGGGGGG 266 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG GGGG GGGG Sbjct: 246 GGGGGRGDVSGAGGGGGGGGG 266 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GG G Sbjct: 132 GGGGGGGGGGGGGGGGNGGDDG 153 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 129 GGGGGGGGGGGGGGGGGGGNG 149 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GG Sbjct: 130 GGGGGGGGGGGGGGGGGGNGG 150 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 105 GGGGGGGGGGGGGGGGRGGGG 125 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 107 GGGGGGGGGGGGGGRGGGGGG 127 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 110 GGGGGGGGGGGRGGGGGGGGG 130 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 113 GGGGGGGGRGGGGGGGGGGGG 133 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 117 GGGGRGGGGGGGGGGGGGGGG 137 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 118 GGGRGGGGGGGGGGGGGGGGG 138 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 120 GRGGGGGGGGGGGGGGGGGGG 140 >06_02_0175 - 12624608-12625297 Length = 229 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGG 121 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 101 GGGGGGGGGGGGGGGGGGGGGG 122 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 102 GGGGGGGGGGGGGGGGGGGGGG 123 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 103 GGGGGGGGGGGGGGGGGGGGGG 124 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 104 GGGGGGGGGGGGGGGGGGGGGG 125 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 105 GGGGGGGGGGGGGGGGGGGGGG 126 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 100 GGGGGGGGGGGGGGGGGGGGG 120 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 101 GGGGGGGGGGGGGGGGGGGGG 121 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 102 GGGGGGGGGGGGGGGGGGGGG 122 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 103 GGGGGGGGGGGGGGGGGGGGG 123 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 104 GGGGGGGGGGGGGGGGGGGGG 124 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 105 GGGGGGGGGGGGGGGGGGGGG 125 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 106 GGGGGGGGGGGGGGGGGGGGG 126 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGGG 368 GGGG GGGG GGGGG Sbjct: 94 GGGGSSGGGGGGGGGGGGGG 113 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGG GGGG GGGGG Sbjct: 94 GGGGSSGGGGGGGGGGGGGGG 114 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 94 GGGGSSGGGGGGGGGGGGGGG 114 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 96 GGSSGGGGGGGGGGGGGGGGG 116 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 97 GSSGGGGGGGGGGGGGGGGGG 117 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GG GGGG GGGGG Sbjct: 90 GTDSGGGGSSGGGGGGGGGGGG 111 >04_04_1413 - 33386049-33386339 Length = 96 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 63 GGGGGGGGGGGCGGGGGGGGGG 84 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 64 GGGGGGGGGGCGGGGGGGGGGG 85 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 62 GGGGGGGGGGGGCGGGGGGGGG 83 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 68 GGGGGGCGGGGGGGGGGGCGGG 89 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGGG Sbjct: 70 GGGGCGGGGGGGGGGGCGGGGG 91 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 64 GGGGGGGGGGCGGGGGGGGGG 84 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 65 GGGGGGGGGCGGGGGGGGGGG 85 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 66 GGGGGGGGCGGGGGGGGGGGCG 87 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GG GG Sbjct: 67 GGGGGGGCGGGGGGGGGGGCGG 88 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 69 GGGGGCGGGGGGGGGGGCGGG 89 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGG Sbjct: 75 GGGGGGGGGGGCGGGGGSGGG 95 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGGG 368 G GG GGGG GGGGG Sbjct: 53 GSGGRRRRTGGGGGGGGGGG 72 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGG Sbjct: 69 GGGGGCGGGGGGGGGGGCGGGG 90 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 G GG GGGG GGGGG Sbjct: 53 GSGGRRRRTGGGGGGGGGGGG 73 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 63 GGGGGGGGGGGCGGGGGGGGG 83 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 71 GGGCGGGGGGGGGGGCGGGGG 91 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 75 GGGGGGGGGGGCGGGGGSGGG 95 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 36.3 bits (80), Expect = 0.030 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 7/29 (24%) Frame = +3 Query: 369 PPPPPX-------PPPPXXGGGXPPPPPP 434 PP PP PPPP G G PPPPPP Sbjct: 1086 PPLPPTLGDYGVAPPPPSIGAGAPPPPPP 1114 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPPPX-----PPPPXXGGGXPPPPPP 434 PPPP PPP GG PPPPPP Sbjct: 1163 PPPPAGFRGGTPPPNAHGGVAPPPPPP 1189 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPP 431 PP PPPP G PPPPP Sbjct: 1109 PPPPPPPGGITGVPPPPP 1126 Score = 32.7 bits (71), Expect = 0.37 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPP 431 PP PP P GG PPPPP Sbjct: 1136 PPAPPLPEGIGGVPPPPP 1153 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/21 (61%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +3 Query: 369 PPPPPXPP-PPXXGGGXPPPP 428 PP P PP PP GG PPPP Sbjct: 1201 PPGAPAPPMPPGVPGGPPPPP 1221 Score = 31.5 bits (68), Expect = 0.85 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 8/30 (26%) Frame = +3 Query: 369 PPPPPXP--------PPPXXGGGXPPPPPP 434 PP PP P PPP G G PP PPP Sbjct: 1136 PPAPPLPEGIGGVPPPPPVGGLGGPPAPPP 1165 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXP--PPPPP 434 PP PP P P G P PPPPP Sbjct: 1198 PPTPPGAPAPPMPPGVPGGPPPPP 1221 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPP 428 PPP PPP G PPPP Sbjct: 1109 PPPPPPPGGITGVPPPPP 1126 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 7/28 (25%) Frame = +3 Query: 372 PPPPXPPPPXXG-------GGXPPPPPP 434 P PP PPPP GG PP PPP Sbjct: 1060 PSPPSPPPPQRENTSVGIQGGIPPLPPP 1087 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 8/29 (27%) Frame = +3 Query: 372 PPPPXP--------PPPXXGGGXPPPPPP 434 PP P P PPP GG PPPPP Sbjct: 1160 PPAPPPPAGFRGGTPPPNAHGGVAPPPPP 1188 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/19 (63%), Positives = 12/19 (63%), Gaps = 1/19 (5%) Frame = +3 Query: 378 PPXPPPPXXGG-GXPPPPP 431 PP PPP GG G PP PP Sbjct: 1184 PPPPPPRGHGGVGGPPTPP 1202 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 4/24 (16%) Frame = +3 Query: 369 PPPPPX----PPPPXXGGGXPPPP 428 PP PP PPPP G G P PP Sbjct: 1207 PPMPPGVPGGPPPPPGGRGLPAPP 1230 Score = 28.7 bits (61), Expect = 6.0 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 8/30 (26%) Frame = +3 Query: 369 PPPPPX------PPPPXXG--GGXPPPPPP 434 PPPPP PPPP G G PP PP Sbjct: 1111 PPPPPGGITGVPPPPPIGGLGGHQAPPAPP 1140 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 36.3 bits (80), Expect = 0.030 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PP PPPP G PPPPPP Sbjct: 292 PPRIPPPPVGGTQPPPPPPP 311 Score = 35.9 bits (79), Expect = 0.039 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 267 PPPPQVPPPPPQA---PPPPPP 285 Score = 34.7 bits (76), Expect = 0.091 Identities = 16/26 (61%), Positives = 16/26 (61%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPP--PXPPPPXXGGGXPP--PPPP 434 PPPP P PPPP G PP PPPP Sbjct: 274 PPPPQAPPPPPPNAPMGMPPRIPPPP 299 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 7/29 (24%) Frame = +3 Query: 369 PPPPPXPP-------PPXXGGGXPPPPPP 434 PPPPP P PP GG PPPPP Sbjct: 281 PPPPPNAPMGMPPRIPPPPVGGTQPPPPP 309 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP PPPP P PP P Sbjct: 268 PPPQVPPPPPQAPPPPPPNAP 288 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PP P PPPP P PP P Sbjct: 276 PPQAPPPPPPNAPMGMPPRIP 296 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP PPPP P PP PP Sbjct: 267 PPPPQVPPPP--PQAPPPPPP 285 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP P PP GG PPPPPP Sbjct: 292 PPRIPPPP---VGGTQPPPPPP 310 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPP G PPPP Sbjct: 305 PPPPPPPLANGPPRSIPPPP 324 >03_01_0023 + 198414-198968 Length = 184 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 36 GGGGGGGGGGGGGGGGRGGGGG 57 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGGG Sbjct: 75 GGGSGGGGSGGGGGGGSGGGGG 96 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 42 GGGGGGGGGGRGGGGGSGGGSG 63 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 46 GGGGGGRGGGGGSGGGSGGGGG 67 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 67 GSGGGGSGGGGSGGGGSGGGGG 88 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 37 GGGGGGGGGGGGGGGRGGGGG 57 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 76 GGSGGGGSGGGGGGGSGGGGG 96 Score = 31.9 bits (69), Expect = 0.64 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 421 GGXPPPXXGGGGXGGGGG 368 G P P GGGG GGGGG Sbjct: 30 GSCPSPGGGGGGGGGGGG 47 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GG G GGGGG Sbjct: 69 GGGGSGGGGSGGGGSGGGGGGG 90 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGG Sbjct: 74 GGGGSGGGGSGGGGGGGSGGGG 95 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGGG Sbjct: 76 GGSGGGGSGGGGGGGSGGGGGG 97 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGG Sbjct: 41 GGGGGGGGGGGRGGGGGSGGG 61 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GG GG Sbjct: 43 GGGGGGGGGRGGGGGSGGGSGG 64 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G G GGG Sbjct: 44 GGGGGGGGRGGGGGSGGGSGGG 65 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGG Sbjct: 45 GGGGGGGRGGGGGSGGGSGGGG 66 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGG 371 GGGGG GGGG GGGG Sbjct: 53 GGGGGSGGGSGGGGGSGGGG 72 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGG 371 GGGGG GGGG GGGG Sbjct: 63 GGGGGSGGGGSGGGGSGGGG 82 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GG GG Sbjct: 72 GSGGGGSGGGGSGGGGGGGSGG 93 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GG G GGGGG Sbjct: 77 GSGGGGSGGGGGGGSGGGGGGG 98 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGG Sbjct: 51 GRGGGGGSGGGSGGGGGSGGGG 72 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGG G Sbjct: 38 GGGGGGGGGGGGGGRGGGGGSG 59 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GG GG Sbjct: 39 GGGGGGGGGGGGGRGGGGGSGG 60 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG G GGG Sbjct: 40 GGGGGGGGGGGGRGGGGGSGGG 61 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 36 GGGGGGGGGGGGGGGGRGGG 55 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 43 GGGGGGGGGRGGGGGSGGGSG 63 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GG G G GGG Sbjct: 45 GGGGGGGRGGGGGSGGGSGGG 65 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 47 GGGGGRGGGGGSGGGSGGGGG 67 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGG 322 GG GG G GGGG G GG Sbjct: 53 GGGGGSGGGSGGGGGSGGGG 72 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G G GG G GGG Sbjct: 56 GGSGGGSGGGGGSGGGGSGGG 76 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGG 322 GG GG G GGGG G GG Sbjct: 63 GGGGGSGGGGSGGGGSGGGG 82 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G G GG G GGG Sbjct: 66 GGSGGGGSGGGGSGGGGSGGG 86 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 69 GGGGSGGGGSGGGGSGGGGG 88 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 74 GGGGSGGGGSGGGGGGGSGGG 94 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GGG G Sbjct: 53 GGGGGSGGGSGGGGGSGGGGSG 74 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GG G GG GG Sbjct: 54 GGGGSGGGSGGGGGSGGGGSGG 75 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG G GG G GGG Sbjct: 55 GGGSGGGSGGGGGSGGGGSGGG 76 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GG G GG GG Sbjct: 59 GGGSGGGGGSGGGGSGGGGSGG 80 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG G GG G GGG Sbjct: 60 GGSGGGGGSGGGGSGGGGSGGG 81 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGG GGGG Sbjct: 61 GSGGGGGSGGGGSGGGGSGGGG 82 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GG G GG GG Sbjct: 64 GGGGSGGGGSGGGGSGGGGSGG 85 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG G GG G GGG Sbjct: 65 GGGSGGGGSGGGGSGGGGSGGG 86 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGG Sbjct: 66 GGSGGGGSGGGGSGGGGSGGGG 87 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGG G Sbjct: 71 GGSGGGGSGGGGSGGGGGGGSG 92 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 36 GGGGGGGGGGGGGGGGRGGGG 56 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 41 GGGGGGGGGGGRGGGGGSGGG 61 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGG Sbjct: 56 GGSGGGSGGGGGSGGGGSGGGG 77 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GGG G Sbjct: 63 GGGGGSGGGGSGGGGSGGGGSG 84 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG G GG GG GG Sbjct: 49 GGGRGGGGGSGGGSGGGGGSGG 70 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG G GGG Sbjct: 50 GGRGGGGGSGGGSGGGGGSGGG 71 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GG G GGG G Sbjct: 48 GGGGRGGGGGSGGGSGGGGGSG 69 >02_05_0149 + 26290236-26290880 Length = 214 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG P GGGG GGGGG Sbjct: 120 GGGYGGHPGGFGGGGGGGGGGG 141 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 121 GGYGGHPGGFGGGGGGGGGGG 141 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 128 GGFGGGGGGGGGGGGRNYGGG 148 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 120 GGGYGGHPGGFGGGGGGGGGG 140 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GG GG Sbjct: 133 GGGGGGGGGGRNYGGGSGGIGG 154 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGGG 368 GGG P GGGG G GGG Sbjct: 159 GGGYNGEPGGGGGGAGEGGG 178 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 34 GGGGGGGGGGGGGGGGGGGGGG 55 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 35 GGGGGGGGGGGGGGGGGGGGGG 56 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 36 GGGGGGGGGGGGGGGGGGGGGG 57 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGG 58 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGG 59 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGG 60 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGG 61 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGG 62 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGG 63 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 48 GGGGGGGGGGGGGGGGRGGGGG 69 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 53 GGGGGGGGGGGRGGGGGGGGGG 74 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 54 GGGGGGGGGGRGGGGGGGGGGG 75 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 55 GGGGGGGGGRGGGGGGGGGGGG 76 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 56 GGGGGGGGRGGGGGGGGGGGGG 77 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 57 GGGGGGGRGGGGGGGGGGGGGG 78 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 58 GGGGGGRGGGGGGGGGGGGGGG 79 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 65 GGGGGGGGGGGGGGGGGGGGGG 86 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 66 GGGGGGGGGGGGGGGGGGGGGG 87 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 67 GGGGGGGGGGGGGGGGGGGGGG 88 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 68 GGGGGGGGGGGGGGGGGGGGGG 89 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 69 GGGGGGGGGGGGGGGGGGGGGG 90 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGG 91 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGG 92 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 44 GGGGGGGGGGGGGGGGGGGGRG 65 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GG GG Sbjct: 45 GGGGGGGGGGGGGGGGGGGRGG 66 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 46 GGGGGGGGGGGGGGGGGGRGGG 67 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGG Sbjct: 47 GGGGGGGGGGGGGGGGGRGGGG 68 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 49 GGGGGGGGGGGGGGGRGGGGGG 70 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGGGG Sbjct: 50 GGGGGGGGGGGGGGRGGGGGGG 71 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGGG Sbjct: 51 GGGGGGGGGGGGGRGGGGGGGG 72 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 52 GGGGGGGGGGGGRGGGGGGGGG 73 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 59 GGGGGRGGGGGGGGGGGGGGGG 80 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGGG Sbjct: 60 GGGGRGGGGGGGGGGGGGGGGG 81 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGGG Sbjct: 61 GGGRGGGGGGGGGGGGGGGGGG 82 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 62 GGRGGGGGGGGGGGGGGGGGGG 83 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 63 GRGGGGGGGGGGGGGGGGGGGG 84 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 34 GGGGGGGGGGGGGGGGGGGGG 54 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 35 GGGGGGGGGGGGGGGGGGGGG 55 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 36 GGGGGGGGGGGGGGGGGGGGG 56 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGG 57 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 38 GGGGGGGGGGGGGGGGGGGGG 58 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 39 GGGGGGGGGGGGGGGGGGGGG 59 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGG 60 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGG 61 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 42 GGGGGGGGGGGGGGGGGGGGG 62 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 43 GGGGGGGGGGGGGGGGGGGGG 63 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 47 GGGGGGGGGGGGGGGGGRGGG 67 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 49 GGGGGGGGGGGGGGGRGGGGG 69 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 54 GGGGGGGGGGRGGGGGGGGGG 74 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 55 GGGGGGGGGRGGGGGGGGGGG 75 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 57 GGGGGGGRGGGGGGGGGGGGG 77 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 58 GGGGGGRGGGGGGGGGGGGGG 78 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 59 GGGGGRGGGGGGGGGGGGGGG 79 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 62 GGRGGGGGGGGGGGGGGGGGG 82 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 65 GGGGGGGGGGGGGGGGGGGGG 85 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 66 GGGGGGGGGGGGGGGGGGGGG 86 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 67 GGGGGGGGGGGGGGGGGGGGG 87 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 68 GGGGGGGGGGGGGGGGGGGGG 88 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 69 GGGGGGGGGGGGGGGGGGGGG 89 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 70 GGGGGGGGGGGGGGGGGGGGG 90 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 71 GGGGGGGGGGGGGGGGGGGGG 91 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 72 GGGGGGGGGGGGGGGGGGGGG 92 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 32 GCGGGGGGGGGGGGGGGGGG 51 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 48 GGGGGGGGGGGGGGGGRGGGG 68 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 50 GGGGGGGGGGGGGGRGGGGGG 70 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 53 GGGGGGGGGGGRGGGGGGGGG 73 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 56 GGGGGGGGRGGGGGGGGGGGG 76 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 60 GGGGRGGGGGGGGGGGGGGGG 80 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 61 GGGRGGGGGGGGGGGGGGGGG 81 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 63 GRGGGGGGGGGGGGGGGGGGG 83 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 32 GCGGGGGGGGGGGGGGGGGGG 52 >01_07_0188 - 41866689-41866763,41866889-41867155,41867277-41867722, 41867945-41868033,41868279-41868368,41868661-41868739, 41868979-41869042,41869597-41869684,41869776-41869836, 41869906-41869969,41870134-41870188,41870275-41870346, 41870469-41870551,41870629-41870724,41871279-41871383, 41872159-41872227,41872470-41872561,41872667-41872886 Length = 704 Score = 36.3 bits (80), Expect = 0.030 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 7/29 (24%) Frame = +3 Query: 369 PPPPPXPPPPXXGGG-------XPPPPPP 434 PPPP PPPP GGG PPP PP Sbjct: 12 PPPPQHPPPPQAGGGGGGEFYRGPPPQPP 40 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 35.9 bits (79), Expect = 0.039 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPP PP P PPPPPP Sbjct: 73 PPPPQTPPSPPPPPPPPPPPPP 94 Score = 34.7 bits (76), Expect = 0.091 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP PPPP PPPPPP Sbjct: 79 PPSPPPPPPP-----PPPPPPP 95 Score = 31.5 bits (68), Expect = 0.85 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP P PP P Sbjct: 79 PPSPPPPPPPPPPPPPPLSP 98 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP PP P P PP PP Sbjct: 73 PPPPQTPPSPPPPPPPPPPPP 93 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PP P PP PP Sbjct: 74 PPPQTPPSPPPPPPPPPPPPP 94 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PP P PPP P PP PP Sbjct: 75 PPQTPPSPPPPPPPPPPPPPP 95 Score = 29.5 bits (63), Expect = 3.