BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_A08 (828 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino pro... 46 6e-05 U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro... 46 6e-05 BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p pro... 46 6e-05 BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p pro... 46 6e-05 BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro... 46 6e-05 AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p pro... 46 6e-05 AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB... 46 6e-05 AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA... 46 6e-05 AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA,... 46 6e-05 AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB,... 46 6e-05 AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD,... 46 6e-05 AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC,... 46 6e-05 AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA... 42 8e-04 AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p pro... 42 0.001 AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA... 42 0.001 AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-P... 41 0.002 AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. 41 0.002 AY089613-1|AAL90351.1| 798|Drosophila melanogaster RE28061p pro... 40 0.005 AE014297-778|AAF54262.1| 798|Drosophila melanogaster CG9748-PA ... 40 0.005 AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p pro... 39 0.007 AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p pro... 39 0.007 AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-P... 39 0.007 AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA... 39 0.007 BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p pro... 38 0.013 BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p pro... 38 0.013 AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p pro... 38 0.013 AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA... 38 0.013 AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA... 38 0.013 M19692-1|AAA28934.1| 1520|Drosophila melanogaster protein ( D.me... 38 0.017 AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p pro... 38 0.017 AY058497-1|AAL13726.1| 1249|Drosophila melanogaster LD03455p pro... 38 0.017 AE014296-2776|AAF49431.2| 1620|Drosophila melanogaster CG4032-PA... 38 0.017 AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-P... 38 0.017 BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p pro... 38 0.022 BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p pro... 38 0.022 AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p pro... 38 0.022 AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p pro... 38 0.022 AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA... 38 0.022 AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA,... 38 0.022 AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB,... 38 0.022 J03177-1|AAA28535.1| 510|Drosophila melanogaster protein ( D.me... 37 0.039 DQ017435-1|AAY82217.1| 53|Drosophila melanogaster CG10002 prot... 37 0.039 DQ017434-1|AAY82216.1| 53|Drosophila melanogaster CG10002 prot... 37 0.039 BT023936-1|ABB36440.1| 510|Drosophila melanogaster RE06859p pro... 37 0.039 BT010029-1|AAQ22498.1| 426|Drosophila melanogaster RE03865p pro... 37 0.039 AY121649-1|AAM51976.1| 950|Drosophila melanogaster LD23647p pro... 37 0.039 AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p pro... 37 0.039 AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC... 37 0.039 AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB... 37 0.039 AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA... 37 0.039 AE014297-4241|AAF56798.1| 510|Drosophila melanogaster CG10002-P... 37 0.039 AE014134-2238|AAF53220.2| 950|Drosophila melanogaster CG5787-PA... 37 0.039 BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p pro... 36 0.051 AY094783-1|AAM11136.1| 118|Drosophila melanogaster LD12750p pro... 36 0.051 AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p pro... 36 0.051 AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB... 36 0.051 AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA... 36 0.051 AE014298-1712|AAF48112.1| 118|Drosophila melanogaster CG1840-PA... 36 0.051 AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-P... 36 0.051 AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-P... 36 0.051 AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-P... 36 0.051 U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptid... 36 0.068 U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding pr... 36 0.068 M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protei... 36 0.068 L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding pr... 36 0.068 BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p pro... 36 0.068 AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p pro... 36 0.068 AY113557-1|AAM29562.1| 93|Drosophila melanogaster RH06401p pro... 36 0.068 AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p pro... 36 0.068 AY070547-1|AAL48018.1| 335|Drosophila melanogaster LD27487p pro... 36 0.068 AE014298-2542|AAF48711.1| 133|Drosophila melanogaster CG5172-PA... 36 0.068 AE014298-2541|AAS65393.1| 95|Drosophila melanogaster CG5172-PB... 36 0.068 AE014298-1420|AAF46562.2| 376|Drosophila melanogaster CG2962-PA... 36 0.068 AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA... 36 0.068 AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB... 36 0.068 AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-P... 36 0.068 AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-P... 36 0.068 AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-P... 36 0.068 AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-P... 36 0.068 AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-P... 36 0.068 X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin pr... 36 0.089 BT001738-1|AAN71493.1| 331|Drosophila melanogaster RE72617p pro... 36 0.089 AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p pro... 36 0.089 AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA... 36 0.089 AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA... 36 0.089 X15586-1|CAA33611.1| 1443|Drosophila melanogaster protein ( D.me... 35 0.16 U42699-1|AAA96754.1| 924|Drosophila melanogaster trachealess pr... 35 0.16 BT023503-1|AAY84903.1| 1327|Drosophila melanogaster LD20030p pro... 35 0.16 BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p pro... 35 0.16 AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p pro... 35 0.16 AY118423-1|AAM48452.1| 263|Drosophila melanogaster RH04014p pro... 35 0.16 AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p pro... 35 0.16 AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p pro... 35 0.16 AY051568-1|AAK92992.1| 263|Drosophila melanogaster GH21518p pro... 35 0.16 AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 p... 35 0.16 AF116572-1|AAD31170.1| 1327|Drosophila melanogaster ribonuclease... 35 0.16 AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA... 35 0.16 AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB... 35 0.16 AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC... 35 0.16 AE014297-2841|AAF55795.1| 263|Drosophila melanogaster CG4000-PA... 35 0.16 AE014297-1087|AAF54491.1| 695|Drosophila melanogaster CG12809-P... 35 0.16 AE014296-2989|AAF49282.3| 1412|Drosophila melanogaster CG8127-PB... 35 0.16 AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-P... 35 0.16 AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-P... 35 0.16 AE013599-1244|AAS64915.1| 253|Drosophila melanogaster CG13214-P... 35 0.16 AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-P... 35 0.16 AE013599-540|AAF59169.1| 1327|Drosophila melanogaster CG8730-PA ... 35 0.16 AE013599-399|AAM68891.2| 409|Drosophila melanogaster CG11112-PB... 35 0.16 DQ539309-1|ABG02830.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539308-1|ABG02829.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539307-1|ABG02828.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539306-1|ABG02827.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539305-1|ABG02826.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539304-1|ABG02825.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539303-1|ABG02824.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539302-1|ABG02823.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539301-1|ABG02822.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539300-1|ABG02821.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539299-1|ABG02820.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539298-1|ABG02819.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539297-1|ABG02818.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539296-1|ABG02817.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539295-1|ABG02816.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539294-1|ABG02815.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539293-1|ABG02814.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539292-1|ABG02813.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539291-1|ABG02812.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539290-1|ABG02811.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539289-1|ABG02810.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539288-1|ABG02809.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539287-1|ABG02808.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539286-1|ABG02807.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539285-1|ABG02806.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539284-1|ABG02805.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539283-1|ABG02804.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539282-1|ABG02803.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 DQ539281-1|ABG02802.1| 342|Drosophila melanogaster CG17108 prot... 34 0.21 BT030113-1|ABN49252.1| 342|Drosophila melanogaster IP06991p pro... 34 0.21 BT011144-1|AAR82812.1| 356|Drosophila melanogaster GH24939p pro... 34 0.21 BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p pro... 34 0.21 AM294881-1|CAL26867.1| 158|Drosophila melanogaster CG10853 prot... 34 0.21 AM294880-1|CAL26866.1| 158|Drosophila melanogaster CG10853 prot... 34 0.21 AM294879-1|CAL26865.1| 158|Drosophila melanogaster CG10853 prot... 34 0.21 AM294878-1|CAL26864.1| 158|Drosophila melanogaster CG10853 prot... 34 0.21 AM294877-1|CAL26863.1| 158|Drosophila melanogaster CG10853 prot... 34 0.21 AM294875-1|CAL26861.1| 158|Drosophila melanogaster CG10853 prot... 34 0.21 AM294874-1|CAL26860.1| 158|Drosophila melanogaster CG10853 prot... 34 0.21 AM294872-1|CAL26858.1| 158|Drosophila melanogaster CG10853 prot... 34 0.21 AE014298-1193|AAF46385.1| 679|Drosophila melanogaster CG33181-P... 34 0.21 AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-P... 34 0.21 AE014134-1932|AAF52992.1| 342|Drosophila melanogaster CG17108-P... 34 0.21 AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA... 34 0.21 AY113490-1|AAM29495.1| 158|Drosophila melanogaster RE47308p pro... 34 0.27 AY075437-1|AAL68252.1| 155|Drosophila melanogaster LP09837p pro... 34 0.27 AL031583-7|CAB41346.1| 359|Drosophila melanogaster EG:34F3.10 p... 34 0.27 AE014298-2787|AAF48900.2| 2030|Drosophila melanogaster CG32542-P... 34 0.27 AE014298-1899|AAF48264.2| 158|Drosophila melanogaster CG1987-PA... 34 0.27 AE014298-111|AAF45553.2| 359|Drosophila melanogaster CG13358-PA... 34 0.27 AE014296-723|AAF47815.1| 155|Drosophila melanogaster CG10853-PA... 34 0.27 AE013599-1122|AAF58779.3| 757|Drosophila melanogaster CG12052-P... 34 0.27 AB107346-1|BAC67651.1| 757|Drosophila melanogaster Lola protein... 34 0.27 AB107326-1|BAC67631.1| 757|Drosophila melanogaster Lola protein... 34 0.27 AB107306-1|BAC67611.1| 757|Drosophila melanogaster Lola protein... 34 0.27 AB107286-1|BAC67591.1| 757|Drosophila melanogaster Lola protein... 34 0.27 BT010114-1|AAQ22583.1| 515|Drosophila melanogaster GH02426p pro... 33 0.36 AY119067-1|AAM50927.1| 217|Drosophila melanogaster LP08165p pro... 33 0.36 AY118596-1|AAM49965.1| 165|Drosophila melanogaster LD48005p pro... 33 0.36 AY118420-1|AAM48449.1| 250|Drosophila melanogaster RE74758p pro... 33 0.36 AY075371-1|AAL68216.1| 165|Drosophila melanogaster GM14667p pro... 33 0.36 AE014297-3395|AAX52972.1| 515|Drosophila melanogaster CG33111-P... 33 0.36 AE014297-3394|AAS65199.1| 515|Drosophila melanogaster CG33111-P... 33 0.36 AE014297-3393|AAF56193.2| 515|Drosophila melanogaster CG33111-P... 33 0.36 AE014296-1850|AAF50135.2| 250|Drosophila melanogaster CG12523-P... 33 0.36 AE013599-3513|AAN16117.1| 165|Drosophila melanogaster CG3800-PA... 33 0.36 X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. 