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXP 370 PPP P PPPP P P Sbjct: 82 PPPPPPPPPPPPPPLSP 98 Score = 29.1 bits (62), Expect = 4.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPP 373 PPP P PPPP P P Sbjct: 83 PPPPPPPPPPPPPLSPTP 100 Score = 28.7 bits (61), Expect = 6.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXP 379 PP P PPPP P P P Sbjct: 82 PPPPPPPPPPPPPPLSPTP 100 >07_01_0516 - 3850252-3852870 Length = 872 Score = 35.9 bits (79), Expect = 0.039 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 P PPP PPPP G PPPP Sbjct: 25 PLPPPPPPPPPAHGPSPPPP 44 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 P PP PPPP G PPPP Sbjct: 25 PLPPPPPPPPPAHGPSPPPP 44 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPP---PPXPPPPXXGGGXPPPPPP 434 PPP PP PPP PPPPPP Sbjct: 10 PPPRLLPPQPPPTSRPLPPPPPPPP 34 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 P P PPPP P PPPP Sbjct: 25 PLPPPPPPPPPAHGPSPPPP 44 Score = 29.1 bits (62), Expect = 4.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPP 373 PPP P PPP P PP Sbjct: 27 PPPPPPPPPAHGPSPPPP 44 Score = 28.7 bits (61), Expect = 6.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 326 PXPXPPPPXXPXXXPPXPP 382 P P PPPP P P PP Sbjct: 25 PLPPPPPPPPPAHGPSPPP 43 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 3/24 (12%) Frame = +2 Query: 320 PPPX---PXPPPPXXPXXXPPXPP 382 PPP P PPP P PP PP Sbjct: 10 PPPRLLPPQPPPTSRPLPPPPPPP 33 >04_04_1126 + 31095651-31096115 Length = 154 Score = 35.9 bits (79), Expect = 0.039 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P P P PPPP G P PPPP Sbjct: 37 PTPKPPPPPPPAPSGVPCPPPP 58 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 P P P PPPP P P PP Sbjct: 37 PTPKPPPPPPPAPSGVPCPPP 57 >01_01_0929 - 7344911-7345978 Length = 355 Score = 35.9 bits (79), Expect = 0.039 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP PP P PPPPPP Sbjct: 17 PPTPPLPPSPPSKTRRPPPPPP 38 Score = 31.9 bits (69), Expect = 0.64 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PP P PP PPPPPP Sbjct: 18 PTPPLPPSPPSKTRRPPPPPPP 39 >02_02_0059 - 6432945-6433115,6433975-6434061,6434585-6434787, 6435281-6435392,6435473-6435517,6435622-6435726, 6435946-6435996,6436026-6436103,6437258-6437313, 6437784-6437853,6438288-6438392,6438525-6438637, 6439354-6439534,6439635-6440390 Length = 710 Score = 29.5 bits (63), Expect(2) = 0.046 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPP 431 PP PPPP G P PPP Sbjct: 62 PPFPPPPGMLHGEPYPPP 79 Score = 25.8 bits (54), Expect(2) = 5.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 320 PPPXPXPPPP 349 PPP P PPPP Sbjct: 33 PPPLPPPPPP 42 Score = 25.0 bits (52), Expect(2) = 0.046 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPP P PPPP Sbjct: 33 PPPLPPPPPP 42 Score = 21.4 bits (43), Expect(2) = 5.1 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +2 Query: 332 PXPPPPXXPXXXPPXPP 382 P PPPP P PP Sbjct: 63 PFPPPPGMLHGEPYPPP 79 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 35.5 bits (78), Expect = 0.052 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXP----PPPPP 434 PPPPP PP P G P PPPPP Sbjct: 230 PPPPPPPPKPANIAGAPGLPLPPPPP 255 Score = 35.5 bits (78), Expect = 0.052 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPXPPPPXXGGG---XPPPPPP 434 PPPPP PPP G PPPPPP Sbjct: 254 PPPPPGPPPREIVPGQTLLPPPPPP 278 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 718 PXXXPPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 P PPPP P + P PPPPPP Sbjct: 200 PSTLPPPPPPPPLPASSEPVDPSAASLPPLPPPPPP 235 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 8/30 (26%) Frame = +3 Query: 369 PPPPPXPPPP--------XXGGGXPPPPPP 434 PP PP PPPP G PPPPPP Sbjct: 227 PPLPPPPPPPPKPANIAGAPGLPLPPPPPP 256 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPPPXPPPP-----XXGGGXPPPPPP 434 PPPPP PP P G PPPPP Sbjct: 251 PPPPPPPPGPPPREIVPGQTLLPPPPP 277 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 730 PPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 PPPP P P PPPPPP Sbjct: 206 PPPPPPLPASSEPVDPSAASLPPLPPPPPPPP 237 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPXPPPPXXGGG---XPPPPPP 434 PPPPP PP G P PPPP Sbjct: 385 PPPPPDTRPPFMAPGVNARPLPPPP 409 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPXPPP---PXXGGGXPPPPPP 434 PPPPP PP G PP PPP Sbjct: 406 PPPPPGLPPAQMQMAPFGVPPGPPP 430 Score = 25.8 bits (54), Expect(2) = 4.0 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPP 373 P P PPPP P PP Sbjct: 246 PGLPLPPPPPPPPGPPP 262 Score = 21.8 bits (44), Expect(2) = 4.0 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 320 PPPXPXPPPP 349 PPP P PP P Sbjct: 204 PPPPPPPPLP 213 >05_05_0217 + 23366436-23367005 Length = 189 Score = 27.5 bits (58), Expect(2) = 0.066 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 421 GGXPPPXXGGGGXGGGGG 368 GG GGGG GGGGG Sbjct: 71 GGRGAAAAGGGGGGGGGG 88 Score = 26.6 bits (56), Expect(2) = 0.066 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -3 Query: 433 GGGGGGXPPP 404 GGGGGG PPP Sbjct: 23 GGGGGGAPPP 32 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 35.1 bits (77), Expect = 0.069 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP P PPPP PPPPPP Sbjct: 49 PPQPTLPPPPPRTLPPPPPPPP 70 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP P PPP PPPPPP Sbjct: 48 PPPQPTLPPPPPRTLPPPPPPP 69 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP PPPPPP Sbjct: 55 PPPPPRTLPP-----PPPPPPP 71 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP PP PP Sbjct: 48 PPPQPTLPPPPPRTLPPPPPP 68 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP PPPP P PP PP Sbjct: 57 PPPRTLPPPPPPP---PPQPP 74 >05_07_0001 + 26976510-26977382 Length = 290 Score = 35.1 bits (77), Expect = 0.069 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG P GGG GGGGG Sbjct: 93 GGGGGEFEQPLTNGGGGGGGGG 114 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 35.1 bits (77), Expect = 0.069 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPPPP PPPP P PP Sbjct: 77 PPPPPPPPPPRNSPSPPKPP 96 Score = 35.1 bits (77), Expect = 0.069 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PPPP PP PP Sbjct: 77 PPPPPPPPPPRNSPSPPKPP 96 Score = 31.9 bits (69), Expect = 0.64 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPPP PP PP Sbjct: 77 PPPPPPPPPPRNSPSPPKPP 96 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 77 PPPPPPPPPPRNSPSPPKPP 96 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PP P PP PPPPPP Sbjct: 64 PPLPSATPPLAASPPPPPPPP 84 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP P PP PPPPPP Sbjct: 64 PPLPSATPPLAASPPPPPPPPP 85 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPP--PPXPPPPXXGGGXPPPPPP 434 PPP PP P PPPPPP Sbjct: 59 PPPASPPLPSATPPLAASPPPPPP 82 >03_05_0067 - 20460206-20460703,20461255-20461530 Length = 257 Score = 35.1 bits (77), Expect = 0.069 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPPPX-----PPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 4 PPPPPQWAMGPPPPPQYFQAGPPPPPP 30 >05_01_0364 + 2855760-2855801,2855940-2856015,2856759-2857747 Length = 368 Score = 34.7 bits (76), Expect = 0.091 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 213 GGGGGGKKKGKKGGGGGGGGNG 234 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGG GGGG Sbjct: 212 GGGGGGGKKKGKKGGGGGGGG 232 Score = 30.7 bits (66), Expect(2) = 0.082 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG P G G GGG G Sbjct: 165 GGGGGSPKTMVAGDGQGGGAG 185 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG GGGGG Sbjct: 211 GGGGGGGGKKKGKKGGGGGGGG 232 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G G GGGGG Sbjct: 210 GGGGGGGGGKKKGKKGGGGGGG 231 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 214 GGGGGKKKGKKGGGGGGGGNG 234 Score = 23.0 bits (47), Expect(2) = 0.082 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -3 Query: 433 GGGGGGXPPP 404 GGGGGG PP Sbjct: 135 GGGGGGSVPP 144 >12_01_0495 - 3935395-3937110 Length = 571 Score = 34.7 bits (76), Expect = 0.091 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 5 PPPPLPPPP------PPPPPP 19 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPP PPPP PPPPP Sbjct: 5 PPPPLPPPPP------PPPPP 19 Score = 29.5 bits (63), Expect = 3.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXP 370 PPP P PPPP P P Sbjct: 6 PPPLPPPPPPPPPPATP 22 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 34.7 bits (76), Expect = 0.091 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPP P PPPP Sbjct: 331 PPPPPPPPSRFNNTTPKPPPP 351 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPXPPPPXXGGG---XPPPPPP 434 P PPP PPPP PPPPPP Sbjct: 329 PAPPPPPPPPSRFNNTTPKPPPPPP 353 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 7/28 (25%) Frame = +2 Query: 320 PPPXPXPPPP-------XXPXXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 327 PPPAPPPPPPPPSRFNNTTPKPPPPPPP 354 >09_02_0327 - 7284829-7284889,7284946-7286126 Length = 413 Score = 34.7 bits (76), Expect = 0.091 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP PPPPP Sbjct: 53 PPPPPPPPPP------PPPPP 67 Score = 34.7 bits (76), Expect = 0.091 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 53 PPPPPPPPP------PPPPPP 67 Score = 30.7 bits (66), Expect = 1.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +3 Query: 369 PPPPPXPPPPXXG 407 PPPPP PPPP G Sbjct: 57 PPPPPPPPPPPRG 69 Score = 29.9 bits (64), Expect = 2.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 369 PPPPPXPPPPXXGG 410 PPPPP PPPP G Sbjct: 56 PPPPPPPPPPPPRG 69 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP PP PP Sbjct: 53 PPPPPPPPPP------PPPPP 67 >08_02_0758 + 20848078-20849579,20849660-20849850,20849944-20850179, 20850254-20850973 Length = 882 Score = 34.7 bits (76), Expect = 0.091 Identities = 16/26 (61%), Positives = 16/26 (61%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPX--PPPPXXGG--GXPPPPPP 434 PPPPP PPP G G PPPPPP Sbjct: 430 PPPPPQKNPPPNLKGQCYGQPPPPPP 455 >07_03_0965 - 22996575-22999112,22999202-22999636,22999717-22999801, 22999888-22999957,23000050-23000293,23000396-23000482, 23000655-23000706,23000830-23001226,23001324-23001648, 23001748-23001914,23002007-23002547 Length = 1646 Score = 34.7 bits (76), Expect = 0.091 Identities = 16/27 (59%), Positives = 16/27 (59%), Gaps = 5/27 (18%) Frame = -3 Query: 433 GGGGGGXPPP-----XXGGGGXGGGGG 368 GGGGGG PPP GGGG G G G Sbjct: 16 GGGGGGPPPPRRRLRSSGGGGGGSGSG 42 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 34.7 bits (76), Expect = 0.091 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 10/32 (31%) Frame = +3 Query: 369 PPPPPXPPPPXX----------GGGXPPPPPP 434 PPPPP PPPP G PPPPPP Sbjct: 369 PPPPPPPPPPAVTQQQDVKTSCGPAVPPPPPP 400 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPPPP PPPP PPPP Sbjct: 365 PPPPPPPPPP------PPPP 378 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPPP PPPPPP Sbjct: 365 PPPPPPPP------PPPPPP 378 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 718 PXXXPPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 P PPPP P A P PPP PP Sbjct: 368 PPPPPPPPPPPAVTQQQDVKTSCGPAVPPPPPPTPP 403 Score = 29.1 bits (62), Expect = 4.5 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 396 PPPPPTPPPP 405 >04_03_0833 + 20147242-20147849,20147937-20148081,20148157-20148210, 20148297-20148388,20148957-20149093,20149210-20149464, 20149598-20149771,20149863-20149960 Length = 520 Score = 34.7 bits (76), Expect = 0.091 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGGG Sbjct: 46 GGGGGGAGKKGRGGGGGGGGG 66 >04_01_0197 + 2323790-2324098,2324145-2324774 Length = 312 Score = 34.7 bits (76), Expect = 0.091 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP PPPPP Sbjct: 27 PPPPPPPPPP------PPPPP 41 Score = 34.7 bits (76), Expect = 0.091 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 27 PPPPPPPPP------PPPPPP 41 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP PP PP Sbjct: 27 PPPPPPPPPP------PPPPP 41 >03_06_0599 + 34984869-34985319,34986581-34987563 Length = 477 Score = 34.7 bits (76), Expect = 0.091 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP PPPPP Sbjct: 398 PPPPPQPPPP------PPPPP 412 Score = 33.1 bits (72), Expect = 0.28 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP P PPP Sbjct: 404 PPPPPPPPPHQRETPSPSPPP 424 Score = 32.7 bits (71), Expect = 0.37 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PPP PPPP P P PP Sbjct: 402 PQPPPPPPPPPHQRETPSPSPP 423 Score = 32.7 bits (71), Expect = 0.37 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPP P PPP Sbjct: 404 PPPPPPPPPHQRETPSPSPPP 424 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PPP P PP PPPPPP Sbjct: 396 PAPPPPPQPP------PPPPPP 411 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP PPP P Sbjct: 405 PPPPPPPPHQRETPSPSPPPQP 426 Score = 29.5 bits (63), Expect = 3.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 332 PXPPPPXXPXXXPPXPP 382 P PPPP P PP PP Sbjct: 396 PAPPPPPQPPPPPPPPP 412 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP PPPP P P P Sbjct: 401 PPQPPPPPPPPPHQRETPSPSP 422 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P PP PP P PPPPPP Sbjct: 396 PAPPPPPQPP----PPPPPPP 412 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 34.7 bits (76), Expect = 0.091 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PPPP P PP P Sbjct: 91 PPPSPPPPPPSSPPPVPPSP 110 Score = 34.3 bits (75), Expect = 0.12 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP P PP P Sbjct: 90 PPPPSPPPPPPSSPPPVPPSP 110 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPP PP Sbjct: 90 PPPPSPPPPPP---SSPPPVPP 108 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPP--PPPP 434 PPPPP PP PP PPPP Sbjct: 70 PPPPPRPPSFAPENALPPSSPPPP 93 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP PPPP P PP PP Sbjct: 90 PPPPSPPPPP--PSSPPPVPP 108 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PP PPPP PPPPPP Sbjct: 86 PPSSPPPP-----SPPPPPP 100 >02_01_0400 - 2922837-2923060,2923280-2923367,2923422-2923473, 2924133-2924206,2924298-2924395,2924650-2924719 Length = 201 Score = 34.7 bits (76), Expect = 0.091 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGGG 368 GG G PP GGGG GGGGG Sbjct: 138 GGTGFPPFRFGGGGGGGGGG 157 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 34.7 bits (76), Expect = 0.091 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPPPP PPP PPPP Sbjct: 430 PPPPPEHPPPPESTSPPPPP 449 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPP Sbjct: 431 PPPPEHPPPPE---STSPPPPP 449 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPPPX--PPPPXXGGGXPPPPPP 434 PPPP PPPP P PPPP Sbjct: 437 PPPPESTSPPPPPTSDPPPVPPPP 460 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PP PPPPP Sbjct: 430 PPPPPEHPPPPESTSPPPPP 449 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPP PPPP G P P P Sbjct: 453 PPPVPPPPPTTGSFMPIPSAP 473 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 3/24 (12%) Frame = +2 Query: 320 PPPX---PXPPPPXXPXXXPPXPP 382 PPP P PPP P PP PP Sbjct: 438 PPPESTSPPPPPTSDPPPVPPPPP 461 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 34.7 bits (76), Expect = 0.091 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP P PP PP Sbjct: 354 PPAPPPPPPFAPTLPPPPPP 373 Score = 34.3 bits (75), Expect = 0.12 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PP PPPP PPPPPP Sbjct: 354 PPAPPPPPPFAPTLPPPPPP 373 Score = 31.9 bits (69), Expect = 0.64 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 387 PPPPXXGGGXPPPPPP 434 PPPP G PPPPPP Sbjct: 413 PPPPTHTHGPPPPPPP 428 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 381 PXPPPPXXGGGXPPPPPP 434 P PPP G PPPPPP Sbjct: 412 PPPPPTHTHGPPPPPPPP 429 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPX----PPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 412 PPPPPTHTHGPPPP------PPPPPP 431 Score = 30.7 bits (66), Expect = 1.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +3 Query: 369 PPPPPXPPPPXXG 407 PPPPP PPPP G Sbjct: 423 PPPPPPPPPPPVG 435 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P PP P PP PPPPP Sbjct: 51 PAPPGPAPPFFPALPVPPPPP 71 Score = 29.5 bits (63), Expect = 3.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 369 PPPPPXPPPPXXGG 410 PPPPP PPPP G Sbjct: 422 PPPPPPPPPPPPVG 435 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPX----PPPPXXGGGXPPPPPP 434 PPPPP PPPP P P PP Sbjct: 358 PPPPPFAPTLPPPPPPRRKPPSPSPP 383 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPX---PPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 413 PPPPTHTHGPPPPP----PPPPPPP 433 >01_03_0005 + 11568545-11569119,11569179-11569191 Length = 195 Score = 34.7 bits (76), Expect = 0.091 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 GGGG PPP GGGG GGG Sbjct: 107 GGGGIYYPPPTGGGGGGGGG 126 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGG 371 GGGG PP GGGG GGGG Sbjct: 107 GGGGIYYPPPTGGGGGGGGG 126 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 8/30 (26%) Frame = -3 Query: 433 GGGGGGX------PPPXXGGGGXG--GGGG 368 GGGGGG PPP GGGG GGGG Sbjct: 81 GGGGGGTVMYTSPPPPYSGGGGGSSTGGGG 110 >01_01_1108 + 8758486-8758815,8758913-8758960,8761512-8761664, 8761749-8761847,8761884-8761991,8762078-8762200, 8763030-8763287 Length = 372 Score = 34.7 bits (76), Expect = 0.091 Identities = 16/24 (66%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXP--PPXXGGGGXGGGGG 368 GGGGGG P GGGG GGGGG Sbjct: 7 GGGGGGVMAGPGVAGGGGGGGGGG 30 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G G GGGGG Sbjct: 6 GGGGGGGVMAGPGVAGGGGGGG 27 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G G GGGGG Sbjct: 4 GGGGGGGGGVMAGPGVAGGGGG 25 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G G GGGG Sbjct: 3 GGGGGGGGGGVMAGPGVAGGGG 24 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 34.3 bits (75), Expect = 0.12 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP P Sbjct: 323 PPPPPPPPPPSFPWPFPPLAP 343 Score = 33.1 bits (72), Expect = 0.28 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P P PP Sbjct: 320 PPPPPPPPPPPPPSFPWPFPP 340 Score = 32.7 bits (71), Expect = 0.37 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPPPP PPPP P PP Sbjct: 321 PPPPPPPPPPPPSFPWPFPP 340 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP PP P Sbjct: 323 PPPPPPPPPPSFPWPFPPLAP 343 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 P PPP PPPP PPPPP Sbjct: 318 PSPPPPPPPP------PPPPP 332 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP PPPPPP Sbjct: 318 PSPPPPPPP------PPPPPP 332 Score = 31.5 bits (68), Expect = 0.85 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP P P PP Sbjct: 320 PPPPPPPPPPPPPSFPWPFPP 340 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PP P PPPP P P PP Sbjct: 286 PPSPPPPPPPAFPFPFPQLPP 306 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP P PP P PPPPPP Sbjct: 305 PPLPHFPPLPSFYPSPPPPPPP 326 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP P PP Sbjct: 320 PPPPPPPPPPPPPSFPWPFPP 340 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPP--PXPPPPXXGGGXPPPPPP 434 PPPP P P PP P PPPP Sbjct: 235 PPPPFLPFPLPPIPFLTPPSPPPP 258 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PP PP PPPP P PP Sbjct: 286 PPSPPPPPPPAFPFPFPQLPP 306 >12_01_0841 - 7873458-7874225 Length = 255 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 31 GGGGGGGEGGGGGGGEGGGGG 51 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 31 GGGGGGGEGGGGGGGEGGGGG 51 