33 0.48 U02042-1|AAA19249.1| 606|Drosophila melanogaster GABA receptor ... 33 0.48 M69057-3|AAA28558.1| 595|Drosophila melanogaster GABA-alpha rec... 33 0.48 M69057-2|AAA28557.1| 601|Drosophila melanogaster GABA-alpha rec... 33 0.48 M69057-1|AAA28556.1| 606|Drosophila melanogaster GABA-alpha rec... 33 0.48 BT015282-1|AAT94511.1| 1250|Drosophila melanogaster LD04601p pro... 33 0.48 BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p pro... 33 0.48 BT011110-1|AAR82777.1| 1777|Drosophila melanogaster LD32107p pro... 33 0.48 AY094731-1|AAM11084.1| 708|Drosophila melanogaster GH25793p pro... 33 0.48 AY052130-1|AAK93554.1| 455|Drosophila melanogaster SD08037p pro... 33 0.48 AY052129-1|AAK93553.1| 1601|Drosophila melanogaster SD07967p pro... 33 0.48 AF299248-1|AAG22814.1| 2836|Drosophila melanogaster talin protein. 33 0.48 AF255733-1|AAF71288.1| 1250|Drosophila melanogaster DNA topoisom... 33 0.48 AE014298-2877|AAF48974.1| 348|Drosophila melanogaster CG14218-P... 33 0.48 AE014298-1311|AAF46472.2| 1837|Drosophila melanogaster CG12124-P... 33 0.48 AE014298-1168|AAF46366.1| 926|Drosophila melanogaster CG10555-P... 33 0.48 AE014297-3872|AAF56525.1| 454|Drosophila melanogaster CG5913-PA... 33 0.48 AE014296-3444|AAF51657.1| 98|Drosophila melanogaster CG11458-P... 33 0.48 AE014296-1598|AAN11989.1| 585|Drosophila melanogaster CG10537-P... 33 0.48 AE014296-1597|AAF50311.1| 606|Drosophila melanogaster CG10537-P... 33 0.48 AE014296-1596|AAN11988.1| 606|Drosophila melanogaster CG10537-P... 33 0.48 AE014296-1476|AAF50399.1| 2836|Drosophila melanogaster CG6831-PA... 33 0.48 AE014134-3114|AAF53813.2| 1250|Drosophila melanogaster CG10123-P... 33 0.48 AE013599-3336|AAM68207.1| 751|Drosophila melanogaster CG13503-P... 33 0.48 AE013599-3335|AAM68206.1| 751|Drosophila melanogaster CG13503-P... 33 0.48 AE013599-3334|AAM68205.1| 751|Drosophila melanogaster CG13503-P... 33 0.48 AE013599-3333|AAF46800.2| 751|Drosophila melanogaster CG13503-P... 33 0.48 AE013599-3332|AAM68204.1| 708|Drosophila melanogaster CG13503-P... 33 0.48 AE013599-3331|AAM68208.2| 761|Drosophila melanogaster CG13503-P... 33 0.48 AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-P... 33 0.48 U33427-1|AAA96257.1| 949|Drosophila melanogaster bHLH-PAS prote... 33 0.63 BT023949-1|ABB36453.1| 1312|Drosophila melanogaster IP03879p pro... 33 0.63 AY122174-1|AAM52686.1| 877|Drosophila melanogaster LD34142p pro... 33 0.63 AY094911-1|AAM11264.1| 902|Drosophila melanogaster RH17284p pro... 33 0.63 AE014298-2781|AAF48895.2| 1868|Drosophila melanogaster CG7282-PA... 33 0.63 AE014298-2334|AAF48566.2| 1311|Drosophila melanogaster CG32577-P... 33 0.63 AE014296-2433|AAF49702.1| 2061|Drosophila melanogaster CG9425-PA... 33 0.63 AE014296-2432|AAS65008.1| 2103|Drosophila melanogaster CG9425-PB... 33 0.63 AE014296-101|AAF47386.1| 958|Drosophila melanogaster CG6883-PA,... 33 0.63 AE014296-100|ABI31226.1| 929|Drosophila melanogaster CG6883-PB,... 33 0.63 AE014134-1928|AAF52988.1| 96|Drosophila melanogaster CG17107-P... 33 0.63 X73134-1|CAA51651.1| 127|Drosophila melanogaster GCR 20 protein. 32 0.83 X71976-1|CAA50796.1| 188|Drosophila melanogaster GCR 1 protein ... 32 0.83 X55902-1|CAA39395.1| 700|Drosophila melanogaster Bj6 protein pr... 32 0.83 M33496-2|AAA03215.1| 698|Drosophila melanogaster protein ( D.me... 32 0.83 M33496-1|AAA03214.1| 700|Drosophila melanogaster protein ( D.me... 32 0.83 D21203-1|BAA04745.2| 1408|Drosophila melanogaster large Forked p... 32 0.83 D17528-1|BAA04479.1| 604|Drosophila melanogaster small forked p... 32 0.83 BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p pro... 32 0.83 BT024335-1|ABC86397.1| 257|Drosophila melanogaster IP09958p pro... 32 0.83 BT023944-1|ABB36448.1| 834|Drosophila melanogaster LD32364p pro... 32 0.83 BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p pro... 32 0.83 BT021407-1|AAX33555.1| 720|Drosophila melanogaster LD06749p pro... 32 0.83 BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p pro... 32 0.83 AY119651-1|AAM50305.1| 700|Drosophila melanogaster RE58280p pro... 32 0.83 AY119132-1|AAM50992.1| 188|Drosophila melanogaster RE35358p pro... 32 0.83 AY094861-1|AAM11214.1| 362|Drosophila melanogaster RE22192p pro... 32 0.83 AY070976-1|AAL48598.1| 127|Drosophila melanogaster RE07460p pro... 32 0.83 AY051622-1|AAK93046.1| 456|Drosophila melanogaster GH27042p pro... 32 0.83 AM294873-1|CAL26859.1| 155|Drosophila melanogaster CG10853 prot... 32 0.83 AM294870-1|CAL26856.1| 155|Drosophila melanogaster CG10853 prot... 32 0.83 AJ271041-1|CAB66004.1| 286|Drosophila melanogaster Gly-rich pro... 32 0.83 AF162774-1|AAF68853.2| 720|Drosophila melanogaster Nopp140-like... 32 0.83 AE014298-2555|AAO41691.1| 426|Drosophila melanogaster CG5424-PE... 32 0.83 AE014298-2554|AAF48719.1| 608|Drosophila melanogaster CG5424-PA... 32 0.83 AE014298-2553|AAO41690.1| 1509|Drosophila melanogaster CG5424-PC... 32 0.83 AE014298-2552|AAO41689.1| 1436|Drosophila melanogaster CG5424-PD... 32 0.83 AE014298-2551|AAF48718.2| 1436|Drosophila melanogaster CG5424-PB... 32 0.83 AE014298-2550|ABI30989.1| 1918|Drosophila melanogaster CG5424-PF... 32 0.83 AE014298-2513|AAF48690.2| 834|Drosophila melanogaster CG8949-PA... 32 0.83 AE014298-2380|AAX52501.1| 698|Drosophila melanogaster CG4211-PC... 32 0.83 AE014298-2379|AAF48597.2| 700|Drosophila melanogaster CG4211-PA... 32 0.83 AE014298-2378|AAN09398.1| 742|Drosophila melanogaster CG4211-PB... 32 0.83 AE014298-950|AAF46198.2| 456|Drosophila melanogaster CG3135-PA ... 