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGG GGGG Sbjct: 31 GGGGGGGEGGGGGGGEGGGGG 51 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGG G Sbjct: 32 GGGGGGEGGGGGGGEGGGGGSG 53 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGG GGGG G GGG Sbjct: 63 GASGGGYGQGGGGGGGGGQGGG 84 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGG GGGG G GGG Sbjct: 98 GASGGGYGKGGGGGGGGGQGGG 119 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGG GGGG G GGG Sbjct: 137 GASGGGYGQGGGGGGGGGQGGG 158 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGG GGGG G GGG Sbjct: 176 GASGGGYGQGGGGGGGGGQGGG 197 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GG GG Sbjct: 62 GGASGGGYGQGGGGGGGGGQGG 83 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GG GG Sbjct: 97 GGASGGGYGKGGGGGGGGGQGG 118 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GG GG Sbjct: 175 GGASGGGYGQGGGGGGGGGQGG 196 >12_01_0840 - 7847239-7847531,7847576-7847675,7848312-7848388, 7848486-7848738 Length = 240 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 31 GGGGGGGEGGGGGGGEGGGGG 51 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 31 GGGGGGGEGGGGGGGEGGGGG 51 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGG GGGG Sbjct: 31 GGGGGGGEGGGGGGGEGGGGG 51 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGG G Sbjct: 32 GGGGGGEGGGGGGGEGGGGGSG 53 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG G GG GGGGG Sbjct: 195 GGQGGGAHARGYGQGGGGGGGG 216 >12_01_0473 + 3708770-3710026 Length = 418 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG P GGG GGGGG Sbjct: 7 GGGGGAAPSSSNIGGGSGGGGG 28 >10_08_0521 + 18500105-18500529,18501216-18501284,18501467-18501555, 18501726-18501838,18502023-18502124,18502576-18502663, 18502795-18503361,18503766-18504149,18504168-18504384, 18504466-18504548,18505174-18505256,18505796-18506032, 18506481-18506658,18506814-18507328,18507740-18507916, 18508385-18508768,18508885-18509031 Length = 1285 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 80 GGGGGGVGDVEGGGGGGGAGGG 101 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGGG Sbjct: 82 GGGGVGDVEGGGGGGGAGGGGG 103 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 91 GGGGGG----GAGGGGGGGGGG 108 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGG Sbjct: 81 GGGGGVGDVEGGGGGGGAGGGG 102 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 81 GGGGGVGDVEGGGGGGGAGGG 101 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 83 GGGVGDVEGGGGGGGAGGGGG 103 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGG GGG G Sbjct: 78 GAGGGGGGVGDVEGGGGGGGAG 99 >10_07_0161 - 13674631-13675433,13675793-13675862 Length = 290 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 185 GGGGGWTGGGNGGGGSGGGGG 205 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 185 GGGGGWTGGGNGGGGSGGGGG 205 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGX--GGGGG 368 GGGGG GGGG GGGGG Sbjct: 201 GGGGGARGSSGGGGGGGWAGGGGG 224 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G G G GGGGG Sbjct: 196 GGGGSGGGGGARGSSGGGGGGG 217 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGG--GGG 368 G GGGG GGGG GG GGG Sbjct: 199 GSGGGGGARGSSGGGGGGGWAGGG 222 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG GGG GGGG Sbjct: 185 GGGGGWTGGGNGGGGSGGGGG 205 >09_03_0130 - 12609417-12610462,12610786-12611040,12611139-12611253, 12611376-12611428,12611854-12612114,12612252-12612302, 12612412-12612660,12612779-12613007,12613292-12613666 Length = 877 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PPP PPPP PPPPPP Sbjct: 12 PAPPPPPPPP------PPPPPP 27 >08_02_1410 - 26876243-26876497,26877129-26877239,26877240-26877324, 26877620-26877672,26878318-26878440,26878514-26878597, 26878708-26878773,26879512-26879584,26879854-26879888, 26879970-26880212 Length = 375 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGGG GGGG Sbjct: 20 GGGGEGLNPNPSGGGGGGGGG 40 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG P GGG GGGGG Sbjct: 19 GGGGGEGLNPNPSGGGGGGGGG 40 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG GGGGG Sbjct: 18 GGGGGGEGLNPNPSGGGGGGGG 39 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GGGGG Sbjct: 17 GGGGGGGEGLNPNPSGGGGGGG 38 >08_02_0796 - 21300251-21300373,21300846-21301721 Length = 332 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPP P Sbjct: 103 PPPPPPPPPP------PPPPQP 118 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPP 373 PPP P PPPP P P Sbjct: 106 PPPPPPPPPPPQPQQHLP 123 >06_01_0486 - 3455030-3455770 Length = 246 Score = 34.3 bits (75), Expect = 0.12 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP P PP PP Sbjct: 125 PPPTPPSPPPYVPPPTPPSPP 145 Score = 32.7 bits (71), Expect = 0.37 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP P PPP PP PPP Sbjct: 125 PPPTPPSPPPYVPPPTPPSPPP 146 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PP P P PP P PP PP Sbjct: 113 PPYIPPPTPPYVPPPTPPSPP 133 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PP P PPP P PP PP Sbjct: 90 PPYVPSPPPYVPPYIPPPTPP 110 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP P PP PP Sbjct: 137 PPPTPPSPPPYVP---PPSPP 154 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP PPP P PPP Sbjct: 118 PPTPPYVPPPTPPSPPPYVPPP 139 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PPP PPP P PPP Sbjct: 130 PSPPPYVPPPTPPSPPPYVPPP 151 >05_07_0280 - 28920864-28920971,28921076-28921175,28921267-28921394, 28922013-28922180,28922280-28922395,28922584-28922736, 28922904-28923047,28923401-28924133 Length = 549 Score = 34.3 bits (75), Expect = 0.12 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 P P P PPPP P PP PP Sbjct: 38 PKPKPQPPPPQQPRSQPPPPP 58 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 P P P PPPP PPPPP Sbjct: 38 PKPKPQPPPPQQPRSQPPPPP 58 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 1/23 (4%) Frame = +3 Query: 369 PPPPPXP-PPPXXGGGXPPPPPP 434 P P P P PPP PPPPP Sbjct: 36 PKPKPKPQPPPPQQPRSQPPPPP 58 >04_04_0183 - 23384290-23384783,23385064-23385139,23385291-23385296 Length = 191 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGGG 368 G GG PPP GGG GG GG Sbjct: 103 GNGGYPPPHQRGGGGGGSGG 122 >03_05_0252 - 22403504-22404676 Length = 390 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 5 GGGGGGRAGRVGGGGGGGAGGG 26 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 16 GGGGGGGA----GGGGGGGGGG 33 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGG Sbjct: 6 GGGGGRAGRVGGGGGGGAGGGG 27 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GG Sbjct: 5 GGGGGGRAGRVGGGGGGGAGG 25 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 6 GGGGGRAGRVGGGGGGGAGGG 26 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 13 GRVGGGGGGGAGGGGGGGGGG 33 >03_02_0856 - 11815684-11815701,11816019-11816194,11817878-11818670 Length = 328 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -3 Query: 421 GGXPPPXXGGGGXGGGGG 368 GG PP GGGG GGGGG Sbjct: 14 GGSPPEERGGGGSGGGGG 31 >03_02_0786 - 11169820-11170158,11170245-11170433,11171173-11171469, 11171568-11171630,11171884-11171997,11173011-11173091, 11173176-11173307,11174265-11174363,11174453-11174530, 11174641-11174901 Length = 550 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/22 (63%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 369 PPPPPXPPPPXXG-GGXPPPPP 431 PPPPP PP P G PPPPP Sbjct: 37 PPPPPMPPVPVMYLRGVPPPPP 58 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 7/29 (24%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXP-------PPPPP 434 PPPP PPPP P PPPPP Sbjct: 30 PPPPMGPPPPPPMPPVPVMYLRGVPPPPP 58 >03_02_0765 + 11000724-11002496 Length = 590 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 565 GGGGGLGAGGGGGGGFGGGGG 585 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGGG Sbjct: 38 GGGGFGGGGGFGGGGGLGGGGG 59 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 76 GGFGGGKGGGLGGGGGLGGGGG 97 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 125 GGGGGLGGGAGGGGGLGSGGG 145 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 565 GGGGGLGAGGGGGGGFGGGGG 585 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGG G Sbjct: 188 GGAGGGLGSGAGGGGGLGGGAG 209 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GG G GGGGG Sbjct: 548 GGAGGGAGAGFGGGAGAGGGGG 569 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG G GGG Sbjct: 125 GGGGGLGGGAGGGGGLGSGGG 145 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGG G Sbjct: 148 GGAGGGLGGGAGGGGGLGGGAG 169 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGG G Sbjct: 199 GGGGGLGGGAGGGGGLGGGAG 219 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGG G Sbjct: 230 GGAGGGLGGGAGGGGGLGGGAG 251 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGG G Sbjct: 289 GGGGGLGGGTGGGGGLGGGAG 309 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGG G Sbjct: 329 GGGGGLGGGAGGGGGLGGGAG 349 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGG G Sbjct: 369 GGGGGLGGGAGGGGGLGGGAG 389 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGG G Sbjct: 409 GGGGGLGGGAGGGGGLGGGAG 429 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGG G Sbjct: 487 GGGGGLGGGAGGGGGLGGGAG 507 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGG G Sbjct: 279 GGGGGLGGGTGGGGGLGGGTG 299 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGG G Sbjct: 476 GGFGGGAGAGTGGGGGLGGGAG 497 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGG G Sbjct: 114 GGFGGGKGGGLGGGGGLGGGAG 135 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGGG Sbjct: 224 GGAGGGGGAGGGLGGGAGGGGG 245 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGG Sbjct: 563 GAGGGGGLGAGGGGGGGFGGGG 584 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGG G Sbjct: 166 GGAGGGLGGGAGGGGGVGGGLG 187 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 199 GGGGGLGGGAGGGGGLGGGAG 219 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGG G Sbjct: 216 GGAGGGLGGGAGGGGGAGGGLG 237 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 289 GGGGGLGGGTGGGGGLGGGAG 309 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 329 GGGGGLGGGAGGGGGLGGGAG 349 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 369 GGGGGLGGGAGGGGGLGGGAG 389 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 409 GGGGGLGGGAGGGGGLGGGAG 429 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 487 GGGGGLGGGAGGGGGLGGGAG 507 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGG GGGG Sbjct: 547 GGGAGGGAGAGFGGGAGAGGGG 568 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 563 GAGGGGGLGAGGGGGGGFGGG 583 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGG G Sbjct: 44 GGGGFGGGGGLGGGGGAGGGFG 65 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGG Sbjct: 75 GGGFGGGKGGGLGGGGGLGGGG 96 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGGG Sbjct: 118 GGKGGGLGGGGGLGGGAGGGGG 139 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GG G Sbjct: 248 GGAGGGLGGGAGGGGGLSGGAG 269 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGG G Sbjct: 256 GGAGGGGGLSGGAGGGLGGGAG 277 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGG G Sbjct: 306 GGAGGGLGGGAGAGGGLGGGAG 327 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GG G GGGGG Sbjct: 313 GGGAGAGGGLGGGAGAGGGGG 333 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGG G Sbjct: 346 GGAGGGLGGGAGAGGGLGGGAG 367 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GG G GGGGG Sbjct: 353 GGGAGAGGGLGGGAGAGGGGG 373 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGG G Sbjct: 386 GGAGGGLGGGAGAGGGLGGGAG 407 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GG G GGGGG Sbjct: 393 GGGAGAGGGLGGGAGTGGGGG 413 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGG G Sbjct: 426 GGAGGGLGGGAGAGGGFGGGAG 447 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GG G GGGGG Sbjct: 433 GGGAGAGGGFGGGAGAGGGGG 453 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGG Sbjct: 37 GGGGGFGGGGGFGGGGGLGGGG 58 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 37 GGGGGFGGGGGFGGGGGLGGG 57 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 39 GGGFGGGGGFGGGGGLGGGGG 59 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 77 GFGGGKGGGLGGGGGLGGGGG 97 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGG G Sbjct: 156 GGAGGGGGLGGGAGGGLGGGAG 177 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = -3 Query: 430 GGGGGXPPPXXGG--GGXGGGGG 368 GGGGG GG GG GGGGG Sbjct: 159 GGGGGLGGGAGGGLGGGAGGGGG 181 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGG G Sbjct: 206 GGAGGGGGLGGGAGGGLGGGAG 227 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = -3 Query: 430 GGGGGXPPPXXGG--GGXGGGGG 368 GGGGG GG GG GGGGG Sbjct: 209 GGGGGLGGGAGGGLGGGAGGGGG 231 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGG GG GGGG GGG Sbjct: 215 GGGAGGGLGGGAGGGGGAGGG 235 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGG G Sbjct: 238 GGAGGGGGLGGGAGGGLGGGAG 259 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = -3 Query: 430 GGGGGXPPPXXGG--GGXGGGGG 368 GGGGG GG GG GGGGG Sbjct: 241 GGGGGLGGGAGGGLGGGAGGGGG 263 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGG--GGXPPPXXGGGGXGGGGG 368 GGGG GG GG G GGGGG Sbjct: 260 GGGGLSGGAGGGLGGGAGAGGGGG 283 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGG G Sbjct: 336 GGAGGGGGLGGGAGGGLGGGAG 357 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGG G Sbjct: 376 GGAGGGGGLGGGAGGGLGGGAG 397 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGG G Sbjct: 416 GGAGGGGGLGGGAGGGLGGGAG 437 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GG G Sbjct: 449 GGGGGLGGGAGGGGGLDGGAG 469 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGG G Sbjct: 494 GGAGGGGGLGGGAGGGLGGGAG 515 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 43 GGGGGFGGGGGLGGGGGAGGG 63 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 76 GGFGGGKGGGLGGGG-GLGGG 95 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 114 GGFGGGKGGGLGGGG-GLGGG 133 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 148 GGAGGGLGGGAGGGG-GLGGG 167 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 166 GGAGGGLGGGAGGGG-GVGGG 185 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 216 GGAGGGLGGGAGGGG-GAGGG 235 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 230 GGAGGGLGGGAGGGG-GLGGG 249 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGGG Sbjct: 282 GGLGGGTGGGGGLGGGTGGGGG 303 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GGGG GGG G Sbjct: 439 GGGFGGGAGAGGGGGLGGGAG 459 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGG G Sbjct: 504 GGAGGGLGGGAGAGGGFGGGKG 525 >02_05_1277 - 35408097-35409080 Length = 327 Score = 34.3 bits (75), Expect = 0.12 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP P PPPP Sbjct: 62 PPPPPPAQPPVLAAPAPAPPPP 83 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPPPXPPP--PXXGGGXPPPPPP 434 PPPPP PP PPP PP Sbjct: 63 PPPPPAQPPVLAAPAPAPPPPQPP 86 >01_05_0490 + 22672241-22674679 Length = 812 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP PPPP PPPPPP Sbjct: 691 PPSPPLPPPP------PPPPPP 706 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP PPPP PP PP Sbjct: 638 PPQPPPPPPPTTRRSRKPPQPP 659 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPPPP PPPP G PP Sbjct: 697 PPPPPPPPPPMSEGEEEAPP 716 Score = 31.5 bits (68), Expect = 0.85 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPX------PPPPXXGGGXPPPPPP 434 PPPPP PP P PPPPPP Sbjct: 643 PPPPPTTRRSRKPPQPPSRPAPPPPPPP 670 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PPPP G PP Sbjct: 697 PPPPPPPPPPMSEGEEEAPP 716 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 7/29 (24%) Frame = +3 Query: 369 PPPPPXP-------PPPXXGGGXPPPPPP 434 PPPPP P PP PPPPPP Sbjct: 641 PPPPPPPTTRRSRKPPQPPSRPAPPPPPP 669 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PP P PPPP P PP P Sbjct: 658 PPSRPAPPPPPPPQQQPPFYP 678 Score = 28.7 bits (61), Expect = 6.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 326 PXPXPPPPXXPXXXPPXPP 382 P P P PP P PP PP Sbjct: 688 PLPPPSPPLPPPPPPPPPP 706 >01_01_0995 + 7875273-7875495,7876196-7876274,7876422-7876536, 7878507-7878761 Length = 223 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 2 GGGGGDEREKAKGGGGGGGGGG 23 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG GGGG GGGGG Sbjct: 3 GGGGDEREKAKGGGGGGGGGGG 24 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PP P P PP G P PPP Sbjct: 34 PPSYPPPRPPVVGYPQPAPPP 54 >01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593, 7039698-7039768,7040148-7040224,7040380-7040527, 7040973-7041134,7041374-7041694 Length = 597 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PP G PPPPPP Sbjct: 111 PPPPPPPHLLHYYGHPPPPPP 131 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P G PPPPPP Sbjct: 111 PPPPPPPHLLHYYGHPPPPPPP 132 Score = 33.1 bits (72), Expect = 0.28 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 11/32 (34%) Frame = +3 Query: 369 PPPPPXPPPPXXG---GG--------XPPPPP 431 PPPPP PPPP G GG PPPPP Sbjct: 126 PPPPPPPPPPFKGDHYGGVYQNWQQNGPPPPP 157 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 4/23 (17%) Frame = +3 Query: 378 PPXPPPPXX----GGGXPPPPPP 434 PP PPPP G PPPPPP Sbjct: 111 PPPPPPPHLLHYYGHPPPPPPPP 133 Score = 28.3 bits (60), Expect = 7.9 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 7/29 (24%) Frame = +3 Query: 369 PPPPPX-------PPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 113 PPPPPHLLHYYGHPPPP------PPPPPP 135 >12_02_1174 - 26696869-26698191 Length = 440 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPP PP Sbjct: 153 PPPPPPPPPP------PPPRPP 168 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP PPPP P PP PP Sbjct: 148 PPPSLPPPPPPPPPPPPPRPP 168 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPP PPPP PPPPPP Sbjct: 148 PPPSLPPPPPP---PPPPPPP 165 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP PPP PPPPPP Sbjct: 141 PPPVKPQPPPSLPPPPPPPPPP 162 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP P PPP PPPPPP Sbjct: 142 PPVKPQPPPSLPPPPPPPPPPP 163 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PP P Sbjct: 156 PPPPPPPPPPRPPSVKPPVVQP 177 Score = 32.3 bits (70), Expect = 0.48 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPP 373 PPP P PPPP P PP Sbjct: 156 PPPPPPPPPPRPPSVKPP 173 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PPP PPP PPPPPP Sbjct: 146 PQPPPSLPPPPP---PPPPPPP 164 Score = 31.5 bits (68), Expect = 0.85 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPP 425 PPPPP PPPP PP Sbjct: 155 PPPPPPPPPPPRPPSVKPP 173 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP PPP P PP PP Sbjct: 141 PPPVKPQPPPSLPPPPPPPPP 161 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PP P PPP P PP PP Sbjct: 142 PPVKPQPPPSLPPPPPPPPPP 162 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP Sbjct: 153 PPPPPPPPPPPPPRPPSVKPP 173 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PPP PPP PPPPPP Sbjct: 210 PQPPPTLPPPS-----PPPPPP 226 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P P P Sbjct: 217 PPPSPPPPPPTVPPRTPGDTP 237 Score = 29.1 bits (62), Expect = 4.5 Identities = 16/59 (27%), Positives = 16/59 (27%) Frame = +2 Query: 206 PNPVNPXLGXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPPPXPXPPPPXXPXXXPPXPP 382 P PV P PPP P P P PP P P PP Sbjct: 141 PPPVKPQPPPSLPPPPPPPPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPPTRPP 199 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 8/30 (26%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXP--------PPPPP 434 PPPPP PP G P PPPPP Sbjct: 221 PPPPPPTVPPRTPGDTPAVVEPKPQPPPPP 250 Score = 28.7 bits (61), Expect = 6.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 326 PXPXPPPPXXPXXXPPXPP 382 P P PPP P PP PP Sbjct: 208 PKPQPPPTLPPPSPPPPPP 226 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 8/30 (26%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGX--------PPPPPP 434 PPPPP PP G PPPPPP Sbjct: 222 PPPPPTVPPRTPGDTPAVVEPKPQPPPPPP 251 Score = 28.3 bits (60), Expect = 7.