32 0.83 AE014298-9|AAX52465.1| 193|Drosophila melanogaster CG13376-PA p... 32 0.83 AE014297-4805|AAF57194.1| 188|Drosophila melanogaster CG2150-PA... 32 0.83 AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA... 32 0.83 AE014297-3653|AAF56353.1| 362|Drosophila melanogaster CG7016-PA... 32 0.83 AE014297-1701|AAF54959.1| 127|Drosophila melanogaster CG9757-PA... 32 0.83 AE014296-3628|AAF51788.3| 720|Drosophila melanogaster CG7421-PA... 32 0.83 AE014296-1088|AAF50683.1| 239|Drosophila melanogaster CG12330-P... 32 0.83 AE013599-1467|AAF58524.2| 259|Drosophila melanogaster CG30042-P... 32 0.83 X71974-1|CAA50794.1| 196|Drosophila melanogaster GCR 17 protein. 32 1.1 U29608-1|AAA70336.1| 1099|Drosophila melanogaster LATS protein. 32 1.1 L39837-1|AAA73959.1| 1099|Drosophila melanogaster tumor suppress... 32 1.1 L02106-2|AAA99872.1| 465|Drosophila melanogaster ribonucleoprot... 32 1.1 L02106-1|AAA99873.1| 471|Drosophila melanogaster ribonucleoprot... 32 1.1 EF108315-1|ABL09495.1| 528|Drosophila melanogaster serine-pepti... 32 1.1 BT021376-1|AAX33524.1| 758|Drosophila melanogaster LD46788p pro... 32 1.1 BT010254-1|AAQ23572.1| 196|Drosophila melanogaster RE34656p pro... 32 1.1 BT004830-1|AAO45186.1| 821|Drosophila melanogaster SD19495p pro... 32 1.1 BT003186-1|AAO24941.1| 756|Drosophila melanogaster RE65015p pro... 32 1.1 BT001320-1|AAN71075.1| 434|Drosophila melanogaster AT15526p pro... 32 1.1 AY128472-1|AAM75065.1| 836|Drosophila melanogaster RE28238p pro... 32 1.1 AY119556-1|AAM50210.1| 1272|Drosophila melanogaster GH28840p pro... 32 1.1 AY118781-1|AAM50641.1| 117|Drosophila melanogaster GH13168p pro... 32 1.1 AY071088-1|AAL48710.1| 173|Drosophila melanogaster RE15531p pro... 32 1.1 AY069803-1|AAL39948.1| 856|Drosophila melanogaster SD04280p pro... 32 1.1 AY069580-1|AAL39725.1| 406|Drosophila melanogaster LD31675p pro... 32 1.1 AY060485-1|AAL25524.1| 696|Drosophila melanogaster SD09360p pro... 32 1.1 AM294876-1|CAL26862.1| 158|Drosophila melanogaster CG10853 prot... 32 1.1 AE014298-3176|AAN09565.1| 856|Drosophila melanogaster CG14619-P... 32 1.1 AE014298-3175|AAN09564.1| 856|Drosophila melanogaster CG14619-P... 32 1.1 AE014298-3174|AAF50952.2| 856|Drosophila melanogaster CG14619-P... 32 1.1 AE014298-2545|AAF48713.1| 173|Drosophila melanogaster CG10598-P... 32 1.1 AE014298-2544|AAN09437.1| 230|Drosophila melanogaster CG10598-P... 32 1.1 AE014298-2027|AAN09585.1| 2148|Drosophila melanogaster CG1517-PC... 32 1.1 AE014298-2026|AAF48365.2| 2196|Drosophila melanogaster CG1517-PB... 32 1.1 AE014298-1554|AAF48000.3| 3539|Drosophila melanogaster CG11122-P... 32 1.1 AE014298-972|AAF46216.3| 758|Drosophila melanogaster CG33691-PA... 32 1.1 AE014298-971|AAZ52507.1| 702|Drosophila melanogaster CG33691-PC... 32 1.1 AE014297-4663|AAF57085.1| 1105|Drosophila melanogaster CG12072-P... 32 1.1 AE014297-4014|AAX53003.1| 434|Drosophila melanogaster CG6354-PE... 32 1.1 AE014297-4013|AAX53002.1| 434|Drosophila melanogaster CG6354-PD... 32 1.1 AE014297-4012|AAX53001.1| 471|Drosophila melanogaster CG6354-PI... 32 1.1 AE014297-4011|AAX53000.1| 471|Drosophila melanogaster CG6354-PH... 32 1.1 AE014297-4010|AAX52999.1| 471|Drosophila melanogaster CG6354-PF... 32 1.1 AE014297-4009|AAF56633.1| 471|Drosophila melanogaster CG6354-PB... 32 1.1 AE014297-4008|AAX52998.1| 465|Drosophila melanogaster CG6354-PG... 32 1.1 AE014297-4007|AAX52997.1| 465|Drosophila melanogaster CG6354-PC... 32 1.1 AE014297-4006|AAN14092.1| 465|Drosophila melanogaster CG6354-PA... 32 1.1 AE014297-3096|AAF55954.1| 117|Drosophila melanogaster CG5778-PA... 32 1.1 AE014297-952|AAF54387.1| 632|Drosophila melanogaster CG9373-PA ... 32 1.1 AE014134-2320|AAN10833.1| 836|Drosophila melanogaster CG6043-PC... 32 1.1 AE014134-2318|AAN10831.1| 759|Drosophila melanogaster CG6043-PB... 32 1.1 AE014134-2317|AAF53274.2| 759|Drosophila melanogaster CG6043-PA... 32 1.1 AE014134-2316|AAN10830.1| 918|Drosophila melanogaster CG6043-PD... 32 1.1 AE014134-2099|AAF53122.1| 406|Drosophila melanogaster CG14939-P... 32 1.1 AY069431-1|AAL39576.1| 417|Drosophila melanogaster LD14015p pro... 28 1.1 AE014296-1155|AAF50644.1| 417|Drosophila melanogaster CG10103-P... 28 1.1 X59772-1|CAB36921.1| 850|Drosophila melanogaster ovo protein pr... 31 1.5 U11383-1|AAB60216.1| 1028|Drosophila melanogaster Ovo-1028aa pro... 31 1.5 BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p pro... 31 1.5 BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p pro... 31 1.5 BT023751-1|AAZ41759.1| 1594|Drosophila melanogaster RH56202p pro... 31 1.5 BT022701-1|AAY55117.1| 157|Drosophila melanogaster IP07196p pro... 31 1.5 BT003171-1|AAO24926.1| 443|Drosophila melanogaster SD07604p pro... 31 1.5 BT001477-1|AAN71232.1| 443|Drosophila melanogaster LD21345p pro... 31 1.5 AY119649-1|AAM50303.1| 975|Drosophila melanogaster RE46053p pro... 31 1.5 AY119139-1|AAM50999.1| 615|Drosophila melanogaster RE41430p pro... 31 1.5 AY113614-1|AAM29619.1| 121|Drosophila melanogaster RH62530p pro... 31 1.5 AY094838-1|AAM11191.1| 1351|Drosophila melanogaster LD47350p pro... 31 1.5 AY075448-1|AAL68261.2| 218|Drosophila melanogaster RE09269p pro... 31 1.5 AY070499-1|AAL47970.1| 428|Drosophila melanogaster GH07841p pro... 31 1.5 AY060415-1|AAL25454.1| 463|Drosophila melanogaster LD37240p pro... 31 1.5 AY051892-1|AAK93316.1| 349|Drosophila melanogaster LD38046p pro... 31 1.5 AM412888-1|CAL85511.1| 116|Drosophila melanogaster CG9080 prote... 31 1.5 AM412887-1|CAL85510.1| 116|Drosophila melanogaster CG9080 prote... 31 1.5 AM412886-1|CAL85509.1| 116|Drosophila melanogaster CG9080 prote... 31 1.5 AM412885-1|CAL85508.1| 116|Drosophila melanogaster CG9080 prote... 31 1.5 AM294871-1|CAL26857.1| 148|Drosophila melanogaster CG10853 prot... 31 1.5 AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 p... 31 1.5 AL023893-1|CAA19655.1| 485|Drosophila melanogaster EG:132E8.1 p... 31 1.5 AL009195-3|CAA15702.1| 463|Drosophila melanogaster EG:30B8.5,FB... 31 1.5 AJ430589-1|CAD23207.1| 1222|Drosophila melanogaster ovoA protein... 31 1.5 AJ430588-1|CAD23206.1| 1354|Drosophila melanogaster shavenbaby p... 31 1.5 AE014298-3100|AAF50843.2| 348|Drosophila melanogaster CG32521-P... 31 1.5 AE014298-2797|AAF48914.2| 193|Drosophila melanogaster CG14191-P... 31 1.5 AE014298-2543|AAF48712.2| 237|Drosophila melanogaster CG12997-P... 31 1.5 AE014298-1780|AAF48175.2| 615|Drosophila melanogaster CG11138-P... 31 1.5 AE014298-1424|AAF46566.2| 349|Drosophila melanogaster CG2961-PA... 31 1.5 AE014298-702|AAF46002.2| 975|Drosophila melanogaster CG6824-PA,... 