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 13/35 (37%) Frame = +3 Query: 369 PPPPPXPP-------------PPXXGGGXPPPPPP 434 PPPPP PP PP PPPPPP Sbjct: 161 PPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPP 195 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 P P PPP PPPPP Sbjct: 208 PKPQPPPTLPPPSPPPPPP 226 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPP Sbjct: 296 PPPPSPPPPPQQPSQRYWTPPP 317 >10_08_0116 + 14935582-14936089,14936850-14937188,14937914-14937960, 14938175-14938264 Length = 327 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 188 GSGGGGSGGGGGGGGGGGGGGG 209 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGGG Sbjct: 190 GGGGSGGGGGGGGGGGGGGGGG 211 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G G GG GGGG GGGGG Sbjct: 186 GHGSGGGGSGGGGGGGGGGGGG 207 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 188 GSGGGGSGGGGGGGGGGGGGG 208 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 190 GGGGSGGGGGGGGGGGGGGGG 210 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 191 GGGSGGGGGGGGGGGGGGGGG 211 >09_06_0172 + 21329904-21331512,21331595-21331740,21332333-21332556, 21333689-21334448 Length = 912 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPP PPP G G PPPP Sbjct: 161 PPPQMGPPPPYGSGYAPPPP 180 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPP PPPP G PPPP Sbjct: 161 PPPQMGPPPPYGSGYAPPPP 180 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG P GG G G GG Sbjct: 218 GGGGGGGYAPGYGGMGVGDGG 238 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GG GG Sbjct: 219 GGGGGGYAPGYGGMGVGDGGSGG 241 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPP PP Sbjct: 264 PPPPPPPPPP------PPPMPP 279 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPP----PPXPPPPXXGGGXPPPPPP 434 PPP PP PPPP PPPPPP Sbjct: 257 PPPQSVRPPPPPPP------PPPPPP 276 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPPPXPPPPXXGG--GXPPPPPP 434 PPPPP PP P PPPP Sbjct: 272 PPPPPMPPRTDNASTQAAPAPPPP 295 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 2/23 (8%) Frame = +2 Query: 320 PPPXPX--PPPPXXPXXXPPXPP 382 PPP PPPP P PP PP Sbjct: 257 PPPQSVRPPPPPPPPPPPPPMPP 279 >09_04_0608 + 18924648-18924899,18926341-18926435,18926903-18927236, 18927345-18927582,18927813-18928069 Length = 391 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 27 GAGGGGSGGVGGGGGGGGGGGG 48 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 27 GAGGGGSGGVGGGGGGGGGGG 47 >09_04_0580 + 18681019-18681475,18682637-18682920,18683088-18683315, 18683415-18683864 Length = 472 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGGG Sbjct: 102 GGGGGGGGGGGGGGGGGGGGG 122 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 102 GGGGGGGGGGGGGGGGGGGGG 122 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 102 GGGGGGGGGGGGGGGGGGGGG 122 >08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147, 1602532-1602600 Length = 390 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPP 425 PPPPP PPPP G P P Sbjct: 19 PPPPPPPPPPLPPRGSPAP 37 Score = 31.5 bits (68), Expect = 0.85 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PPPP P P P Sbjct: 18 PPPPPPPPPPPLPPRGSPAP 37 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPPPP PPPP P P Sbjct: 18 PPPPPPPPPPPLPPRGSPAP 37 Score = 24.2 bits (50), Expect(2) = 4.2 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 605 PPXPPPPXPXGG 640 PP PPPP P G Sbjct: 22 PPPPPPPLPPRG 33 Score = 23.4 bits (48), Expect(2) = 4.2 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 602 SPPXPPPPXP 631 +PP PPPP P Sbjct: 17 APPPPPPPPP 26 >08_01_0059 - 394001-394708 Length = 235 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPP PPPP PP PP Sbjct: 11 PPPPATPPPPPRRAPPPPSPP 31 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPP PPP PP Sbjct: 11 PPPPATPPPPPRRAPPPPSPP 31 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPPPX--PPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPP P Sbjct: 17 PPPPPRRAPPPPSPPIRPPPPPTP 40 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP PPPP P PP P Sbjct: 19 PPPRRAPPPPSPPIRPPPPP 38 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = +3 Query: 369 PPPPPX--PPPPXXGGGXPPPPP 431 PPPPP PPPP PPPPP Sbjct: 3 PPPPPRRAPPPP----ATPPPPP 21 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP PPPP PP PP Sbjct: 11 PPPPATPPPPPRRAPPPPSPP 31 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP PPP P PP PP Sbjct: 18 PPPPRRAPPPPSPPIRPPPPP 38 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPP--PPXPPPPXXGGGXPPPPPP 434 PPP P PPPP P PPPP Sbjct: 46 PPPSHPLAPPPPHISPPAPVPPPP 69 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 2/23 (8%) Frame = +2 Query: 320 PPPXPX--PPPPXXPXXXPPXPP 382 PPP P PPPP P P PP Sbjct: 26 PPPSPPIRPPPPPTPRPYAPPPP 48 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 P PP PPPP PPPP Sbjct: 28 PSPPIRPPPPPTPRPYAPPPP 48 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 4/24 (16%) Frame = +3 Query: 369 PPPPPXP----PPPXXGGGXPPPP 428 PPPPP P PPP PPPP Sbjct: 34 PPPPPTPRPYAPPPPSHPLAPPPP 57 >07_03_0560 + 19479597-19480667 Length = 356 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 200 GGAGGGGGMGGGGGGGFGGGGG 221 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 125 GGGGGGGLGGGGGGGVGGGGG 145 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 234 GGAGGGGGLGGGGGGGMGGGGG 255 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 167 GGGGGGGFGGDGGGGLGGGGG 187 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 74 GGGGGGG---LGGGGGFGGGGG 92 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGGG Sbjct: 83 GGGGFGGGGGAGGGGGLGGGGG 104 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGGG Sbjct: 116 GGGGEGGGLGGGGGGGLGGGGG 137 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGGG Sbjct: 77 GGGGLGGGGGFGGGGGAGGGGG 98 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 103 GGKGGGFGGGVGGGGGGEGGG 123 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 114 GGGGGGEGGGLGGGGGGGLGGG 135 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 115 GGGGGEGGGLGGGGGGGLGGG 135 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 125 GGGGGGGLGGGGGGGVGGGGG 145 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 167 GGGGGGGFGGDGGGGLGGGGG 187 Score = 32.3 bits (70), Expect = 0.48 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 1/60 (1%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXFXFXPKXGF-TGFG 205 GG GG G GG G G GGG GGG F G GFG Sbjct: 283 GGGGGGGLGGGGGAGGGLGGGAGGGLGHGGGLGGGLGHGGGLGGGGFGVGVGVGVGVGFG 342 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 G GGG GGGG GGGGG Sbjct: 193 GAGGGVGGGAGGGGGMGGGGG 213 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 G GGG GGGG GGGGG Sbjct: 227 GAGGGMGGGAGGGGGLGGGGG 247 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGG G Sbjct: 243 GGGGGGGMGGGGGGGMGGGAG 263 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGG G Sbjct: 284 GGGGGGLGGGGGAGGGLGGGAG 305 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG G GGG Sbjct: 134 GGGGGGVGGGGGQGGGFGAGGG 155 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG G GGG Sbjct: 210 GGGGGGFGGGGGKGGGFGAGGG 231 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG G GGG Sbjct: 75 GGGGGGLGGGGGFGGGGGAGGG 96 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGG G Sbjct: 89 GGGGAGGGGGLGGGGGKGGGFG 110 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGG Sbjct: 199 GGGAGGGGGMGGGGGGGFGGGG 220 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GG G GGGGG Sbjct: 237 GGGGGLGGGGGGGMGGGGGGG 257 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GG GG Sbjct: 243 GGGGGGGMGGGGGGGMGGGAGG 264 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G G GGG Sbjct: 244 GGGGGGMGGGGGGGMGGGAGGG 265 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GG GG Sbjct: 251 GGGGGGGMGGGAGGGFGGGAGG 272 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G G GGG Sbjct: 252 GGGGGGMGGGAGGGFGGGAGGG 273 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GG G GGGGG Sbjct: 268 GGAGGGAGQGGSGGLGGGGGGG 289 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGG Sbjct: 76 GGGGGLGGGGGFGGGGGAGGGG 97 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 82 GGGGGFGGGGGAGGGGGLGGG 102 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGG GGGG Sbjct: 125 GGGGGGGLGGGGGGGVGGGGG 145 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 193 GAGGGVGGGAGGGGGMGGGGG 213 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 199 GGGAGGGGGMGGGGGGGFGGG 219 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 201 GAGGGGGMGGGGGGGFGGGGG 221 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGGG Sbjct: 220 GGKGGGFGAGGGMGGGAGGGGG 241 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 227 GAGGGMGGGAGGGGGLGGGGG 247 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGG Sbjct: 233 GGGAGGGGGLGGGGGGGMGGGG 254 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 233 GGGAGGGGGLGGGGGGGMGGG 253 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGG GGGGG Sbjct: 235 GAGGGGGLGGGGGGGMGGGGGG 256 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 235 GAGGGGGLGGGGGGGMGGGGG 255 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 243 GGGGGGGMGGGGGGGMGGGAG 263 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGG G Sbjct: 126 GGGGGGLGGGGGGGVGGGGGQG 147 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GGG G Sbjct: 183 GGGGGKEGGFGAGGGVGGGAG 203 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G G GG GGGGG Sbjct: 267 GGGAGGGAGQGGSGGLGGGGG 287 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GG GG Sbjct: 62 GGGGGFGGDGGFGGGGGGGLGG 83 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG G GGG Sbjct: 63 GGGGFGGDGGFGGGGGGGLGGG 84 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 65 GGFGGDGGFGGGGGGGLGGGGG 86 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGGG Sbjct: 97 GGLGGGGGKGGGFGGGVGGGGG 118 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGG GGGGG Sbjct: 98 GLGGGGGKGGGFGGGVGGGGGG 119 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG G GGG Sbjct: 102 GGGKGGGFGGGVGGGGGGEGGG 123 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 117 GGGEGGGLGGGGGGGLGGGGG 137 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 133 GGGGGGG---VGGGGGQGGGFG 151 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 135 GGGGGVGGGGGQGGGFGAGGG 155 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GGG G Sbjct: 141 GGGGGQGGGFGAGGGVGGGSG 161 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGG GGGG Sbjct: 167 GGGGGGGFGGDGGGGLGGGGG 187 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 209 GGGGGGG---FGGGGGKGGGFG 227 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 211 GGGGGFGGGGGKGGGFGAGGG 231 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GGG G Sbjct: 217 GGGGGKGGGFGAGGGMGGGAG 237 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GG G GG GG Sbjct: 260 GGAGGGFGGGAGGGAGQGGSGG 281 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 64 GGGFGGDGGFGGGGGGGLGGG 84 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 71 GGFGGGGGGGLGGGGGFGGGG 91 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 72 GFGGGGGGGLGGGGGFGGGGG 92 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 76 GGGGGLGGGGGFGGGGGAGGG 96 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGG Sbjct: 82 GGGGGFGGGGGAGGGGGLGGGG 103 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 84 GGGFGGGGGAGGGGGLGGGGG 104 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GG G GGGGG Sbjct: 110 GGGVGGGGGGEGGGLGGGGGGG 131 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 283 GGGGGGG---LGGGGGAGGGLG 301 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 79 GGLGGGG-GFGGGGGAGGGGG 98 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG GGGG GGG Sbjct: 88 GGGGGAGGGGGLGGGGGKGGG 108 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 88 GGGGGAGGGGGLGGGGGKGGG 108 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 118 GGEGGGLGGGGGGGLGGGGGG 138 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 123 GLGGGGGGGLGGGGGGGVGGG 143 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 130 GGLGGGGGGGVGGGG-GQGGG 149 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 G GGG GGG GGGGG Sbjct: 151 GAGGGVGGGSGTGGGLGGGGG 171 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 206 GGMGGGGGGGFGGGG-GKGGG 225 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 241 GLGGGGGGGMGGGGGGGMGGG 261 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GG GGGGG Sbjct: 267 GGGAGGGAGQGGSGGLGGGGGG 288 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 280 GGLGGGGGGGLGGGG-GAGGG 299 >06_03_0674 + 23422004-23422552,23423295-23423369,23424360-23424443, 23424749-23424991,23425348-23425515,23425608-23425727, 23426372-23427016 Length = 627 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGG Sbjct: 549 GGGGGGGYSGGGGGGGYSGGGG 570 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 550 GGGGGGYSGGGGGGGYSGGGGG 571 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 550 GGGGGGYSGGGGGGGYSGGGG 570 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 551 GGGGGYSGGGGGGGYSGGGGG 571 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 G GGG GGG GGGGG Sbjct: 542 GSGGGYSGGGGGGGYSGGGGG 562 Score = 28.3 bits (60), Expect = 7.9 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGG--GGXGGGGG 368 GG GGG GG GG GGGGG Sbjct: 575 GGRGGGYSRGGRGGYSGGGGGGGG 598 >06_01_0194 + 1503350-1503554,1504399-1504490,1504835-1504935, 1506186-1506276,1506616-1506674,1506764-1506884, 1506959-1507027,1507321-1507373,1507688-1507796, 1507895-1508065,1508148-1508306,1508561-1508650, 1508751-1508933,1509837-1510027,1510340-1510787 Length = 713 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 674 GGGGGRGRGGGGGGGRGGGGG 694 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 674 GGGGGRGRGGGGGGGRGGGGG 694 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GG G Sbjct: 683 GGGGGGRGGGGGGGGGRGGRG 703 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGG Sbjct: 672 GRGGGGGRGRGGGGGGGRGGGG 693 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GGGGG Sbjct: 674 GGGGGRGRGGGGGGGRGGGGGG 695 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GG G GGGGG Sbjct: 675 GGGGRGRGGGGGGGRGGGGGGG 696 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GG GG Sbjct: 680 GRGGGGGGGRGGGGGGGGGRGG 701 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GG G Sbjct: 682 GGGGGGGRGGGGGGGGGRGGRG 703 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 664 GGSRGRGRGRGGGGGRGRGGG 684 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 672 GRGGGGGRGRGGGGGGGRGGG 692 >04_04_1628 + 34874688-34874915,34875182-34875232,34875532-34875652, 34875739-34875788,34876395-34876524,34877007-34877170, 34877262-34877300,34877301-34877464,34877808-34877931, 34878002-34878103,34878208-34878297 Length = 420 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGGG Sbjct: 6 GGGGGGDESEFVGVGGGGGGGG 27 >03_05_0919 - 28792790-28792915,28793090-28793155,28794345-28794530, 28794604-28795141,28795290-28795363 Length = 329 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 162 GGDGGGGGDGNVGGGGGGGGGG 183 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 163 GDGGGGGDGNVGGGGGGGGGGG 184 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 165 GGGGGDGNVGGGGGGGGGGGG 185 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 165 GGGGGDGNVGGGGGGGGGGGGG 186 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGGG Sbjct: 166 GGGGDGNVGGGGGGGGGGGGGG 187 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 174 GGGGGGGGGGGGGGGGGGGGDG 195 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXG--GGGG 368 GGGGGG GGGG G GGGG Sbjct: 154 GGGGGGDVGGDGGGGGDGNVGGGG 177 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG G GGGG GGGGG Sbjct: 167 GGGDGNVGGGGGGGGGGGGGGG 188 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGG G Sbjct: 150 GGGGGGGGGGDVGGDGGGGGDG 171 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG GGGGG Sbjct: 148 GGGGGGGGGGGGDVGGDGGGGG 169 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGX----GGGGG 368 GGGGGG GGGG GGGGG Sbjct: 153 GGGGGGGDVGGDGGGGGDGNVGGGGG 178 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 168 GGDGNVGGGGGGGGGGGGGGG 188 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 171 GNVGGGGGGGGGGGGGGGGGG 191 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 174 GGGGGGGGGGGGGGGGGGGG 193 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 163 GDGGGGGDGNVGGGGGGGGGG 183 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 166 GGGGDGNVGGGGGGGGGGGGG 186 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 167 GGGDGNVGGGGGGGGGGGGGG 187 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 165 GGGGGDGNVGGGGGGGGGGGG 185 >03_05_0690 + 26778567-26778804,26778950-26779024,26779995-26780099, 26780869-26781000,26781432-26781571,26782213-26782323, 26782690-26782812,26784166-26784267,26784536-26784546, 26784878-26785103,26785363-26785401,26785413-26785583, 26785674-26785753,26785976-26786039 Length = 538 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGGG Sbjct: 24 GGGGGGGVGGDRGGGGSGGGG 44 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGG--GGG 368 GGGGGG GGGG GG GGG Sbjct: 15 GGGGGGGGGGGGGGGGVGGDRGGG 38 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGG G Sbjct: 25 GGGGGGVGGDRGGGGSGGGGPG 46 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGG Sbjct: 23 GGGGGGGGVGGDRGGGGSGGGG 44 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG G GG Sbjct: 13 GGGGGGGGGGGGGGGGGGVGG 33 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GG GG Sbjct: 13 GGGGGGGGGGGGGGGGGGVGG 33 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 11 GRGGGGGGGGGGGGGGGGGG 30 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGG G Sbjct: 11 GRGGGGGGGGGGGGGGGGGGVG 32 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGG Sbjct: 18 GGGGGGGGGGGGGVGGDRGGGG 39 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGG--GGXGGGGG 368 GGGGGG GG GG G GGG Sbjct: 20 GGGGGGGGGGGVGGDRGGGGSGGG 43 >02_05_0407 + 28715332-28715385,28715528-28715680,28715810-28715872, 28715988-28716021,28716157-28716279,28716400-28716462, 28716655-28716748,28717049-28717094,28717180-28717247, 28717360-28717408,28717593-28717658,28718876-28719074, 28719344-28719386,28719719-28719923 Length = 419 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 20 GGGGGARRGGGGGGGGGGGGG 40 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 20 GGGGGARRGGGGGGGGGGGGG 40 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG GGGG GGGG Sbjct: 20 GGGGGARRGGGGGGGGGGGGG 40 >02_02_0240 + 8196140-8198248,8198381-8198650 Length = 792 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 P PPPP GGG P PPP Sbjct: 19 PQQPPPPPPGGGAKPEPPP 37 Score = 31.5 bits (68), Expect = 0.85 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 P PPPP GG P PPP Sbjct: 19 PQQPPPPPPGGGAKPEPPP 37 >01_07_0082 - 40965947-40967023 Length = 358 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPP 431 P PPPP G G PPPPP Sbjct: 265 PAQPPPPQAGYGYPPPPP 282 >01_01_0715 - 5542648-5543219,5543352-5543544 Length = 254 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P PP P P G PPPPPP Sbjct: 175 PSPPVPAPAPAGSPPPPPPPP 195 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PP P P G PPPPPP Sbjct: 175 PSPPVPAPAP--AGSPPPPPPP 194 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PPP P P P PPPP Sbjct: 143 PSPPPPPTVPAAPTPRPSPPPP 164 Score = 28.7 bits (61), Expect = 6.