31 1.5 AE014298-701|ABC67174.1| 1028|Drosophila melanogaster CG6824-PD,... 31 1.5 AE014298-700|AAF46003.2| 1222|Drosophila melanogaster CG6824-PC,... 31 1.5 AE014298-699|AAF46001.2| 1351|Drosophila melanogaster CG6824-PB,... 31 1.5 AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB,... 31 1.5 AE014298-367|AAF45758.1| 463|Drosophila melanogaster CG3218-PA ... 31 1.5 AE014298-190|AAS65244.1| 443|Drosophila melanogaster CG3056-PB,... 31 1.5 AE014298-189|AAF45613.1| 485|Drosophila melanogaster CG3056-PA,... 31 1.5 AE014297-1019|AAN13441.1| 157|Drosophila melanogaster CG31415-P... 31 1.5 AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA... 31 1.5 AE013599-1819|AAS64855.1| 433|Drosophila melanogaster CG8118-PC... 31 1.5 AE013599-1817|AAF58300.2| 1594|Drosophila melanogaster CG8118-PB... 31 1.5 AE013599-1816|AAF58299.1| 1594|Drosophila melanogaster CG8118-PA... 31 1.5 AE013599-1232|AAF58699.1| 121|Drosophila melanogaster CG9080-PA... 31 1.5 BT030440-1|ABO52860.1| 1378|Drosophila melanogaster LD40879p pro... 31 1.9 BT029136-1|ABJ17069.1| 1196|Drosophila melanogaster LD14750p pro... 31 1.9 BT025041-1|ABE73212.1| 1255|Drosophila melanogaster LD15160p pro... 31 1.9 BT024217-1|ABC86279.1| 1373|Drosophila melanogaster RE19210p pro... 31 1.9 BT009951-1|AAQ22420.1| 295|Drosophila melanogaster RH51767p pro... 31 1.9 BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p pro... 31 1.9 AY119041-1|AAM50901.1| 393|Drosophila melanogaster LP06455p pro... 31 1.9 AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p pro... 31 1.9 AF181637-1|AAD55423.1| 1266|Drosophila melanogaster BcDNA.GH0791... 31 1.9 AE014298-2744|AAF48863.1| 1895|Drosophila melanogaster CG15040-P... 31 1.9 AE014298-2576|AAF48733.1| 577|Drosophila melanogaster CG12432-P... 31 1.9 AE014298-979|AAF46221.2| 1027|Drosophila melanogaster CG14431-PA... 31 1.9 AE014298-554|AAS72337.3| 1254|Drosophila melanogaster CG32782-PD... 31 1.9 AE014298-553|AAN09104.4| 1254|Drosophila melanogaster CG32782-PC... 31 1.9 AE014297-996|AAF54422.3| 4671|Drosophila melanogaster CG9492-PA ... 31 1.9 AE014297-425|AAF51897.2| 295|Drosophila melanogaster CG1154-PA ... 31 1.9 AE014297-416|AAF51905.3| 393|Drosophila melanogaster CG10303-PA... 31 1.9 AE014296-2979|ABC66133.1| 329|Drosophila melanogaster CG34002-P... 31 1.9 AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC... 31 1.9 AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB... 31 1.9 AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD... 31 1.9 AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA... 31 1.9 AE014134-2984|AAF53715.3| 1377|Drosophila melanogaster CG10600-P... 31 1.9 AE013599-1228|AAF58703.1| 120|Drosophila melanogaster CG13227-P... 31 1.9 AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p pro... 26 2.0 AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA... 26 2.0 X62636-1|CAA44502.1| 326|Drosophila melanogaster hrp36.1 protein. 31 2.5 X59691-1|CAA42212.1| 386|Drosophila melanogaster P11 (hnRNP pro... 31 2.5 X58183-1|CAA41170.1| 386|Drosophila melanogaster heterogeneous ... 31 2.5 X54803-1|CAA38574.1| 386|Drosophila melanogaster Hrb87F protein. 31 2.5 X54251-1|CAA38152.1| 1596|Drosophila melanogaster nuclear protei... 31 2.5 BT025960-1|ABG02204.1| 433|Drosophila melanogaster IP16063p pro... 31 2.5 BT023829-1|AAZ86750.1| 107|Drosophila melanogaster RE20030p pro... 31 2.5 BT016135-1|AAV37020.1| 1218|Drosophila melanogaster GH06496p pro... 31 2.5 BT012315-1|AAS77440.1| 385|Drosophila melanogaster LD32727p pro... 31 2.5 AY121713-1|AAM52040.1| 959|Drosophila melanogaster SD04710p pro... 31 2.5 AY094937-1|AAM11290.1| 394|Drosophila melanogaster RH54416p pro... 31 2.5 AY061579-1|AAL29127.1| 613|Drosophila melanogaster SD02991p pro... 31 2.5 AY058599-1|AAL13828.1| 773|Drosophila melanogaster LD29226p pro... 31 2.5 AY051589-1|AAK93013.1| 564|Drosophila melanogaster GH23387p pro... 31 2.5 AF247763-1|AAF74194.1| 613|Drosophila melanogaster SCAR protein. 31 2.5 AF053091-1|AAC06254.1| 2715|Drosophila melanogaster eyelid protein. 31 2.5 AE014298-3099|AAN09667.1| 388|Drosophila melanogaster CG32521-P... 31 2.5 AE014298-3098|AAF50844.2| 388|Drosophila melanogaster CG32521-P... 31 2.5 AE014298-2723|AAX52506.1| 991|Drosophila melanogaster CG32547-P... 31 2.5 AE014297-2398|AAN13750.1| 2716|Drosophila melanogaster CG7467-PB... 31 2.5 AE014297-2397|AAS65166.1| 2556|Drosophila melanogaster CG7467-PC... 31 2.5 AE014297-2396|AAF55457.1| 2703|Drosophila melanogaster CG7467-PA... 31 2.5 AE014297-1716|AAF54967.1| 385|Drosophila melanogaster CG12749-P... 31 2.5 AE014297-1715|AAN13574.1| 325|Drosophila melanogaster CG12749-P... 31 2.5 AE014134-2963|AAF53693.2| 564|Drosophila melanogaster CG10341-P... 31 2.5 AE014134-2001|AAF53042.1| 613|Drosophila melanogaster CG4636-PA... 31 2.5 AE013599-3326|AAG22194.1| 1218|Drosophila melanogaster CG6562-PB... 31 2.5 AE013599-3325|AAF46796.1| 1218|Drosophila melanogaster CG6562-PA... 31 2.5 AE013599-3146|AAF46686.2| 1215|Drosophila melanogaster CG4266-PA... 31 2.5 AE013599-1936|AAF58220.2| 107|Drosophila melanogaster CG30479-P... 31 2.5 DQ285021-1|ABB90104.1| 110|Drosophila melanogaster G-rich selen... 30 3.4 BT021236-1|AAX33384.1| 783|Drosophila melanogaster RH08748p pro... 30 3.4 AY060611-1|AAL28159.1| 108|Drosophila melanogaster GH03581p pro... 30 3.4 AY051919-1|AAK93343.1| 255|Drosophila melanogaster LD40489p pro... 30 3.4 AF396454-1|AAK72981.1| 110|Drosophila melanogaster G-rich selen... 30 3.4 AF234157-1|AAF60294.1| 255|Drosophila melanogaster SR family sp... 30 3.4 AF232773-1|AAF43413.1| 255|Drosophila melanogaster SR family sp... 30 3.4 AF132566-1|AAD27865.2| 528|Drosophila melanogaster LD24380p pro... 30 3.4 AE014298-2546|AAF48714.1| 250|Drosophila melanogaster CG10597-P... 30 3.4 AE014298-1781|AAF48174.1| 264|Drosophila melanogaster CG11138-P... 30 3.4 AE014298-1711|AAF48111.2| 110|Drosophila melanogaster CG1844-PA... 30 3.4 AE014297-2188|AAF55300.1| 255|Drosophila melanogaster CG6987-PA... 30 3.4 AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA... 30 3.4 AE014134-1162|AAN10598.1| 2922|Drosophila melanogaster CG11321-P... 30 3.4 AE014134-1161|AAF52435.2| 2594|Drosophila melanogaster CG11321-P... 30 3.4 AE014134-212|AAF51408.2| 424|Drosophila melanogaster CG33979-PA... 30 3.4 AE014134-211|AAF51409.2| 783|Drosophila melanogaster CG33979-PB... 30 3.4 AE013599-3461|AAF46899.2| 1218|Drosophila melanogaster CG3536-PA... 30 3.4 X97197-1|CAA65831.1| 366|Drosophila melanogaster spliceosomal p... 30 4.4 U54982-2|AAC16666.1| 1262|Drosophila melanogaster stn-B protein. 30 4.4 U21717-1|AAA92045.1| 743|Drosophila melanogaster nervy protein. 30 4.4 M23221-1|AAA28540.1| 2038|Drosophila melanogaster fsh protein. 30 4.4 M15762-1|AAA70424.1| 50|Drosophila melanogaster unknown protei... 30 4.4 DQ138920-1|ABA86526.1| 1505|Drosophila melanogaster CG17766 prot... 30 4.4 BT025138-1|ABE73309.1| 175|Drosophila melanogaster IP06825p pro... 30 4.4 BT023489-1|AAY84889.1| 347|Drosophila melanogaster RE50839p pro... 30 4.4 BT022162-1|AAY51556.1| 395|Drosophila melanogaster IP01380p pro... 30 4.4 BT022134-1|AAY51529.1| 543|Drosophila melanogaster IP08802p pro... 30 4.4 BT015183-1|AAT94412.1| 1525|Drosophila melanogaster SD05962p pro... 30 4.4 BT011350-1|AAR96142.1| 489|Drosophila melanogaster RH05790p pro... 30 4.4 BT011172-1|AAR88533.1| 1262|Drosophila melanogaster RH38069p pro... 30 4.4 BT010126-1|AAQ22595.1| 267|Drosophila melanogaster AT03482p pro... 30 4.4 BT004898-1|AAO47876.1| 743|Drosophila melanogaster LD17501p pro... 30 4.4 BT003578-1|AAO39582.1| 739|Drosophila melanogaster LD24631p pro... 30 4.4 AY122075-1|AAM52587.1| 503|Drosophila melanogaster AT17506p pro... 30 4.4 AY121674-1|AAM52001.1| 611|Drosophila melanogaster RE22741p pro... 30 4.4 AY119224-1|AAM51084.1| 469|Drosophila melanogaster SD16903p pro... 30 4.4 AY119154-1|AAM51014.1| 380|Drosophila melanogaster RE65163p pro... 30 4.4 AY095027-1|AAM11355.1| 1379|Drosophila melanogaster LD11664p pro... 30 4.4 AY069819-1|AAL39964.1| 200|Drosophila melanogaster SD06787p pro... 30 4.4 AL021086-3|CAA15934.1| 1471|Drosophila melanogaster EG:86E4.3 pr... 30 4.4 AJ252082-1|CAB64385.1| 979|Drosophila melanogaster BAB-I protei... 30 4.4 AJ243904-1|CAB64937.1| 773|Drosophila melanogaster SF1 protein ... 30 4.4 AF296285-1|AAL33883.1| 611|Drosophila melanogaster SPZ3 protein. 30 4.4 AE014298-3231|ABI31012.1| 1260|Drosophila melanogaster CG12473-P... 30 4.4 AE014298-3230|EAA46059.2| 1260|Drosophila melanogaster CG12473-P... 30 4.4 AE014298-3143|AAF50813.1| 183|Drosophila melanogaster CG10918-P... 30 4.4 AE014298-1408|AAF46552.2| 1884|Drosophila melanogaster CG32685-P... 30 4.4 AE014298-1329|AAF46491.3| 1367|Drosophila melanogaster CG32705-P... 30 4.4 AE014298-1107|AAF46312.3| 2038|Drosophila melanogaster CG2252-PB... 30 4.4 AE014298-1050|AAF46265.4| 1268|Drosophila melanogaster CG12690-P... 30 4.4 AE014298-857|AAF46136.1| 347|Drosophila melanogaster CG3780-PA ... 30 4.4 AE014298-295|AAF45693.1| 1525|Drosophila melanogaster CG17766-PA... 30 4.4 AE014297-3695|AAF56384.1| 208|Drosophila melanogaster CG11786-P... 30 4.4 AE014297-24|AAN13334.1| 200|Drosophila melanogaster CG14642-PA,... 30 4.4 AE014297-23|AAF52161.1| 392|Drosophila melanogaster CG14642-PB,... 30 4.4 AE014296-854|AAF47906.1| 172|Drosophila melanogaster CG15023-PA... 30 4.4 AE014296-390|AAF47594.1| 553|Drosophila melanogaster CG12361-PA... 30 4.4 AE014296-173|AAS64927.1| 526|Drosophila melanogaster CG9097-PA,... 30 4.4 AE014296-172|AAF47439.2| 977|Drosophila melanogaster CG9097-PB,... 30 4.4 AE014134-2970|AAF53700.1| 530|Drosophila melanogaster CG10348-P... 30 4.4 AE014134-2891|AAN11175.1| 475|Drosophila melanogaster CG5674-PC... 30 4.4 AE014134-2886|AAN11174.1| 489|Drosophila melanogaster CG5674-PA... 30 4.4 AE014134-1358|AAF52574.2| 611|Drosophila melanogaster CG7104-PA... 30 4.4 AE013599-3848|AAF47191.2| 743|Drosophila melanogaster CG3385-PA... 30 4.4 AE013599-2734|AAF57660.2| 1271|Drosophila melanogaster CG30122-P... 30 4.4 X76210-1|CAA53803.1| 389|Drosophila melanogaster homeotic ultra... 29 5.9 X05723-1|CAA29194.1| 389|Drosophila melanogaster Ultrabithorax ... 29 5.9 U31961-13|AAA84410.1| 346|Drosophila melanogaster UBXIVA protein. 29 5.9 U31961-12|AAA84409.1| 363|Drosophila melanogaster UBXIIA protein. 29 5.9 U31961-11|AAA84408.1| 380|Drosophila melanogaster UBXIA protein. 29 5.9 U31961-10|AAA84411.1| 372|Drosophila melanogaster UBXIIB protein. 29 5.9 U31961-9|AAA84412.1| 389|Drosophila melanogaster UBXIB protein. 29 5.9 BT030179-1|ABN49318.1| 82|Drosophila melanogaster IP17830p pro... 29 5.9 BT030120-1|ABN49259.1| 643|Drosophila melanogaster IP13130p pro... 29 5.9 BT024428-1|ABC86490.1| 627|Drosophila melanogaster IP02644p pro... 29 5.9 BT023922-1|ABB36426.1| 1246|Drosophila melanogaster RH04127p pro... 29 5.9 BT023873-1|AAZ86794.1| 512|Drosophila melanogaster AT21758p pro... 29 5.9 BT012673-1|AAT09323.1| 876|Drosophila melanogaster SD07102p pro... 29 5.9 BT010241-1|AAQ23559.1| 380|Drosophila melanogaster RE43738p pro... 29 5.9 BT003529-1|AAO39533.1| 987|Drosophila melanogaster RE18590p pro... 29 5.9 AY118955-1|AAM50815.1| 911|Drosophila melanogaster LD35748p pro... 29 5.9 AY069664-1|AAL39809.1| 600|Drosophila melanogaster LD44138p pro... 29 5.9 AY058550-1|AAL13779.1| 560|Drosophila melanogaster LD24704p pro... 29 5.9 AY058341-1|AAL13570.1| 1024|Drosophila melanogaster GH11706p pro... 29 5.9 AY052115-1|AAK93539.1| 1358|Drosophila melanogaster SD06557p pro... 29 5.9 AM412966-1|CAL85589.1| 265|Drosophila melanogaster Fst protein. 29 5.9 AM412964-1|CAL85587.1| 266|Drosophila melanogaster Fst protein. 29 5.9 AM412963-1|CAL85586.1| 266|Drosophila melanogaster Fst protein. 29 5.9 AL023874-7|CAA19643.1| 552|Drosophila melanogaster EG:100G10.1 ... 29 5.9 AF324426-1|AAG48328.1| 2531|Drosophila melanogaster transcriptio... 