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPP 431 PP PPPP GG P P Sbjct: 188 PPPPPPPPAGGNFTAPSP 205 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPP 428 PPP PPPP G P P Sbjct: 188 PPPPPPPPAGGNFTAPSP 205 >07_03_1140 - 24258627-24258849,24259967-24260089,24260200-24260921, 24260945-24261073,24261484-24261714 Length = 475 Score = 27.9 bits (59), Expect(2) = 0.18 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 405 GGGXPPPPPP 434 GGG PPPPPP Sbjct: 56 GGGWPPPPPP 65 Score = 24.6 bits (51), Expect(2) = 0.18 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +3 Query: 381 PXPPPPXXGGGXPPPP 428 P PPP GGG P P Sbjct: 18 PPQPPPSTGGGIPQLP 33 >11_04_0307 + 16185405-16185713,16185847-16185942,16186626-16186730, 16186938-16187090,16188395-16188478,16188566-16188694, 16188986-16189165,16189555-16189677,16189678-16189794, 16189889-16190053 Length = 486 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P PP PP P PPPPPP Sbjct: 28 PSPPVPPDPYGADLSPPPPPP 48 >10_08_0630 - 19410852-19411235,19411370-19412257,19412440-19412941, 19413662-19414135,19414982-19415040,19415468-19415629 Length = 822 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P PPPPP Sbjct: 431 PPPPPSHPTPITSVAPAPPPPP 452 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPP P P PPPPPP Sbjct: 432 PPPPSHPTPITSVAPAPPPPPP 453 >09_01_0112 + 1737438-1737777,1738441-1738511,1738974-1739052, 1741559-1741641,1741733-1741784,1742038-1742105, 1742279-1742345,1742426-1742505,1742576-1742640, 1742785-1742847,1743271-1743427,1743511-1743588, 1743677-1744219,1744321-1744497,1744534-1744788, 1745270-1745329,1745874-1745888,1746123-1746135, 1746819-1746934 Length = 793 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/27 (59%), Positives = 16/27 (59%), Gaps = 5/27 (18%) Frame = -3 Query: 433 GGGGGGXPP-----PXXGGGGXGGGGG 368 GGGG G PP GGGG GGGGG Sbjct: 39 GGGGSGSPPHRFSRGGGGGGGDGGGGG 65 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGGG Sbjct: 53 GGGGGG----GDGGGGGGGGG 69 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P G GGGG Sbjct: 64 GGGGGGRFHPYRGPSDHSGGGG 85 >07_03_1530 + 27502546-27502671,27503487-27503561,27504670-27504746, 27505576-27507522,27508478-27508946,27509898-27510079, 27510746-27511208,27511295-27511691,27511810-27511937, 27512106-27512273,27512452-27512559,27512830-27512838 Length = 1382 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPPPP PPPP PP P Sbjct: 1159 PPPPPLPPPPPVAPFHPPGP 1178 Score = 31.5 bits (68), Expect = 0.85 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PPPP PP P Sbjct: 1159 PPPPPLPPPPPVAPFHPPGP 1178 >07_01_0282 - 2070027-2070041,2074763-2075062,2075154-2075722, 2075812-2076337 Length = 469 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP P G PP P Sbjct: 427 PPPPPHPPSPSAEGSASPPTTP 448 >06_02_0046 + 10928708-10928798,10929997-10930077,10930567-10930685, 10931275-10931894,10931992-10933184,10933280-10933359, 10933751-10933846,10933931-10934004,10936007-10936151, 10936323-10936487 Length = 887 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 4/25 (16%) Frame = +3 Query: 369 PPPPPX----PPPPXXGGGXPPPPP 431 PPPPP PPPP PPPPP Sbjct: 494 PPPPPEDEWIPPPPPENEPAPPPPP 518 >05_04_0303 - 20010761-20011756 Length = 331 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGGGG Sbjct: 46 GGGGGGVGGGVVGGDGVGGGGG 67 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGG GGGG GGGGG Sbjct: 51 GVGGGVVGGDGVGGGGGGGGGG 72 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG G GGGG GGGGG Sbjct: 53 GGGVVGGDGVGGGGGGGGGGGG 74 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 54 GGVVGGDGVGGGGGGGGGGGGG 75 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 55 GVVGGDGVGGGGGGGGGGGGG 75 >04_04_0760 - 27837170-27837328,27837441-27837504,27837812-27838160, 27838906-27838960,27839489-27839821 Length = 319 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP P PPPP Sbjct: 9 PPPPPPPPSESTPTSDPKPPPP 30 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P PPPPP Sbjct: 10 PPPPPPPSESTPTSDPKPPPPP 31 >03_05_0843 + 28126480-28127007,28127092-28127457,28129388-28129487, 28130266-28130546,28130643-28130705,28131276-28131431, 28131913-28132080,28132158-28132298,28132714-28132840, 28132888-28132994,28134142-28134372,28134446-28134559, 28135091-28135261 Length = 850 Score = 33.5 bits (73), Expect = 0.21 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPP 422 PPPPP PPPP PP Sbjct: 39 PPPPPLPPPPPRSNSAPP 56 Score = 29.1 bits (62), Expect = 4.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPP 373 PPP P PPPP PP Sbjct: 39 PPPPPLPPPPPRSNSAPP 56 >03_05_0630 + 26260159-26260272,26260520-26260894 Length = 162 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 97 GGGGGGYGGGRGGGGYGGGGG 117 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 97 GGGGGGYGGGRGGGGYGGGGGG 118 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 97 GGGGGGYGGGRGGGGYGGGGG 117 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGG Sbjct: 90 GGGGGGYGGGGGGYGGGRGGGG 111 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/57 (29%), Positives = 19/57 (33%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXFXFXPKXGFTG 211 GG GG G GGG G GGG GGG + G+ G Sbjct: 98 GGGGGYGGGRGGGGYGGGGGGGYGRREGGYGGGGGYGGGRGGGGGGYGGSRGGGYGG 154 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GG GG Sbjct: 114 GGGGGGYGRREGGYGGGGGYGG 135 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGG G Sbjct: 113 GGGGGGGYGRREGGYGGGGGYG 134 >03_02_0350 - 7734494-7734952,7735765-7736133 Length = 275 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 12 GGGGGGGGSGGGGGGPSGGGGG 33 Score = 31.5 bits (68), Expect = 0.85 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGG--GGXGGGGG 368 GGGGGG GG GG GGGGG Sbjct: 13 GGGGGGGSGGGGGGPSGGGGGGGG 36 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG GG G Sbjct: 18 GGSGGGGGGPSGGGGGGGGPCG 39 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 13 GGGGGGGSGGGGGGPSGGGGG 33 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GGGG GGGGG Sbjct: 4 GGGASSALGGGGGGGGSGGGGG 25 >12_02_0079 + 13310066-13310652,13310737-13310954,13311099-13311347, 13312012-13312076,13312367-13312465 Length = 405 Score = 33.1 bits (72), Expect = 0.28 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPP P P P GG PPPP Sbjct: 6 PPPGPPHPAPMADGGEPPPP 25 >12_01_0477 + 3742751-3745200,3747192-3747502,3747886-3748232 Length = 1035 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GG GG Sbjct: 61 GGGGGGGGGGGGGGGGRGGRGG 82 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG G GG Sbjct: 59 GGGGGGGGGGGGGGGGGGRGG 79 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GG GG Sbjct: 59 GGGGGGGGGGGGGGGGGGRGG 79 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GG G Sbjct: 60 GGGGGGGGGGGGGGGGGRGGRG 81 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 12/34 (35%) Frame = +3 Query: 369 PPPPPXPPPP------------XXGGGXPPPPPP 434 PPPPP PPPP G PPPPPP Sbjct: 27 PPPPPHPPPPPPLEPAPPSTPQLRGEASPPPPPP 60 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP PP P Sbjct: 27 PPPPPHPPPPPPLEPAPPSTP 47 >09_04_0506 - 18188785-18190599 Length = 604 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG P GGGG GGGGG Sbjct: 314 GGGGGGP----GGGGGGGGGG 330 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 GG GGG P GGGG GGG Sbjct: 311 GGRGGGGGGPGGGGGGGGGG 330 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG GG G Sbjct: 312 GRGGGGGGPGGGGGGGGGGNWG 333 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 4/24 (16%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPP----PPP 434 PPP PPPP PPP PPP Sbjct: 50 PPPQPPPPPQQQQQPPPISQQPPP 73 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGG 322 GG GG G GGGG G GG Sbjct: 311 GGRGGGGGGPGGGGGGGGGG 330 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GG G Sbjct: 323 GGGGGGGGNWGRGGGGMGGRG 343 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 310 GGGRGGGGGGPGGGGGGGGGG 330 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 298 GGPGGAQVGGNYGGGRGGGGG 318 >08_01_0202 - 1638978-1639571 Length = 197 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGGG Sbjct: 110 GGGYGGGDRGYGGGGGYGGGGG 131 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGGG Sbjct: 157 GGGYGGGGGGYRGGGGGGGGGG 178 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 111 GGYGGGDRGYGGGGGYGGGGG 131 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 158 GGYGGGGGGYRGGGGGGGGGG 178 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXG--GGGXGGGGG 368 GGGGGG G GGG GGGGG Sbjct: 154 GGGGGGYGGGGGGYRGGGGGGGGG 177 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GGGGG Sbjct: 153 GGGGGGGYGGGGGGYRGGGGG 173 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGG Sbjct: 109 GGGGYGGGDRGYGGGGGYGGGG 130 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GG GG Sbjct: 107 GGGGGGYGGGDRGYGGGGGYGG 128 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG GGGGG Sbjct: 153 GGGGGGGYGGGGGGYRGGGGGG 174 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGG G Sbjct: 93 GGGGGGRYGGDRGYGGGGGGYG 114 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGGG Sbjct: 111 GGYGGGDRGYGGGGGYGGGGGG 132 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 153 GGGGGGGYGGGGGGYRGGGGG 173 >07_03_0559 + 19475893-19476783 Length = 296 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 162 GGGGGGGFGGGGGGGIGGGGG 182 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 75 GGGGGGL----GGGGGFGGGGG 92 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 162 GGGGGGGFGGGGGGGIGGGGG 182 Score = 31.9 bits (69), Expect = 0.64 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 65 GGFGGGGGFRGGGGGGLGGGGG 86 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGG GGGG GGGGG Sbjct: 195 GAAGGGGGMGSGGGGGFGGGGG 216 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GGGGG Sbjct: 120 GGGGGGGFGGGSGGGVGGGGG 140 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG G GGG Sbjct: 171 GGGGGGIGGGGGKGGGFGAGGG 192 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGGG Sbjct: 103 GGFGGGVGGGSGAGGGLGGGGG 124 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG G G GGGG GGGGG Sbjct: 153 GGSGTGGGLGGGGGGGFGGGGG 174 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 110 GGGSGAGGGLGGGGGGGFGGG 130 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 120 GGGGGGGFGGGSGGGVGGGGG 140 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 152 GGGSGTGGGLGGGGGGGFGGG 172 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGGG Sbjct: 215 GGKGGGFGAGGVMGGGAGGGGG 236 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGG G Sbjct: 89 GGGGGGLGGGGCEGGGFGGGVG 110 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGG GGGG Sbjct: 120 GGGGGGGFGGGSGGGVGGGGG 140 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGG G Sbjct: 121 GGGGGGFGGGSGGGVGGGGGQG 142 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 G GGG GGGG G GGG Sbjct: 188 GAGGGVGGAAGGGGGMGSGGG 208 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GG GGG GGGG GGGG Sbjct: 79 GGLGGGGGFGGGGGGGLGGGG 99 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGG G Sbjct: 125 GGFGGGSGGGVGGGGGQGGGFG 146 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GGG G Sbjct: 136 GGGGGQGGGFGAGGGVGGGSG 156 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGG GGGG Sbjct: 162 GGGGGGGFGGGGGGGIGGGGG 182 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGG G Sbjct: 163 GGGGGGFGGGGGGGIGGGGGKG 184 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 170 GGGGGGG---IGGGGGKGGGFG 188 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 172 GGGGGIGGGGGKGGGFGAGGG 192 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG G GGG Sbjct: 63 GGGGFGGGGGFRGGGGGGLGGG 84 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 64 GGGFGGGGGFRGGGGGGLGGG 84 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 72 GFRGGGGGGLGGGGGFGGGGG 92 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG G G GGGG GGG G Sbjct: 111 GGSGAGGGLGGGGGGGFGGGSG 132 Score = 28.7 bits (61), Expect = 6.0 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXFXFXPKXGFTGFG 205 GG GG G GGGG G GGG GGG K G GFG Sbjct: 167 GGFGGGGGGGIGGGG-GKGGGFGAGGGVGGAAGGGGGMGSGGGGGFGGGGGKGG--GFG 222 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GG GG Sbjct: 76 GGGGGLGGGGGFGGGGGGGLGG 97 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG G GGG Sbjct: 77 GGGGLGGGGGFGGGGGGGLGGG 98 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 79 GGLGGGG-GFGGGGGGGLGGG 98 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 125 GGFGGGSGGGVGGGG-GQGGG 144 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG G GGG Sbjct: 129 GGSGGGVGGGGGQGGGFGAGGG 150 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 G GGG GGG GGGGG Sbjct: 146 GAGGGVGGGSGTGGGLGGGGG 166 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 160 GLGGGGGGGFGGGGGGGIGGG 180 >06_03_1370 + 29645598-29646288,29646364-29646752 Length = 359 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GG GG Sbjct: 8 GGGGGGGGGGGVGGGGGGGRGG 29 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGG--GGG 368 GGGGGG GGGG GG GGG Sbjct: 11 GGGGGGGGVGGGGGGGRGGERGGG 34 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXGG-GGXGGGGG 368 GGGGGG GG GG GGGG Sbjct: 13 GGGGGGVGGGGGGGRGGERGGGG 35 >06_03_0867 + 25534760-25539620,25540662-25540857,25540957-25541104, 25541673-25541751,25542151-25542238,25542330-25542600, 25542676-25542718,25542801-25542904,25543374-25543790 Length = 2068 Score = 33.1 bits (72), Expect = 0.28 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 P PPP PPPP PPPP Sbjct: 89 PTPPPPPPPPLPQHRLEPPPP 109 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP PPPP Sbjct: 89 PTPPPPPPPPLPQHRLEPPPP 109 >06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 Length = 304 Score = 33.1 bits (72), Expect = 0.28 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PPP PPPP PPP P Sbjct: 53 PHPPPPPPPPQPAKEPPPPTKP 74 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPP P P PPPPP Sbjct: 68 PPPPTKPKHPKPKQQQHPPPPP 89 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXP 379 P P PPPP P PP P Sbjct: 53 PHPPPPPPPPQPAKEPPPP 71 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +1 Query: 718 PXXXPPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 P PPPP P PPPPPP Sbjct: 55 PPPPPPPPQPAKEPPPPTKPKHPKPKQQQHPPPPPP 90 >06_01_0178 + 1386981-1387505 Length = 174 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GG GG Sbjct: 38 GGGGGGGGGGGGGGGGAGGKGG 59 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 30 GGRGGASGGGGGGGGGGGGGG 50 Score = 31.9 bits (69), Expect = 0.64 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 37 GGGGGGG-----GGGGGGGGGG 53 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GG GG Sbjct: 72 GGGGGGGKGRKGGAGGHGGAGG 93 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 27 GGRGGRGGASGGGGGGGGGGG 47 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 30 GGRGGASGGGGGGGGGGGGGG 50 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GG GG Sbjct: 94 GGGGGGGKGRKGGRGGDGGSGG 115 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 27 GGRGGRGGASGGGGGGGGGGGG 48 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GG G GGGG GGGGG Sbjct: 28 GRGGRGGASGGGGGGGGGGGGG 49 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 30 GGRGGASGGGGGGGGGGGGGGG 51 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GG GG Sbjct: 41 GGGGGGGGGGGGGAGGKGGKGG 62 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GG GG Sbjct: 44 GGGGGGGGGGAGGKGGKGGAGG 65 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GG GG Sbjct: 47 GGGGGGGAGGKGGKGGAGGHGG 68 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G G GG GGGGG Sbjct: 75 GGGGKGRKGGAGGHGGAGGGGG 96 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GG G GGGG GGGGG Sbjct: 25 GRGGRGGRGGASGGGGGGGGGG 46 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 27 GGRGGRGGASGGGGGGGGGGG 47 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 33 GGASGGGGGGGGGGGGGGGGG 53 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G G GG GG GG Sbjct: 50 GGGGAGGKGGKGGAGGHGGAGG 71 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GG G Sbjct: 71 GGGGGGGGKGRKGGAGGHGGAG 92 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGG Sbjct: 73 GGGGGGKGRKGGAGGHGGAGGG 94 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GG GG GGGG GGGG Sbjct: 58 GGKGGAGGHGGAGGGGGGGGG 78 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GG GG GGG GGGGG Sbjct: 58 GGKGGAGGHGGAGGGGGGGGG 78 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GG G Sbjct: 93 GGGGGGGGKGRKGGRGGDGGSG 114 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G G GG GG GG Sbjct: 97 GGGGKGRKGGRGGDGGSGGAGG 118 >05_05_0313 - 24026142-24026708 Length = 188 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGG 371 GGGGG P GGG GGGG Sbjct: 85 GGGGGAPVDETSGGGGGGGG 104 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 GGGGG GGGG GGG Sbjct: 85 GGGGGAPVDETSGGGGGGGG 104 >05_05_0135 - 22626163-22626198,22626391-22626441,22626516-22626608, 22627249-22627254,22628051-22628180,22628333-22628583 Length = 188 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/26 (61%), Positives = 16/26 (61%), Gaps = 4/26 (15%) Frame = -3 Query: 433 GGGGG----GXPPPXXGGGGXGGGGG 368 GGGGG G P GGGG GGGGG Sbjct: 9 GGGGGSHESGSPRGGGGGGGGGGGGG 34 >03_05_0704 - 26953474-26953643,26953770-26953801,26953915-26954009, 26954107-26954180,26954283-26954412,26954522-26954585, 26954660-26954722,26954795-26954937,26955386-26955523, 26955610-26955731,26955805-26955976,26956559-26956630, 26956753-26956887,26956987-26957103,26957184-26957316, 26957455-26957561,26958060-26958077,26958235-26958379, 26958472-26958671,26960744-26961421 Length = 935 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGG Sbjct: 5 GGGGGGRRGGRGGGGGREGGGG 26 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGG G Sbjct: 13 GGRGGGGGREGGGGGGGGGGRG 34 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GG GG Sbjct: 14 GRGGGGGREGGGGGGGGGGRGG 35 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 5 GGGGGGRRGGRGGGGGREGGG 25 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 6 GGGGGRRGGRGGGGGREGGGG 26 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 13 GGRGGGG-GREGGGGGGGGGG 32 >03_02_0561 + 9466428-9466502,9466503-9467243,9467592-9467600 Length = 274 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGG 371 G GG P P GGGG GGGG Sbjct: 77 GSGGHAPHPESGGGGGGGGG 96 >03_02_0457 + 8638318-8638336,8640394-8640497,8640613-8640778, 8641403-8641467 Length = 117 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGG GGGGG Sbjct: 60 GGPGGGGPGGGPYGGGRGGGGG 81 >02_05_1057 + 33809982-33810366,33810436-33810687,33810727-33810926, 33811021-33811122 Length = 312 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/26 (61%), Positives = 16/26 (61%), Gaps = 4/26 (15%) Frame = -3 Query: 433 GGGGGGXP----PPXXGGGGXGGGGG 368 GGGGGG P GGGG GGGGG Sbjct: 31 GGGGGGVGGVFIPGIIGGGGGGGGGG 56 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGG GGGGG Sbjct: 71 GGGCGGENDDTGNGGGGGGGGG 92 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 72 GGCGGENDDTGNGGGGGGGGGG 93 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GGGGG Sbjct: 15 GGGGGGTAGACCPGAAGGGGGG 36 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GGG G Sbjct: 125 GGGGGNITVDGFRGGGSGGGRG 146 >02_05_0750 - 31479876-31480985 Length = 369 Score = 33.1 bits (72), Expect = 0.28 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPP PPP PPPPP Sbjct: 193 PPPPSPSPPPEPEPQLPPPPP 213 Score = 31.5 bits (68), Expect = 0.85 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PPP P PP P Sbjct: 194 PPPSPSPPPEPEPQLPPPPP 213 >02_02_0525 - 11182043-11182080,11182386-11182511,11182760-11183486 Length = 296 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +3 Query: 369 PPPPPXPP-PPXXGGGXPPPPPP 434 PPPPP PP PP P PPPP Sbjct: 7 PPPPPAPPSPPPALPCDPMPPPP 29 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP P P PP Sbjct: 9 PPPAPPSPPPALPCDPMPPPP 29 >02_01_0158 - 1103461-1104186 Length = 241 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGGG Sbjct: 84 GGGGGGGGFGSRGGGGSGGGG 104 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGG Sbjct: 83 GGGGGGGGGFGSRGGGGSGGGG 104 Score = 25.4 bits (53), Expect(2) = 0.53 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGG 374 GGG G GGGG GGG Sbjct: 142 GGGVGVGGGGGGGGGAGGG 160 Score = 25.4 bits (53), Expect(2) = 2.6 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -3 Query: 397 GGGGXGGGGG 368 GGGG GGGGG Sbjct: 180 GGGGGGGGGG 189 Score = 25.4 bits (53), Expect(2) = 0.53 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -3 Query: 397 GGGGXGGGGG 368 GGGG GGGGG Sbjct: 181 GGGGGGGGGG 190 Score = 23.0 bits (47), Expect(2) = 2.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGG 371 GGG GGGG GGG Sbjct: 142 GGGVGVGGGGGGGGGAGGG 160 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 4/25 (16%) Frame = +3 Query: 369 PPPPPXP----PPPXXGGGXPPPPP 431 PPPPP P PPP PPPPP Sbjct: 964 PPPPPPPPNVAPPPFTRQDIPPPPP 988 Score = 31.5 bits (68), Expect = 0.85 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P P P PP G PPPPPP Sbjct: 34 PASPRSPVPPPPGVPPPPPPPP 55 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +3 Query: 369 PPPPPXPPP-PXXGGGXPPPPP 431 PPPPP PPP P PPPP Sbjct: 984 PPPPPSPPPLPITQPPSVPPPP 1005 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPP P PPP Sbjct: 984 PPPPPSPPPLPITQPPSVPPP 1004 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXP 379 P P PPPP P PP P Sbjct: 37 PRSPVPPPPGVPPPPPPPP 55 Score = 28.3 bits (60), Expect = 7.9 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPPPXP---PPPXXGGGXP--PPPPP 434 PPPPP P PPP P PP PP Sbjct: 965 PPPPPPPNVAPPPFTRQDIPPPPPSPP 991 >12_02_1057 + 25733376-25735439 Length = 687 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Frame = +3 Query: 372 PPPPXPPP--PXXGGGXPPPPPP 434 PPPP PPP P PP PPP Sbjct: 256 PPPPLPPPSRPPSSSPAPPSPPP 278 >08_02_1063 + 24024030-24024506,24024803-24024856,24024965-24025118, 24025314-24025388,24025511-24025788,24026023-24026253, 24026522-24026620,24026740-24026889,24027830-24027976, 24028525-24028575,24028647-24028819,24029018-24029147, 24029361-24029458,24029655-24029892,24030634-24030837, 24031003-24031083,24031296-24031535 Length = 959 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 112 GGGGGGG---GDGGGGGGGGGG 130 >08_02_0839 + 21693348-21694853 Length = 501 Score = 32.7 bits (71), Expect = 0.37 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPPPP P PP PPPP Sbjct: 29 PPPPPPPQPPLLQLQPPPPP 48 Score = 31.9 bits (69), Expect = 0.64 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PP P PPPPP Sbjct: 29 PPPPPPPQPPLLQLQPPPPP 48 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPP PPPPP Sbjct: 29 PPPPPPPQPPLLQLQPPPPP 48 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P P PP PP P Sbjct: 29 PPPPPPPQPPLLQLQPPPPP 48 >07_03_1751 - 29215074-29216270 Length = 398 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 113 GGFGGGKGGGLGGGGGLGGGGG 134 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGG G Sbjct: 175 GGAGGGLGGGSGGGGGLGGGAG 196 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGGG Sbjct: 193 GGAGGGAGVGGGAGGGAGGGGG 214 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGGG Sbjct: 207 GGAGGGGGLGGGAGGGAGGGGG 228 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGGG Sbjct: 221 GGAGGGGGLGGGAGGGHGGGGG 242 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGG GG GGGG GGGG Sbjct: 290 GGGFGGGKGGGFGGGGGGGGG 310 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG G GGG Sbjct: 295 GGKGGGFGGGGGGGGGAGAGGG 316 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGG G Sbjct: 291 GGFGGGKGGGFGGGGGGGGGAG 312 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG G GGG Sbjct: 335 GGVGGGAGGGFGGGGGAGAGGG 356 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GG G G GGG Sbjct: 124 GGGGGLGGGGGGGAGGGLGGG 144 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GG G G GGG Sbjct: 164 GGGGGLGGGAGGGAGGGLGGG 184 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGG G Sbjct: 213 GGLGGGAGGGAGGGGGLGGGAG 234 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGG G Sbjct: 227 GGLGGGAGGGHGGGGGLGGGAG 248 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGG 322 GG GG G GGGG G GG Sbjct: 291 GGFGGGKGGGFGGGGGGGGG 310 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GG GG Sbjct: 302 GGGGGGGGGAGAGGGFGGGKGG 323 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G G GGG Sbjct: 303 GGGGGGGGAGAGGGFGGGKGGG 324 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G G GG G GGG Sbjct: 363 GGFGGGVGGGHGAGGGGAGGG 383 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGG GG G Sbjct: 130 GGGGGGGAGGGLGGGAGGGAG 150 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GG G GGG G Sbjct: 143 GGAGGGAGAGVGGGAGAGGGAG 164 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGG GG GGG GGGG Sbjct: 170 GGGAGGGAGGGLGGGSGGGGG 190 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG G GG GGGG Sbjct: 192 GGGAGGGAGVGGGAGGGAGGGG 213 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGG G Sbjct: 305 GGGGGGAGAGGGFGGGKGGGFG 326 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGG Sbjct: 112 GGGFGGGKGGGLGGGGGLGGGG 133 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G G G G Sbjct: 131 GGGGGGAGGGLGGGAGGGAGAG 152 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG G G GGG GGGGG Sbjct: 147 GGAGAGVGGGAGAGGGAGGGGG 168 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GGGG GGG G Sbjct: 154 GGGAGAGGGAGGGGGLGGGAG 174 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GG G GGG G Sbjct: 186 GGGGGLGGGAGGGAGVGGGAG 206 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GG G GGG G Sbjct: 238 GGGGGLGGGAGGGAGVGGGAG 258 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG G GGG Sbjct: 245 GGAGGGAGVGGGAGGGAGAGGG 266 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GGG GGGGG Sbjct: 258 GGGAGAGGGLGAGGGAGGGGG 278 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 296 GKGGGFGGGGGGGGGAGAGGG 316 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 367 GGVGGGH---GAGGGGAGGGGG 385 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 114 GFGGGKGGGLGGGGGLGGGGG 134 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG G GG GGGG Sbjct: 206 GGGAGGGGGLGGGAGGGAGGGG 227 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG G GGG Sbjct: 271 GGAGGGGGIGGGAGGGAGAGGG 292 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 336 GVGGGAGGGFGGGGGAGAGGG 356 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GGGG GGG G Sbjct: 54 GGGKGGGVGVGGGGGFGGGAG 74 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 113 GGFGGGKGGGLGGGGGLGGGG 133 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 121 GGLGGGG-GLGGGGGGGAGGG 140 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 175 GGAGGGLGGGSGGGG-GLGGG 194 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 213 GGLGGGAGGGAGGGG-GLGGG 232 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 227 GGLGGGAGGGHGGGG-GLGGG 246 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GGG GGGGG Sbjct: 330 GGGKGGGVGGGAGGGFGGGGG 350 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG G GG Sbjct: 334 GGGVGGGAGGGFGGGGGAGAGG 355 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG G GGGG GGG G Sbjct: 370 GGGHGAGGGGAGGGGGFGGGAG 391 >07_03_0558 + 19461369-19462448 Length = 359 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 85 GGLGGGASGGVGGGGGFGGGGG 106 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 159 GGVGGGAGGGVGGGGGFGGGGG 180 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 56 GGFGGGGGGGLGGGGGGLGGG 76 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 G GGG GGGG GGGGG Sbjct: 122 GAGGGAGGGLGGGGGFGGGGG 142 Score = 31.5 bits (68), Expect = 0.85 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 129 GGLGGGGGFGGGGGGGLGGGGG 150 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 G GGG GGGG GGGGG Sbjct: 228 GAGGGAGGGIGGGGGFGGGGG 248 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGGG Sbjct: 221 GGQGGGFGAGGGAGGGIGGGGG 242 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GGGG GGGGG Sbjct: 43 GGGFGEGEGFGGGGGFGGGGG 63 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGGG Sbjct: 115 GGFGGGAGAGGGAGGGLGGGGG 136 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG G GGG Sbjct: 139 GGGGGGLGGGGGHGGGFGAGGG 160 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 53 GGGGGFG--GGGGGGLGGGGG 71 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGGG Sbjct: 189 GGFGGGAGVGGGAGGGVGGGGG 210 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 G GGG GGGG GGGGG Sbjct: 196 GVGGGAGGGVGGGGGFGGGGG 216 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGGG Sbjct: 257 GGFGGGAGVGSGAGGGVGGGGG 278 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 G GGG GGGG GGGGG Sbjct: 300 GVGGGAGGGVGGGGGFGGGGG 320 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 G GGG GGGG GGGGG Sbjct: 336 GVGGGAGGGVGGGGGFGGGGG 356 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 122 GAGGGAGGGLGGGGGFGGGGG 142 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 228 GAGGGAGGGIGGGGGFGGGGG 248 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 60 GGGGGGL---GGGGGGLGGGHG 78 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 67 GGGGGGLG--GGHGGGFGGGGG 86 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGG Sbjct: 84 GGGLGGGASGGVGGGGGFGGGG 105 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGG Sbjct: 158 GGGVGGGAGGGVGGGGGFGGGG 179 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 138 GGGGGGG---LGGGGGHGGGFG 156 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 140 GGGGGLGGGGGHGGGFGAGGG 160 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GGG G Sbjct: 146 GGGGGHGGGFGAGGGVGGGAG 166 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 212 GGGGGSGLGGGQGGGFGAGGG 232 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 43 GGGFGEGEGFGGGGGFGGGGG 63 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 51 GFGGGGGFGGGGGGGLGGGGG 71 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG G GGG Sbjct: 55 GGGFGGGGGGGLGGGGGGLGGG 76 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G G GGG Sbjct: 59 GGGGGGGLGGGGGGLGGGHGGG 80 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 85 GGLGGGASGGVGGGGGFGGGG 105 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGG G Sbjct: 93 GGVGGGGGFGGGGGGGLGGGQG 114 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGG--GGXGGGGG 368 GGGGGG GG GG G GGG Sbjct: 103 GGGGGGLGGGQGGGFGGGAGAGGG 126 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 159 GGVGGGAGGGVGGGGGFGGGG 179 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 160 GVGGGAGGGVGGGGGFGGGGG 180 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 166 GGGVGGGGGFGGGGGGGLGGG 186 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGG G Sbjct: 167 GGVGGGGGFGGGGGGGLGGGHG 188 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 196 GVGGGAGGGVGGGGGFGGGGG 216 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 202 GGGVGGGGGFGGGGGSGLGGG 222 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 270 GGGVGGGGGFGGGGGGGLGGG 290 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGG G Sbjct: 271 GGVGGGGGFGGGGGGGLGGGHG 292 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 300 GVGGGAGGGVGGGGGFGGGGG 320 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 306 GGGVGGGGGFGGGGGGGLGGG 326 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGG G Sbjct: 307 GGVGGGGGFGGGGGGGLGGGHG 328 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 336 GVGGGAGGGVGGGGGFGGGGG 356 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 71 GGLGGGHGGGFGGGG-GLGGG 90 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 86 GLGGGASGGVGGGGGFGGGGG 106 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 93 GGVGGGG-GFGGGGGGGLGGG 112 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G G GG GGGG GGGG Sbjct: 120 GAGAGGGAGGGLGGGGGFGGGG 141 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 129 GGLGGGG-GFGGGGGGGLGGG 148 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 130 GLGGGGGFGGGGGGGLGGGGG 150 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGG G Sbjct: 235 GGIGGGGGFGGGGGGGLGGGHG 256 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 235 GGIGGGG-GFGGGGGGGLGGG 254 >07_01_0725 - 5532803-5533324,5533631-5533657,5534285-5534398, 5534564-5534731,5535951-5536193,5537178-5537261, 5537357-5538117,5539637-5539730,5540633-5540899, 5541311-5541316,5542538-5542657 Length = 801 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGGG Sbjct: 758 GGGGYGGGGGGYGGGGYGGGGG 779 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 763 GGGGGGYGGGGYGGGGGGGGYG 784 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGG--GXPPPXXGGGGXGGGGG 368 GGGGG G G GG GGGGG Sbjct: 238 GGGGGSVGGSRQGFGAGGRGGGGG 261 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGG GGGGG Sbjct: 759 GGGYGGGGGGYGGGGYGGGGGG 780 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GG GG Sbjct: 764 GGGGGYGGGGYGGGGGGGGYGG 785 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 759 GGGYGGGGGGYGGGGYGGGGG 779 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 760 GGYGGGGGGYGGGGYGGGGGG 780 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG G GGG Sbjct: 765 GGGGYGGGGYGGGGGGGGYGGG 786 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 767 GGYGGGGYG-GGGGGGGYGGG 786 >06_03_0425 - 20659298-20659634,20659964-20660075,20660161-20660272 Length = 186 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGGGG Sbjct: 39 GGGGGGYGGGGGGGYGGGGGGG 60 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 39 GGGGGGYGGGGGGGYGGGGG 58 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 39 GGGGGGYGGGGGGGYGGGGGG 59 >06_02_0127 + 12140843-12140966,12141170-12141567 Length = 173 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 94 GGYGGGYGGGYGGGGGGGGGGG 115 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 94 GGYGGGYGGGYGGGGGGGGGG 114 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG G GG GGGG Sbjct: 109 GGGGGGGYGGYGGYGGYGGGG 129 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GG G GGGGG Sbjct: 90 GGGYGGYGGGYGGGYGGGGGGG 111 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GG GG Sbjct: 106 GGGGGGGGGGYGGYGGYGGYGG 127 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 95 GYGGGYGGGYGGGGGGGGGGG 115 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GG GG Sbjct: 97 GGGYGGGYGGGGGGGGGGGYGG 118 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGGG Sbjct: 108 GGGGGGGGYGGYGGYGGYGGGG 129 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG P G G GGGGG Sbjct: 150 GGGYGGGGYPGGGYYGGGGGGG 171 Score = 28.3 bits (60), Expect = 7.9 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GG GG Sbjct: 105 GGGGGGG-----GGGGYGGYGG 121 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 GGGGGG GGG GGG Sbjct: 138 GGGGGGGYSKGFGGGYGGGG 157 Score = 28.3 bits (60), Expect = 7.9 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGG--GGG 368 GGGGGG GG G GG GGG Sbjct: 139 GGGGGGYSKGFGGGYGGGGYPGGG 162 >06_02_0125 + 12122812-12122911,12123647-12123993 Length = 148 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 117 GGYGGGYGGGYGGGGGYGGGGG 138 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGG Sbjct: 116 GGGYGGGYGGGYGGGGGYGGGG 137 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 117 GGYGGGYGGGYGGGGGYGGGG 137 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 118 GYGGGYGGGYGGGGGYGGGGG 138 >06_01_1050 + 8262033-8262165,8262262-8262391,8262486-8263026 Length = 267 Score = 32.7 bits (71), Expect = 0.37 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PP PPP PPPPPP Sbjct: 128 PLEPPRPPPREQDATPPPPPPP 149 >05_04_0235 + 19291204-19291769,19291860-19292250 Length = 318 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 50 GGGGGGG---GGGGGGGGGGGG 68 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 48 GCGGGGGGGGGGGGGGGGGG 67 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 48 GCGGGGGGGGGGGGGGGGGGG 68 >03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 Length = 397 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 7/29 (24%) Frame = +3 Query: 369 PPPPPXPPPPXXGG-------GXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 355 PPPPPPPPPPPPVYYSSYVMLDRPPPPPP 383 >03_06_0365 - 33399422-33399925,33400470-33400583,33400762-33400929, 33401305-33401547,33402148-33402231,33402323-33403098, 33404423-33404636 Length = 700 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGGG Sbjct: 663 GGGGYGGGGGGYGGGGYGGGGG 684 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGG Sbjct: 668 GGGGGGYGGGGYGGGGGYGGG 688 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG G GGG Sbjct: 661 GGGGGGYGGGGGGYGGGGYGGG 682 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGG G Sbjct: 669 GGGGGYGGGGYGGGGGYGGGYG 690 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 664 GGGYGGGGGGYGGGGYGGGGG 684 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 668 GGGGGGYGGGGYGGGGGYGGG 688 >02_05_0818 + 32004749-32005347,32005905-32006415,32006539-32007300 Length = 623 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXP--PPXXGGGGXGGGGG 368 GGGGGG P GG G GGGGG Sbjct: 18 GGGGGGDRWMPDLRGGNGGGGGGG 41 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = -3 Query: 433 GGGGGGXPPPXX----GGGGXGGGGG 368 GGGGG P GGGG GGGGG Sbjct: 19 GGGGGDRWMPDLRGGNGGGGGGGGGG 44 >02_04_0271 + 21445113-21445865,21446727-21446788,21446927-21447027, 21447165-21447248,21448054-21448058,21448193-21448267, 21448339-21448416,21448896-21448952,21449351-21449421, 21449529-21449628,21449758-21449862,21450004-21450066, 21450144-21450266,21450371-21450514,21450598-21450672 Length = 631 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 192 GGGGGGG---GGGGGGAGGGGG 210 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 193 GGGGGGG---GGGGGAGGGGGG 211 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGG 371 GGGGG GG G GGGG Sbjct: 192 GGGGGGGGGGGGGAGGGGGG 211 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG G G Sbjct: 196 GGGGGGGGGAGGGGGGEEGAG 216 >01_06_1602 - 38559661-38559936,38560008-38560137,38562550-38562778, 38563627-38563659,38563746-38563896 Length = 272 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 3 GGGGGGG---GGGGGGGGGGGG 21 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 4 GGGGGGG---GGGGGGGGGGGG 22 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGG 371 GGGGG GGGG GGGG Sbjct: 3 GGGGGGGGGGGGGGGGGGGG 22 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGG 322 GG GG G GGGG G GG Sbjct: 3 GGGGGGGGGGGGGGGGGGGG 22 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 3 GGGGGGGGGGGGGGGGGGGG 22 >01_06_1365 - 36690267-36692222 Length = 651 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 611 GGGGGGA---RRGGGGGGGGGG 629 >01_06_0090 + 26358051-26359157,26359582-26359701,26359968-26360099, 26360194-26360375,26360488-26360602,26362001-26362135, 26362261-26362395 Length = 641 Score = 32.7 bits (71), Expect = 0.37 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P G PPPPP Sbjct: 273 PPPPPMPALSVCGRAAAPPPPP 294 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPXPPPPXXG----GGXPPPPPP 434 PP PP PP P PPPPPP Sbjct: 270 PPIPPPPPMPALSVCGRAAAPPPPPP 295 Score = 28.7 bits (61), Expect = 6.