29 5.9 AE014298-2943|AAN09520.1| 1034|Drosophila melanogaster CG11940-P... 29 5.9 AE014298-2942|AAF49029.1| 1162|Drosophila melanogaster CG11940-P... 29 5.9 AE014298-2302|AAS65377.1| 1246|Drosophila melanogaster CG9170-PB... 29 5.9 AE014298-2301|AAF48550.1| 1246|Drosophila melanogaster CG9170-PA... 29 5.9 >U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino protein. Length = 1058 Score = 46.0 bits (104), Expect = 6e-05 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP G PPPPPP Sbjct: 503 PPPPPPPPPPLANYGAPPPPPP 524 Score = 41.9 bits (94), Expect = 0.001 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP G PPPPPP Sbjct: 504 PPPPPPPPPLANYGAPPPPPPP 525 Score = 41.9 bits (94), Expect = 0.001 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P P GGG PPPPPP Sbjct: 533 PPPPPPAPIEGGGGIPPPPPP 553 Score = 41.5 bits (93), Expect = 0.001 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PPPP G PPPPP Sbjct: 519 PPPPPPPPPGSGSAPPPPPP 538 Score = 41.5 bits (93), Expect = 0.001 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPPP G PPPPPP Sbjct: 519 PPPPPPPPPGSGSAPPPPPP 538 Score = 39.5 bits (88), Expect = 0.005 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 485 PPPPPPPPPLPAFVAPPPPPP 505 Score = 38.7 bits (86), Expect = 0.010 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP P PPPPPP Sbjct: 486 PPPPPPPPLPAFVAPPPPPPPP 507 Score = 38.3 bits (85), Expect = 0.013 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PPPPPP Sbjct: 485 PPPPPPPPPLPAFVAPPPPPPP 506 Score = 35.9 bits (79), Expect = 0.068 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P PPPPPP Sbjct: 487 PPPPPPPLPAFVAPPPPPPPPP 508 Score = 33.9 bits (74), Expect = 0.27 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP PP PP Sbjct: 503 PPPPPPPPPPLANYGAPPPPP 523 Score = 31.5 bits (68), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 485 PPPPPPPPPLPAFVAPPPPP 504 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP Sbjct: 502 PPPPPPPPPPPLANYGAPPPP 522 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 519 PPPPPPPPPGSGSAPPPPPP 538 Score = 29.9 bits (64), Expect = 4.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PP P PP PP Sbjct: 486 PPPPPPPPLPAFVAPPPPPPP 506 Score = 29.5 bits (63), Expect = 5.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP PP PP Sbjct: 504 PPPPPPPPPLANYGAPPPPPP 524 >U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous protein protein. Length = 1091 Score = 46.0 bits (104), Expect = 6e-05 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP P GG PPPPPP Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPP 560 Score = 44.8 bits (101), Expect = 1e-04 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P GGG PPPPPP Sbjct: 524 PPPPPPPMPGRAGGGPPPPPPP 545 Score = 41.5 bits (93), Expect = 0.001 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P GG PPPPPP Sbjct: 540 PPPPPPPMPGRAGGPPPPPPPP 561 Score = 40.7 bits (91), Expect = 0.002 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +3 Query: 381 PXPPPPXXGGGXPPPPPP 434 P PPPP GGG PPPPPP Sbjct: 512 PMPPPPPGGGGAPPPPPP 529 Score = 37.5 bits (83), Expect = 0.022 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 P PPPP GG PPPPPP Sbjct: 512 PMPPPPPGGGGAPPPPPPP 530 Score = 36.7 bits (81), Expect = 0.039 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PPP PPPP GG PPP P Sbjct: 554 PPPPPPPPGMGGPPPPPMP 572 Score = 36.3 bits (80), Expect = 0.051 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 PP PPPP GG PPPP P Sbjct: 554 PPPPPPPPGMGGPPPPPMP 572 Score = 35.5 bits (78), Expect = 0.089 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 8/29 (27%) Frame = +3 Query: 369 PPPPPX----PPPPXXG----GGXPPPPP 431 PPPPP PPPP G GG PPPPP Sbjct: 557 PPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PPP G G PPPPP Sbjct: 554 PPPPPPPP---GMGGPPPPP 570 Score = 30.7 bits (66), Expect = 2.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PP P PP PP Sbjct: 539 PPPPPPPPMPGRAGGPPPPPP 559 >BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p protein. Length = 1153 Score = 46.0 bits (104), Expect = 6e-05 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP G PPPPPP Sbjct: 598 PPPPPPPPPPMANYGAPPPPPP 619 Score = 42.3 bits (95), Expect = 8e-04 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP G PPPPPP Sbjct: 599 PPPPPPPPPMANYGAPPPPPPP 620 Score = 41.9 bits (94), Expect = 0.001 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P P GGG PPPPPP Sbjct: 628 PPPPPPAPIEGGGGIPPPPPP 648 Score = 41.5 bits (93), Expect = 0.001 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PPPP G PPPPP Sbjct: 614 PPPPPPPPPGSGSAPPPPPP 633 Score = 41.5 bits (93), Expect = 0.001 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPPP G PPPPPP Sbjct: 614 PPPPPPPPPGSGSAPPPPPP 633 Score = 39.5 bits (88), Expect = 0.005 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 580 PPPPPPPPPLPAFVAPPPPPP 600 Score = 39.5 bits (88), Expect = 0.005 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP G PPPPPP Sbjct: 600 PPPPPPPPMANYGAPPPPPPPP 621 Score = 38.7 bits (86), Expect = 0.010 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP P PPPPPP Sbjct: 581 PPPPPPPPLPAFVAPPPPPPPP 602 Score = 38.3 bits (85), Expect = 0.013 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PPPPPP Sbjct: 580 PPPPPPPPPLPAFVAPPPPPPP 601 Score = 35.9 bits (79), Expect = 0.068 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P PPPPPP Sbjct: 582 PPPPPPPLPAFVAPPPPPPPPP 603 Score = 33.9 bits (74), Expect = 0.27 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP PP PP Sbjct: 598 PPPPPPPPPPMANYGAPPPPP 618 Score = 31.5 bits (68), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 580 PPPPPPPPPLPAFVAPPPPP 599 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP Sbjct: 597 PPPPPPPPPPPMANYGAPPPP 617 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 614 PPPPPPPPPGSGSAPPPPPP 633 Score = 29.9 bits (64), Expect = 4.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PP P PP PP Sbjct: 581 PPPPPPPPLPAFVAPPPPPPP 601 Score = 29.9 bits (64), Expect = 4.