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 718 PXXXPPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 P PPPP P A AP PPPPPP Sbjct: 270 PPIPPPPPMPALSVCGR--------AAAPPPPPPPP 297 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPP 425 PPPPP PPP G P Sbjct: 290 PPPPPPPPPARRTSGAASP 308 >01_05_0513 - 22864657-22867899 Length = 1080 Score = 32.7 bits (71), Expect = 0.37 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PP GGG PPP Sbjct: 164 PPPPEDRPPEGGGGDNAPPP 183 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP--PP 434 PPPP PP GG PPP PP Sbjct: 164 PPPPEDRPPEGGGGDNAPPPEVPP 187 >01_01_0570 - 4231100-4232560 Length = 486 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 277 GGGGGGG---MGGGGGFGGGGG 295 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 151 GGGGGFGGGAGGGGGIGAGGG 171 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGG GG GGGG GGGG Sbjct: 76 GGGTGGGAAGGLGGGGGGGGG 96 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG G GGG Sbjct: 151 GGGGGFGGGAGGGGGIGAGGG 171 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GGGG GGGGG Sbjct: 269 GGGAGGGVGGGGGGGMGGGGG 289 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GG GG Sbjct: 92 GGGGGLGGSGGLGGGGMGGSGG 113 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGG GGGG GGGGG Sbjct: 177 GAGGGVGGGGRFGGGGMGGGGG 198 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 269 GGGAGGGVGGGGGGGMGGGGG 289 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGG G Sbjct: 77 GGTGGGAAGGLGGGGGGGGGLG 98 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG G GGG Sbjct: 104 GGGGMGGSGGFGGGGGGGVGGG 125 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GG GG Sbjct: 81 GGAAGGLGGGGGGGGGLGGSGG 102 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGG 371 GGGGG G GG GGGG Sbjct: 88 GGGGGGGGGLGGSGGLGGGG 107 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGG GGGGG Sbjct: 144 GGGGVGAGGGGGFGGGAGGGGG 165 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGG Sbjct: 196 GGGFGGGAGGGVGGGGELGGGG 217 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGG Sbjct: 273 GGGVGGGGGGGMGGGGGFGGGG 294 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GG G GGGGG Sbjct: 73 GGVGGGTGGGAAGGLGGGGGGG 94 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 105 GGGMGGSGGFGGGGGGGVGGG 125 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 133 GGGVGAGGGLRGGGGVGAGGG 153 Score = 28.7 bits (61), Expect = 6.0 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 1/60 (1%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXG-GGXXXXXXXXXXXXXXXXXXXXXGGGXFXFXPKXGFTGFG 205 G GG G GGGG G G GG GGG F G GFG Sbjct: 141 GLRGGGGVGAGGGGGFGGGAGGGGGIGAGGGFGGGAGAGGGVGGGGRFGGGGMGGGGGFG 200 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGG GGGGG Sbjct: 261 GGGMGGDIGGGAGGGVGGGGGG 282 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 262 GGMGGDIGGGAGGGVGGGGGG 282 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 274 GGVGGGGGGGMGGGGGFGGGG 294 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 275 GVGGGGGGGMGGGGGFGGGGG 295 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 77 GGTGGGAAGGLGGGG-GGGGG 96 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GG GG Sbjct: 89 GGGGGGGGLGGSGGLGGGGMGG 110 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG G GGG Sbjct: 120 GGVGGGVGAGFGSGGGVGAGGG 141 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG G GGG Sbjct: 161 GGGGGIGAGGGFGGGAGAGGG 181 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 197 GGFGGGAGGGVGGGGELGGGG 217 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GG G G GGG Sbjct: 258 GGAGGGMGGDIGGGAGGGVGGG 279 >12_02_0848 + 23636478-23638058 Length = 526 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPX----PPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 64 PPPPPIIDASPPPPSTS---PPPPPP 86 >11_06_0016 - 19284810-19284926,19285527-19286879 Length = 489 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPPP PPPPPP Sbjct: 83 PPPSPPPPP-----PPPPPP 97 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPP P PPPP PPPPP Sbjct: 83 PPPSPPPPPP------PPPPP 97 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PPPP P PP P Sbjct: 83 PPPSPPPPPPPPP---PPRP 99 >09_04_0168 - 15295442-15295477,15295478-15295552,15295660-15295722, 15296095-15296319,15296421-15296562,15296678-15296839, 15298148-15298320,15300352-15300882 Length = 468 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGG 371 GGGGG GGGG GGGG Sbjct: 107 GGGGGGSGEGAGGGGGGGGG 126 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 GGGGGG GGGG GGG Sbjct: 107 GGGGGGSGEGAGGGGGGGGG 126 >08_02_1330 + 26191062-26191314,26191894-26191961,26192125-26192355, 26192736-26192837,26192893-26192955,26193910-26193984 Length = 263 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 20 GGGGGGG----GGGGGGGGGGG 37 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 18 GSGGGGGGGGGGGGGGGGGG 37 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 G GGGG GGGG GGG Sbjct: 18 GSGGGGGGGGGGGGGGGGGG 37 >07_03_1386 - 26192019-26192073,26192272-26192397,26192570-26192622, 26192722-26192807,26192896-26193017,26193096-26193155, 26193787-26193866,26193949-26194087,26194273-26194367, 26194792-26194860,26195015-26195131,26195839-26195913, 26196590-26196961 Length = 482 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GGGG GGGGG Sbjct: 13 GGGSGSESGGSGGGGRGGGGG 33 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 13 GGGSGSESGGSGGGGRGGGGG 33 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG G GGG GGGGG Sbjct: 13 GGGSGSESGGSGGGGRGGGGGG 34 >07_01_0714 - 5451246-5451408,5453401-5453534,5453608-5453796, 5454313-5454825,5455815-5456856,5457283-5457380, 5458224-5458451 Length = 788 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 25 GGGGGGG----GGGGGGGGGGG 42 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GG GG Sbjct: 25 GGGGGGGGGGGGGGGGGGDGG 45 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 22 GAVGGGGGGGGGGGGGGGGGG 42 >06_03_0447 + 20878444-20878821 Length = 125 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP P PP G PPPPP Sbjct: 49 PPPRPIPPDLVEGRALAPPPPP 70 >06_02_0207 + 13017538-13017670,13019486-13019658,13020754-13020845, 13022213-13022271,13022659-13022759,13023907-13023988, 13024092-13024321 Length = 289 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGGG 368 G GG PP G GG GGGGG Sbjct: 224 GSGGFPPFRFGKGGGGGGGG 243 >05_06_0026 - 25024807-25025300,25025432-25025495,25025567-25025662, 25025719-25025929,25026616-25026690,25026820-25027037 Length = 385 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P PP P PP P Sbjct: 28 PPPPPPPLPPAAAAVEPLPPQP 49 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPP--PXPPPPXXGGGXPPPPPP 434 PP P PPPP PPPPPP Sbjct: 10 PPSPVAAAPPPPPVQVPVPPPPPP 33 >05_03_0662 + 16732965-16733037,16733310-16733413,16734468-16734861, 16736291-16736901,16739238-16739289,16739771-16739826, 16739962-16740190,16740980-16741212,16741480-16741740 Length = 670 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGG G Sbjct: 153 GGGGGGSAGASGGSGGGGGGAG 174 >04_04_1414 - 33394518-33394847 Length = 109 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 89 GGGGGGG----GGGGGCGGGGG 106 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG G P GGGG GGGGG Sbjct: 79 GGSACGGPACGGGGGGGGGGGG 100 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGG 377 GGGGGG GGGG GG Sbjct: 90 GGGGGGGGGGGCGGGGGGG 108 >04_03_1022 - 21778315-21779007 Length = 230 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP PP P Sbjct: 37 PPPPPPPPPPYVPPHLLPPSP 57 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PP P P Sbjct: 38 PPPPPPPPPYVPPHLLPPSPAP 59 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PP P Sbjct: 36 PPPPPPPPPPPYVPPHLLPPSP 57 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PPP P PP P Sbjct: 38 PPPPPPPPPYVPPHLLPPSP 57 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPXP---PPPXXGGGXPPPPPP 434 PPPPP PP PPPPPP Sbjct: 17 PPPPPATRARPPCSSAHLLPPPPPP 41 Score = 28.3 bits (60), Expect = 7.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 5/26 (19%) Frame = +3 Query: 372 PPPPXPPP---PXXGGGXPP--PPPP 434 PP P P P P GG PP PPPP Sbjct: 95 PPTPAPAPSTTPGGHGGVPPYYPPPP 120 >03_05_0688 + 26762668-26762893,26763027-26763101,26763865-26764032, 26764983-26765114,26765538-26765677,26765840-26765908, 26766325-26766435,26766854-26766973,26768223-26768324, 26769608-26769778,26769865-26769944,26770119-26770182 Length = 485 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG P GG G GG G Sbjct: 22 GGGGGGGVDPAGGGSGGGGPG 42 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGG GGGG Sbjct: 20 GGGGGGGGGVDPAGGGSGGGG 40 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P G GG G G G Sbjct: 23 GGGGGGVDPAGGGSGGGGPGMG 44 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGG G Sbjct: 21 GGGGGGGGVDPAGGGSGGGGPG 42 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG GGGG Sbjct: 19 GGGGGGGGGGVDPAGGGSGGGG 40 >02_02_0417 + 9993807-9993868,9994009-9994105,9994223-9994310, 9995111-9995184,9995985-9996185,9996663-9996744, 9996829-9997061 Length = 278 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGGG 368 G GG PP G GG GGGGG Sbjct: 212 GSGGFPPFRFGKGGGGGGGG 231 >01_06_0561 + 30251547-30252173,30252248-30252405,30253250-30254192, 30254271-30254438,30254546-30254857,30255498-30255557, 30255905-30255937,30256083-30256271 Length = 829 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 25 GGGGGGG----GGGGGTGGGGG 42 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 GGGGGG GGGG GGG Sbjct: 26 GGGGGGGGGGGTGGGGGGGG 45 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG G GG GGGGG Sbjct: 25 GGGGGGGGGGGGTGGGGGGGG 45 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GG Sbjct: 28 GGGGGGGGGTGGGGGGGGRRGG 49 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GG G Sbjct: 27 GGGGGGGGGGTGGGGGGGGRRG 48 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 22 GRRGGGGGGGGGGGGTGGGGG 42 >01_06_0046 + 25943183-25943590 Length = 135 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPPP PPPP PPPP Sbjct: 50 PPPPALPPPPPYYYYSPPPP 69 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPX----PPPPXXGGGXPPPPPP 434 PPPPP PPPP G PPPP Sbjct: 56 PPPPPYYYYSPPPPAYYPGSYCPPPP 81 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PPP PPPP Sbjct: 50 PPPPALPPPPPYYYYSPPPP 69 >01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 Length = 252 Score = 32.3 bits (70), Expect = 0.48 Identities = 18/59 (30%), Positives = 19/59 (32%), Gaps = 1/59 (1%) Frame = +2 Query: 206 PNPVNPXLGXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPPPXPXPPPP-XXPXXXPPXP 379 P+P P G K K P P P P P PP P P PP P Sbjct: 167 PSPPKPKPGPKPKPPKPGPKPKPPKPGPKPKPKPPKPGPKPKPKPPKPGPKPKPGPPQP 225 >01_05_0501 + 22764978-22765896,22766087-22766349,22766613-22766836, 22767419-22767749,22767968-22768372 Length = 713 Score = 32.3 bits (70), Expect = 0.48 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPP 373 PPP P PPPP P PP Sbjct: 76 PPPPPPPPPPPPPVPVPP 93 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 P PPP PPPP PPPPP Sbjct: 74 PSPPPPPPPP------PPPPP 88 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP PPPPPP Sbjct: 74 PSPPPPPPP------PPPPPP 88 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP PPP P Sbjct: 76 PPPPPPPPPP------PPPVP 90 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPP P Sbjct: 76 PPPPPPPPP------PPPPVP 90 >01_01_0347 + 2765517-2767109,2767214-2767228 Length = 535 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 GGGGGG GGGG GGG Sbjct: 38 GGGGGGGSTGAGGGGGGGGG 57 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGG 371 GGGGG GGGG GGGG Sbjct: 38 GGGGGGGSTGAGGGGGGGGG 57 >06_03_0214 + 18067945-18068463,18068940-18069839,18069918-18070652 Length = 717 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 PP PPPP PPPPPP Sbjct: 200 PPLPPPP------PPPPPP 212 Score = 29.1 bits (62), Expect(2) = 0.49 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 203 PPPPPPPPPP 212 Score = 25.0 bits (52), Expect(2) = 6.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 369 PPPPPXPPPP 398 P PPP PPPP Sbjct: 201 PLPPPPPPPP 210 Score = 21.8 bits (44), Expect(2) = 0.49 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +3 Query: 393 PPXXGGGXPPPPP 431 PP PPPPP Sbjct: 239 PPQHNAPPPPPPP 251 Score = 21.8 bits (44), Expect(2) = 6.6 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +3 Query: 396 PXXGGGXPPPPPP 434 P PPPPPP Sbjct: 239 PPQHNAPPPPPPP 251 >02_01_0377 + 2728892-2729187,2729483-2729544,2730516-2730570, 2730784-2730858,2730980-2731054,2731155-2731202, 2731548-2732357,2732450-2732498,2733157-2733266, 2733381-2733488,2733920-2733980 Length = 582 Score = 29.1 bits (62), Expect(2) = 0.50 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 12 PPPPPPPPPP 21 Score = 21.8 bits (44), Expect(2) = 0.50 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +3 Query: 381 PXPPPPXXGGGXP 419 P PPPP G P Sbjct: 58 PLPPPPPLGSSRP 70 >05_03_0001 - 7269231-7269436,7269536-7270100,7270600-7270821, 7270913-7271155,7271227-7271481,7272017-7272370, 7273082-7273164,7273250-7273630,7273874-7274027 Length = 820 Score = 25.8 bits (54), Expect(2) = 0.63 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 369 PPPPPXPPPP 398 P PPP PPPP Sbjct: 2 PAPPPPPPPP 11 Score = 24.6 bits (51), Expect(2) = 0.63 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPP P P P Sbjct: 4 PPPPPPPPRRDFPAFPFAPYP 24 >12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758, 4171814-4171891,4174482-4174569,4174659-4174850, 4174939-4175802 Length = 493 Score = 31.9 bits (69), Expect = 0.64 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 381 PXPPPPXXGGGXPPPPPP 434 P PPPP PPPPPP Sbjct: 148 PPPPPPQESTPPPPPPPP 165 Score = 31.9 bits (69), Expect = 0.64 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP P PP Sbjct: 158 PPPPPPPPPAPVAAAVSAPAPP 179 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 PP PPP PPPPPP Sbjct: 148 PPPPPPQESTPPPPPPPPP 166 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P P PP P Sbjct: 160 PPPPPPPAPVAAAVSAPAPPSP 181 >09_03_0145 - 12749288-12751510 Length = 740 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 P PPP PPPP G PPPP Sbjct: 28 PSPPPPPPPP----GIQPPPP 44 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPX-PPPPXXGG---GXPPPPPP 434 PPPP PPPP G G PPPP P Sbjct: 34 PPPPGIQPPPPALPGMPHGRPPPPFP 59 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 P P PPPP G PPPP Sbjct: 25 PTNPSPPPPPPPPGIQPPPP 44 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 P P PPPP G PPP P Sbjct: 28 PSPPPPPPPPGIQPPPPALP 47 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 PP P P PPPPPP Sbjct: 19 PPFKPKPTNPSPPPPPPPP 37 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 P P PPPP P P PP Sbjct: 25 PTNPSPPPPPPPPGIQPPPP 44 >07_03_1533 + 27523811-27524710 Length = 299 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG GGGGG Sbjct: 100 GGGGGGGDDSGGDDGGGGGGGG 121 Score = 31.5 bits (68), Expect = 0.85 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 91 GGGGGG------GGGGGGGGGG 106 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G G GGGGG Sbjct: 99 GGGGGGGGDDSGGDDGGGGGGG 120 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG GGGGG Sbjct: 97 GGGGGGGGGGDDSGGDDGGGGG 118 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG GGGGG Sbjct: 98 GGGGGGGGGDDSGGDDGGGGGG 119 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGG G Sbjct: 102 GGGGGDDSGGDDGGGGGGGGDG 123 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 424 GGGXPPPXXGGGGXGGGGG 368 GGG GGGG GGGGG Sbjct: 85 GGGDDDGGGGGGGGGGGGG 103 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGGG 368 GGG GGGG GGGGG Sbjct: 85 GGGDDDGGGGGGGGGGGGGG 104 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG GGGG Sbjct: 96 GGGGGGGGGGGDDSGGDDGGGG 117 >07_03_0600 + 19866757-19867218,19867920-19868429 Length = 323 Score = 31.9 bits (69), Expect = 0.64 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP P P P G PPPPPP Sbjct: 58 PPHAPPPQQPPAMWGQPPPPPP 79 >07_03_0154 + 14509979-14512033 Length = 684 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPPPP PPPP PPPP Sbjct: 53 PPPPPPPPPP------PPPP 66 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPPP PPPPPP Sbjct: 53 PPPPPPPP------PPPPPP 66 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP P P Sbjct: 57 PPPPPPPPPPQVQAATVATPVP 78 >07_01_0479 + 3606663-3607448 Length = 261 Score = 31.9 bits (69), Expect = 0.64 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPP---PPXPPPPXXGGGXPPPPPP 434 PPP P PPPP G PPPP P Sbjct: 228 PPPGMRPGMPPPPFRPGMPPPPPGP 252 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPPPXPP--PPXXGGGXPPPPPP 434 P P PP PP GG PPPP P Sbjct: 184 PIPFQRPPGVPPAFPGGPPPPPGP 207 >06_03_1121 + 27767707-27768065,27768612-27769034,27770013-27770175, 27770271-27770381,27770895-27770963,27771117-27771203, 27771967-27772752 Length = 665 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG P GG GGGGG Sbjct: 20 GGGGGPAPHSSDPGGVGGGGG 40 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG P GG GGGGG Sbjct: 20 GGGGGPAPHSSDPGGVGGGGGG 41 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G G G Sbjct: 36 GGGGGGGGPGDGGGHGRGRGRG 57 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = -3 Query: 427 GGGGXPPPXX---GGGGXGGGGG 368 GGGG P P GG G GGGGG Sbjct: 20 GGGGGPAPHSSDPGGVGGGGGGG 42 >06_01_0931 + 7192519-7194075 Length = 518 Score = 31.9 bits (69), Expect = 0.64 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 381 PXPPPPXXGGGXPPPPPP 434 P PPPP PPPPPP Sbjct: 130 PSPPPPPPRSQAPPPPPP 147 Score = 29.5 bits (63), Expect = 3.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPP 431 P PPPP PPPPP Sbjct: 130 PSPPPPPPRSQAPPPPPP 147 >05_07_0102 + 27700395-27700426,27701034-27702087,27703205-27703420 Length = 433 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG P GGG GGGG Sbjct: 18 GGGGGGPRGCGGGGPRSGGGG 38 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 G GGG P GGG GGGGG Sbjct: 26 GCGGGGPRSGGGGGPRGGGGG 46 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/24 (66%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGX--GGGGG 368 GGGGGG P GGGG GGGGG Sbjct: 18 GGGGGG--PRGCGGGGPRSGGGGG 39 >04_04_1687 - 35365766-35366356,35367137-35368135 Length = 529 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPPPP PPPP PPPP Sbjct: 10 PPPPPPPPPP------PPPP 23 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPPP PPPPPP Sbjct: 10 PPPPPPPP------PPPPPP 23 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PPPP PPPPPP Sbjct: 4 PPAATAPPPPPP---PPPPPPP 22 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PP PPPP P PP P Sbjct: 4 PPAATAPPPPPPPPPPPPPP 23 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP PPP P PP PP Sbjct: 4 PPAATAPPPPPPPPPPPPPP 23 >04_04_1641 + 34993807-34994589,34994924-34995022,34995521-34995648, 34996095-34996235,34996456-34996542,34996627-34996780, 34998569-34998628,34999019-34999447,34999524-34999819, 35000278-35000407,35000690-35001187 Length = 934 Score = 31.9 bits (69), Expect = 0.64 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 P PPP PP P PPPP Sbjct: 36 PSPPPPPPSPVPSPAPPPPP 55 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 P PP PPP PPPPP Sbjct: 36 PSPPPPPPSPVPSPAPPPPP 55 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 P P PPPP PPPPP Sbjct: 36 PSPPPPPPSPVPSPAPPPPP 55 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P P P PPPP PPP P Sbjct: 45 PVPSPAPPPPPHRPSPSPPPNP 66 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 P P PPP P PP PP Sbjct: 36 PSPPPPPPSPVPSPAPPPPP 55 >04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 Length = 389 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P P P PPPP PPPPPP Sbjct: 20 PAPAPVPPPPP----PPPPPPP 37 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 P P P PPPP P PP PP Sbjct: 20 PAPAPVPPPPPPP---PPPPP 37 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PP P P PP PPPPPP Sbjct: 19 PPAPAPVPPPP---PPPPPPP 36 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXP 379 PP P P PP P PP P Sbjct: 19 PPAPAPVPPPPPPPPPPPP 37 >04_04_0726 + 27588225-27588685,27588768-27588895,27590523-27591016 Length = 360 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG G G GGGG GGGGG Sbjct: 66 GGDGAGQVAQGSGGGGGGGGGG 87 >04_04_0198 + 23502657-23502900,23505228-23505298,23505690-23505727, 23505905-23507693 Length = 713 Score = 31.9 bits (69), Expect = 0.64 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPPPP PPPP P P Sbjct: 551 PPPPPPPPPPAPAPALAPAP 570 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PP P P Sbjct: 549 PPPPPPPPPP------PPAPAP 564 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP P P Sbjct: 550 PPPPPPPPPPPAPAPALAPAP 570 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP P P P Sbjct: 549 PPPPPPPPPPPPAPAPALAP 568 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PPPP P P Sbjct: 551 PPPPPPPPPPAPAPALAPAP 570 >03_03_0278 - 16126803-16129049 Length = 748 Score = 31.9 bits (69), Expect = 0.64 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPPP PP PP Sbjct: 186 PPPPPPPPRQAPAPPPAKPP 205 >03_03_0139 + 14769393-14769764,14770113-14770193,14770537-14770737 Length = 217 Score = 31.9 bits (69), Expect = 0.64 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGG--GXPPPXXGGGGXGGGGG 368 GGGGG G GGGG GGGGG Sbjct: 8 GGGGGIAGKKRKAVGGGGGGGGGG 31 >02_04_0382 - 22501041-22501279,22501717-22501810 Length = 110 Score = 31.9 bits (69), Expect = 0.64 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 8/30 (26%) Frame = +3 Query: 369 PPPPPX----PPPPXXGGGX----PPPPPP 434 PPP P PP P GGG PPPPPP Sbjct: 74 PPPSPDYYDPPPSPYYGGGGGYGKPPPPPP 103 >02_02_0682 - 12923103-12923747,12924607-12924870,12924953-12925219, 12925301-12925529,12925614-12926295,12926409-12926682, 12926822-12927347,12927460-12927698,12927799-12927896, 12928017-12928020,12928657-12928832,12929593-12929647, 12930787-12931047 Length = 1239 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G G GGGGG Sbjct: 3 GGGGGGGDGGGGAGAGGGGGGG 24 >02_02_0359 - 9390175-9390416,9390924-9391044,9391069-9391410, 9392400-9392759 Length = 354 Score = 31.9 bits (69), Expect = 0.64 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPP 422 PPPPP PPPP PP Sbjct: 37 PPPPPPPPPPPSQPSAPP 54 Score = 29.5 bits (63), Expect = 3.