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP PP PP Sbjct: 599 PPPPPPPPPMANYGAPPPPPP 619 >BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p protein. Length = 1286 Score = 46.0 bits (104), Expect = 6e-05 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP G PPPPPP Sbjct: 731 PPPPPPPPPPMANYGAPPPPPP 752 Score = 42.3 bits (95), Expect = 8e-04 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP G PPPPPP Sbjct: 732 PPPPPPPPPMANYGAPPPPPPP 753 Score = 41.9 bits (94), Expect = 0.001 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P P GGG PPPPPP Sbjct: 761 PPPPPPAPIEGGGGIPPPPPP 781 Score = 41.5 bits (93), Expect = 0.001 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PPPP G PPPPP Sbjct: 747 PPPPPPPPPGSGSAPPPPPP 766 Score = 41.5 bits (93), Expect = 0.001 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPPP G PPPPPP Sbjct: 747 PPPPPPPPPGSGSAPPPPPP 766 Score = 39.5 bits (88), Expect = 0.005 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 713 PPPPPPPPPLPAFVAPPPPPP 733 Score = 39.5 bits (88), Expect = 0.005 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP G PPPPPP Sbjct: 733 PPPPPPPPMANYGAPPPPPPPP 754 Score = 38.7 bits (86), Expect = 0.010 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP P PPPPPP Sbjct: 714 PPPPPPPPLPAFVAPPPPPPPP 735 Score = 38.3 bits (85), Expect = 0.013 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PPPPPP Sbjct: 713 PPPPPPPPPLPAFVAPPPPPPP 734 Score = 35.9 bits (79), Expect = 0.068 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P PPPPPP Sbjct: 715 PPPPPPPLPAFVAPPPPPPPPP 736 Score = 33.9 bits (74), Expect = 0.27 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP PP PP Sbjct: 731 PPPPPPPPPPMANYGAPPPPP 751 Score = 31.5 bits (68), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 713 PPPPPPPPPLPAFVAPPPPP 732 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP Sbjct: 730 PPPPPPPPPPPMANYGAPPPP 750 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 747 PPPPPPPPPGSGSAPPPPPP 766 Score = 29.9 bits (64), Expect = 4.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PP P PP PP Sbjct: 714 PPPPPPPPLPAFVAPPPPPPP 734 Score = 29.9 bits (64), Expect = 4.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP PP PP Sbjct: 732 PPPPPPPPPMANYGAPPPPPP 752 >BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p protein. Length = 1091 Score = 46.0 bits (104), Expect = 6e-05 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP P GG PPPPPP Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPP 560 Score = 44.8 bits (101), Expect = 1e-04 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P GGG PPPPPP Sbjct: 524 PPPPPPPMPGRAGGGPPPPPPP 545 Score = 41.5 bits (93), Expect = 0.001 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P GG PPPPPP Sbjct: 540 PPPPPPPMPGRAGGPPPPPPPP 561 Score = 40.7 bits (91), Expect = 0.002 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +3 Query: 381 PXPPPPXXGGGXPPPPPP 434 P PPPP GGG PPPPPP Sbjct: 512 PMPPPPPGGGGAPPPPPP 529 Score = 37.5 bits (83), Expect = 0.022 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 P PPPP GG PPPPPP Sbjct: 512 PMPPPPPGGGGAPPPPPPP 530 Score = 36.7 bits (81), Expect = 0.039 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PPP PPPP GG PPP P Sbjct: 554 PPPPPPPPGMGGPPPPPMP 572 Score = 36.3 bits (80), Expect = 0.051 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 PP PPPP GG PPPP P Sbjct: 554 PPPPPPPPGMGGPPPPPMP 572 Score = 35.5 bits (78), Expect = 0.089 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 8/29 (27%) Frame = +3 Query: 369 PPPPPX----PPPPXXG----GGXPPPPP 431 PPPPP PPPP G GG PPPPP Sbjct: 557 PPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PPP G G PPPPP Sbjct: 554 PPPPPPPP---GMGGPPPPP 570 Score = 30.7 bits (66), Expect = 2.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PP P PP PP Sbjct: 539 PPPPPPPPMPGRAGGPPPPPP 559 >AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p protein. Length = 1049 Score = 46.0 bits (104), Expect = 6e-05 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP G PPPPPP Sbjct: 494 PPPPPPPPPPLANYGAPPPPPP 515 Score = 41.9 bits (94), Expect = 0.001 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP G PPPPPP Sbjct: 495 PPPPPPPPPLANYGAPPPPPPP 516 Score = 41.9 bits (94), Expect = 0.001 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P P GGG PPPPPP Sbjct: 524 PPPPPPAPIEGGGGIPPPPPP 544 Score = 41.5 bits (93), Expect = 0.001 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PPPP G PPPPP Sbjct: 510 PPPPPPPPPGSGSAPPPPPP 529 Score = 41.5 bits (93), Expect = 0.001 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPPP G PPPPPP Sbjct: 510 PPPPPPPPPGSGSAPPPPPP 529 Score = 39.5 bits (88), Expect = 0.005 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 475 PPPPPPPPPLHAFVAPPPPPP 495 Score = 38.3 bits (85), Expect = 0.013 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PPPPPP Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPP 496 Score = 35.1 bits (77), Expect = 0.12 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP PPPPPP Sbjct: 476 PPPPPPPPLHAFVAPPPPPPPP 497 Score = 33.9 bits (74), Expect = 0.27 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP PP PP Sbjct: 494 PPPPPPPPPPLANYGAPPPPP 514 Score = 31.5 bits (68), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 475 PPPPPPPPPLHAFVAPPPPP 494 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP Sbjct: 493 PPPPPPPPPPPLANYGAPPPP 513 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 510 PPPPPPPPPGSGSAPPPPPP 529 Score = 29.5 bits (63), Expect = 5.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP PP PP Sbjct: 495 PPPPPPPPPLANYGAPPPPPP 515 Score = 29.1 bits (62), Expect = 7.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP PP PP Sbjct: 475 PPPPPPPPPLHAFVAPPPPPP 495 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 6/27 (22%) Frame = +2 Query: 320 PPPXPXPP------PPXXPXXXPPXPP 382 PPP P PP PP P PP PP Sbjct: 476 PPPPPPPPLHAFVAPPPPPPPPPPPPP 502 >AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB, isoform B protein. Length = 1091 Score = 46.0 bits (104), Expect = 6e-05 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP P GG PPPPPP Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPP 560 Score = 44.8 bits (101), Expect = 1e-04 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P GGG PPPPPP Sbjct: 524 PPPPPPPMPGRAGGGPPPPPPP 545 Score = 41.5 bits (93), Expect = 0.001 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P GG PPPPPP Sbjct: 540 PPPPPPPMPGRAGGPPPPPPPP 561 Score = 40.7 bits (91), Expect = 0.002 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +3 Query: 381 PXPPPPXXGGGXPPPPPP 434 P PPPP GGG PPPPPP Sbjct: 512 PMPPPPPGGGGAPPPPPP 529 Score = 37.5 bits (83), Expect = 0.022 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 P PPPP GG PPPPPP Sbjct: 512 PMPPPPPGGGGAPPPPPPP 530 Score = 36.7 bits (81), Expect = 0.039 