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXP 370 PPP P PPPP P P Sbjct: 38 PPPPPPPPPPSQPSAPP 54 Score = 29.1 bits (62), Expect = 4.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPP 373 PPP P PPPP PP Sbjct: 37 PPPPPPPPPPPSQPSAPP 54 Score = 28.7 bits (61), Expect = 6.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPP 425 PPPP PPPP PP Sbjct: 37 PPPPPPPPPPPSQPSAPP 54 >02_01_0471 - 3364215-3364912,3365511-3365742,3365827-3366198, 3366324-3366449,3367056-3367262,3367399-3367492, 3367575-3367621,3367705-3368157,3368261-3368560, 3368656-3369114,3369189-3369410,3369659-3369890, 3370051-3370422,3371210-3371322,3371682-3371903, 3371977-3372180,3372308-3372572,3373123-3373311, 3373441-3373768,3373843-3374248,3374339-3374648, 3375677-3375837,3376825-3376998,3377265-3377609, 3377713-3377754,3378585-3378734,3378847-3379002, 3379088-3379540,3379651-3379966,3380402-3380839, 3381475-3381697,3383538-3383852,3384033-3384095, 3384699-3384903,3385362-3385425,3386014-3386204 Length = 3048 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG G GG Sbjct: 24 GGGGGGGGGDGGGGGGAGAGG 44 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G G G Sbjct: 22 GGGGGGGGGGGDGGGGGGAGAG 43 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GG Sbjct: 23 GGGGGGGGGGDGGGGGGAGAGG 44 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 23 GGGGGGGGGGDGGGGGGAGAG 43 >01_06_1758 - 39681942-39682030,39682115-39682345,39682643-39682679, 39683604-39683835,39683937-39684022,39684126-39684218, 39684302-39684465,39684541-39684702,39684783-39684962, 39685079-39685515,39685614-39685669 Length = 588 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 GGGGGG GGGG GGG Sbjct: 77 GGGGGGGAGGYRGGGGRGGG 96 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGG--GGG 368 G GGGG GGGG GG GGG Sbjct: 68 GAGGGGWGRGGGGGGGAGGYRGGG 91 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGG GG GGGG G GG Sbjct: 66 GGGAGGGGWGRGGGGGGGAGG 86 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GGGG GG GG Sbjct: 66 GGGAGGGGWGRGGGGGGGAGG 86 >01_06_1377 + 36764461-36765339 Length = 292 Score = 31.9 bits (69), Expect = 0.64 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP P PPP PPPPPP Sbjct: 157 PPEPQYPPPSSSPYYFPPPPPP 178 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP P PPP PPPPP Sbjct: 156 PPPEPQYPPPSSSPYYFPPPPP 177 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 1/22 (4%) Frame = +2 Query: 320 PPPXPX-PPPPXXPXXXPPXPP 382 PPP P PPP P PP PP Sbjct: 156 PPPEPQYPPPSSSPYYFPPPPP 177 >01_01_0716 - 5548908-5549235,5549327-5549768,5549847-5549982 Length = 301 Score = 31.9 bits (69), Expect = 0.64 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGG 371 GGG P P GGG GGGG Sbjct: 153 GGGSSPTPSHGGGAYGGGG 171 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXG 380 GG GGG P P GGG G Sbjct: 128 GGYGGGSPAPSHGGGAYG 145 >01_01_0626 - 4713943-4714515,4714645-4714853,4717310-4717628 Length = 366 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG P G GG GGG G Sbjct: 61 GGGSGGSSPAGTGRGGGGGGEG 82 >06_01_0760 - 5676973-5677830 Length = 285 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P G G G G G Sbjct: 255 GGGGGGQSVPGGSGSGSGSGSG 276 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/59 (28%), Positives = 20/59 (33%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXFXFXPKXGFTGFG 205 GG GG G GG G G G G GGG + G +G+G Sbjct: 73 GGGGGGGGGQNGGSGYGSGSGSGYGQAGGYGPYGGGAYAQGEGGGGGGGGGQNGGSGYG 131 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G G G G Sbjct: 72 GGGGGGGGGGQNGGSGYGSGSG 93 Score = 27.5 bits (58), Expect(2) = 0.69 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 G GGG GGGG GGGG Sbjct: 103 GPYGGGAYAQGEGGGGGGGGG 123 Score = 23.0 bits (47), Expect(2) = 0.69 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -3 Query: 394 GGGXGGGGG 368 GGG GGGGG Sbjct: 155 GGGQGGGGG 163 >12_02_0370 + 18139557-18140469,18140561-18140704,18140804-18140956, 18141032-18141147,18141231-18141398,18142110-18142334, 18142458-18142577 Length = 612 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPP---PXPPPPXXGGGXPPPPPP 434 PPPP P PPPP PPPP Sbjct: 87 PPPPQEQPSPPPPASSNTTQQPPPP 111 Score = 28.7 bits (61), Expect = 6.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPP P P P PPPP Sbjct: 71 PPPQPQPEPQPAAPSQPPPP 90 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPP P P PPPP Sbjct: 70 PPPPQPQPEPQPAAPSQPPPP 90 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P P PPPP Sbjct: 70 PPPPQPQPEPQPAAPSQPPPP 90 >12_01_0838 - 7830944-7831444 Length = 166 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G G GG GGGG GGGGG Sbjct: 99 GQGNGGAQGQGSGGGGGGGGGG 120 Score = 31.5 bits (68), Expect = 0.85 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 140 GGGGGG------GGGGDGGGGG 155 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 G GG GGGG GGGGG Sbjct: 101 GNGGAQGQGSGGGGGGGGGGG 121 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G G G G Sbjct: 35 GGGGGGGGGGGGGGNGSGSGSG 56 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GG GGGG GGGGG Sbjct: 101 GNGGAQGQGSGGGGGGGGGGGG 122 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 103 GGAQGQGSGGGGGGGGGGGGG 123 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 109 GSGGGG------GGGGGGGGGG 124 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G G G G Sbjct: 111 GGGGGGGGGGGGGGSGQGSGSG 132 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGG 374 GGGGG GGGG GGG Sbjct: 140 GGGGGGGGGGDGGGGGGGG 158 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 G GGG G GG GGGGG Sbjct: 62 GKGGGQSGGGQGSGGGGGGGG 82 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGG G GGGG GGGG Sbjct: 64 GGGQSGGGQGSGGGGGGGGGG 84 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG GGGG GGGGG Sbjct: 64 GGGQSGGGQGSGGGGGGGGGG 84 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GG G GGGG GGGGG Sbjct: 103 GGAQGQGSGGGGGGGGGGGGG 123 >11_03_0095 - 9905323-9905793 Length = 156 Score = 31.5 bits (68), Expect = 0.85 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPP--PXXGGGGXGGGGG 368 GGGGG PP P GGG G GG Sbjct: 104 GGGGGSPPPSLPDLAGGGRGEAGG 127 >10_08_0880 + 21267034-21267537 Length = 167 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGG GGGGG Sbjct: 31 GSGGGGGHGHYGGGGSSGGGGG 52 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGG GGGGG Sbjct: 54 GGGSGGYGGGGSSGGGYGGGGG 75 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 55 GGSGGYGGGGSSGGGYGGGGG 75 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G GGGG GGG Sbjct: 49 GGGGYGGGSGGYGGGGSSGGG 69 >10_08_0338 + 16916429-16916650,16916728-16917900 Length = 464 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GG Sbjct: 103 GGGGGGGGAGGGGGGGGGDAGG 124 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GG Sbjct: 104 GGGGGGGAGGGGGGGGGDAGG 124 >10_08_0214 - 15915156-15915713 Length = 185 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GG G Sbjct: 32 GGGGGGGGGGEGGGGGYGGSG 52 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG G GG GGGGG Sbjct: 62 GGGSGGAAGGGYGRGGGGGGGG 83 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 106 GGAGGYGSGGGGGGGQGGGAG 126 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGG G Sbjct: 106 GGAGGYGSGGGGGGGQGGGAG 126 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G G GG G GG GGGGG Sbjct: 139 GSGAGGAHGGGYGSGGGGGGGG 160 Score = 28.3 bits (60), Expect = 7.9 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 33 GGGGGG-------GGGEGGGGG 47 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGG GGGG G GGG Sbjct: 67 GAAGGGYGRGGGGGGGGGEGGG 88 >10_02_0009 + 4128909-4130123 Length = 404 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP PPPPPP Sbjct: 79 PSPPSPPPP------PPPPPP 93 Score = 29.1 bits (62), Expect = 4.5 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 84 PPPPPPPPPP 93 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 P PP PPPP PPPPP Sbjct: 79 PSPPSPPPPP------PPPPP 93 >10_01_0360 - 3970796-3971248,3972080-3972436 Length = 269 Score = 31.5 bits (68), Expect = 0.85 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 15 GGGGGG------GGGGAGGGGG 30 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGGGG Sbjct: 17 GGGGGG------GGAGGGGGGG 32 >09_04_0616 + 18977421-18977907,18977984-18978245,18978903-18979149 Length = 331 Score = 31.5 bits (68), Expect = 0.85 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGG 374 G GG PP GGGG GGG Sbjct: 266 GDGGNAPPAYRGGGGGGGG 284 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGG 371 G GG PP GGG GGGG Sbjct: 266 GDGGNAPPAYRGGGGGGGG 284 >08_02_0602 + 19183549-19184919 Length = 456 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGG GGGG GGGGG Sbjct: 61 GASGGGSGGGGGGGGGGGGGGG 82 Score = 31.5 bits (68), Expect = 0.85 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 68 GGGGGG------GGGGGGGGGG 83 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 61 GASGGGSGGGGGGGGGGGGGG 81 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G G GG GGG GGGGG Sbjct: 52 GSGSGGSHRGASGGGSGGGGGG 73 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 GGG GG GGGG GGG Sbjct: 64 GGGSGGGGGGGGGGGGGGGG 83 >08_02_0329 - 15833124-15833825 Length = 233 Score = 31.5 bits (68), Expect = 0.85 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 PP PP P G PPP PP Sbjct: 190 PPLPPLPVLAAGPPPPTPP 208 >08_01_0600 - 5262573-5262773,5262850-5262952,5263050-5263180, 5263263-5263312,5265266-5265725,5266349-5266708 Length = 434 Score = 31.5 bits (68), Expect = 0.85 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPPPX-----PPPPXXGGGXPPPPPP 434 PPPP PPPP G PPPP P Sbjct: 38 PPPPQMWGQAPPPPPQMWGQAPPPPQP 64 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 6/27 (22%) Frame = +3 Query: 369 PPPPPX------PPPPXXGGGXPPPPP 431 PPP P PPPP G PPPPP Sbjct: 26 PPPVPHQQQQYAPPPPQMWGQAPPPPP 52 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 5/24 (20%) Frame = +3 Query: 369 PPPPPX-----PPPPXXGGGXPPP 425 PPPPP PPPP G PPP Sbjct: 48 PPPPPQMWGQAPPPPQPAYGQPPP 71 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 5/26 (19%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPP-----PPP 434 PPPP P GGG PP PPP Sbjct: 3 PPPPPPQAGVAGGGGAPPQWGAIPPP 28 >07_01_0862 - 7172083-7172931 Length = 282 Score = 31.5 bits (68), Expect = 0.85 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPXPPPPXXGGG----XPPPPPP 434 PPPPP PPPP PPP PP Sbjct: 127 PPPPPPPPPPTAEEKKLLLFPPPLPP 152 >05_05_0293 + 23896011-23896207,23896309-23896366,23896502-23896606, 23896848-23896905,23897385-23897560,23897731-23897800, 23897908-23898203 Length = 319 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GG G Sbjct: 24 GGGGGGGVAAGGGGGGGGGKG 44 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGG G Sbjct: 24 GGGGGGGVAAGGGGGGGGGKG 44 >04_04_0360 - 24684159-24684565,24684654-24685089 Length = 280 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GG G Sbjct: 56 GGGGGGGGGGGGGGGGGGGSG 76 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGG G Sbjct: 56 GGGGGGGGGGGGGGGGGGGSG 76 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 56 GGGGGGGGGGGGGGGGGGGSG 76 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGGG 368 G G P GGGG GGGGG Sbjct: 46 GDGCRSGPCYGGGGGGGGGG 65 >04_01_0500 - 6540769-6541482,6541819-6541877,6541965-6542064, 6542113-6542322,6542507-6542765,6544022-6544215 Length = 511 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 4/24 (16%) Frame = +3 Query: 372 PPPPXPPPP----XXGGGXPPPPP 431 PPPP PPPP PPPPP Sbjct: 31 PPPPLPPPPPGPLQRRSSLPPPPP 54 Score = 31.5 bits (68), Expect = 0.85 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP PP P PPPPP Sbjct: 33 PPLPPPPPGPLQRRSSLPPPPP 54 >03_05_0576 + 25765137-25766420 Length = 427 Score = 31.5 bits (68), Expect = 0.85 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 P P P P PP PPPPP Sbjct: 71 PSPSPSPSPPPQPSSPPPPPP 91 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 P P P P PP P PP PP Sbjct: 71 PSPSPSPSPPPQPSSPPPPPP 91 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PP P Sbjct: 86 PPPPPPSPPPAAAVSVSPPTQP 107 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P P P PPP PPP PP Sbjct: 73 PSPSPSPPPQPSSPPPPPPSPP 94 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 1/22 (4%) Frame = +2 Query: 320 PPPXPXPPP-PXXPXXXPPXPP 382 P P P PPP P P PP PP Sbjct: 73 PSPSPSPPPQPSSPPPPPPSPP 94 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 1/23 (4%) Frame = +3 Query: 369 PPPPPXP-PPPXXGGGXPPPPPP 434 P P P P P P PPPPPP Sbjct: 69 PSPSPSPSPSPPPQPSSPPPPPP 91 >03_03_0106 - 14500935-14501263,14501357-14501432,14501531-14501542 Length = 138 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP P PPPP PPPPPP Sbjct: 85 PPKKPDPPPPC-----PPPPPP 101 >03_03_0008 - 13674602-13674708,13675272-13675439,13676169-13676787, 13676868-13677330,13677855-13678036,13678093-13678235, 13678315-13678423,13679000-13679456,13680490-13682473, 13682507-13682626,13682920-13682971 Length = 1467 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPPPXPP--PPXXGGGXPPPPPP 434 PPPPP P PP G P PP P Sbjct: 1212 PPPPPIAPLNPPGPHGNFPAPPAP 1235 >03_02_0172 - 6131559-6131990 Length = 143 Score = 31.5 bits (68), Expect = 0.85 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 58 GGGGGG------GGGGGGGGGG 73 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 418 GXPPPXXGGGGXGGGGG 368 G P GGGG GGGGG Sbjct: 54 GSPAGGGGGGGGGGGGG 70 >02_04_0563 - 23895573-23895614,23896330-23896390,23896901-23897025, 23897217-23897302,23898052-23898167,23898274-23898336, 23898451-23898530,23898751-23898871,23899419-23899501, 23900081-23900155,23900436-23900936 Length = 450 Score = 31.5 bits (68), Expect = 0.85 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 41 GGGGGG------GGGGGGGGGG 56 >02_04_0180 + 20696258-20698398,20698691-20698871,20698998-20699060 Length = 794 Score = 31.5 bits (68), Expect = 0.85 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 11/33 (33%) Frame = +3 Query: 369 PPPPPXPPPPXXGGG-----------XPPPPPP 434 PPPPP PP GGG PPPPPP Sbjct: 11 PPPPPPPPFGRGGGGAGYPRGHKQLYAPPPPPP 43 >01_06_0357 - 28668894-28669238,28669510-28669537,28669578-28669635, 28669836-28669916,28670395-28670526,28670609-28670926, 28672495-28673317 Length = 594 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP PP PP Sbjct: 2 PPPPPPPPPP------PPSPP 16 Score = 29.5 bits (63), Expect = 3.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXP 370 PPP P PPPP P P Sbjct: 3 PPPPPPPPPPPSPPRLP 19 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPPP PPP PP Sbjct: 2 PPPPPPPP-----PPPPSPP 16 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP PP PP Sbjct: 2 PPPPPPPPPP------PPSPP 16 >01_05_0641 - 23881429-23881836 Length = 135 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GG G Sbjct: 37 GGGGGGETGKPDGGGGGGGEG 57 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGG G Sbjct: 36 GGGGGGGETGKPDGGGGGGGEG 57 >01_05_0552 - 23173106-23173184,23173266-23173411,23173543-23174022, 23174106-23174161,23175538-23175637,23175708-23175765, 23176163-23176278,23176915-23176974,23177297-23177383, 23178250-23178341,23178409-23178587,23178946-23179087, 23179655-23179706,23180241-23180473,23180569-23180745, 23180882-23181044,23181242-23181392,23181493-23181574, 23182193-23182332,23182499-23183013 Length = 1035 Score = 31.5 bits (68), Expect = 0.85 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 105 GGGGGG------GGGGGGGGGG 120 >01_02_0031 + 10364487-10365407 Length = 306 Score = 31.5 bits (68), Expect = 0.85 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PPP PPPP PPP P Sbjct: 169 PPPPPPPPALPAPPPPPAP 187 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 PP PPPP PPPP P Sbjct: 169 PPPPPPPPALPAPPPPPAP 187 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PPP PPPPP Sbjct: 169 PPPPPPPPALPA---PPPPP 185 Score = 28.7 bits (61), Expect = 6.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 326 PXPXPPPPXXPXXXPPXPP 382 P P PPPP P PP P Sbjct: 169 PPPPPPPPALPAPPPPPAP 187 >01_01_1125 - 8920590-8924372 Length = 1260 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P GG P PPPP Sbjct: 164 PPPPPSAMP--LAGGEPRPPPP 183 >01_01_1067 + 8403584-8404195,8404532-8404693,8404837-8405346, 8405434-8405493,8405721-8406137,8406576-8407100 Length = 761 Score = 31.5 bits (68), Expect = 0.85 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 50 GGGGGG------GGGGGGGGGG 65 >01_01_0187 + 1624159-1624279,1624530-1624590,1625118-1625574 Length = 212 Score = 31.5 bits (68), Expect = 0.85 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = -3 Query: 433 GGGGGGXPPP--XXGGGGXGGGG 371 GGGG PPP GGGG GGG Sbjct: 66 GGGGAAAPPPTMQMGGGGFRGGG 88 >01_01_0179 + 1517379-1517721,1518092-1518376,1519462-1519699, 1519796-1519946,1520049-1520446,1520552-1520573 Length = 478 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GG GGG GGGG GGGG Sbjct: 16 GGRGGGADREANGGGGGGGGG 36 >12_02_1036 - 25587313-25587890,25589209-25589272,25589356-25589448, 25589533-25589683,25590474-25590539,25590594-25590907 Length = 421 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PP P P Sbjct: 39 PPPPPPPPPP------PPAPAP 54 >11_01_0621 - 4981070-4981136,4982906-4983825 Length = 328 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P PP P PPPP Sbjct: 128 PPPPPHPLPPP----PPTPPPP 145 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPP 373 PPP P P PP P PP Sbjct: 128 PPPPPHPLPPPPPTPPPP 145 >10_08_0232 - 16053034-16053597 Length = 187 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G GGG G Sbjct: 75 GGGGGGAP---YGGAGFGGGSG 93 >10_08_0127 - 15010125-15011068,15011328-15011835 Length = 483 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GG GG Sbjct: 361 GGGGGGSGSGGGGGGVGGVGG 381 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG G GGG Sbjct: 361 GGGGGGSGSGGGGGGVGGVGGG 382 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 362 GGGGGSGSGGGGGGVGGVGGG 382 >10_03_0012 - 7037088-7037282,7037453-7037954,7038079-7038081, 7040633-7041213 Length = 426 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPP 425 PPPPP PP P G PP Sbjct: 100 PPPPPPPPQPIHAAGEFPP 118 Score = 29.5 bits (63), Expect = 3.4 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 10/32 (31%) Frame = +3 Query: 369 PPPPPXPPPPXX--------GGGX--PPPPPP 434 PPPPP P P GGG PPPPPP Sbjct: 74 PPPPPSMPGPLPAPYDHHHRGGGPAQPPPPPP 105 >10_02_0067 + 4884902-4885210,4886008-4886037 Length = 112 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGG 377 GGGGGG P G GG GG Sbjct: 30 GGGGGGGQQPGEGSGGIGG 48 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,998,629 Number of Sequences: 37544 Number of extensions: 660672 Number of successful extensions: 54205 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5011 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37205 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2279943096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -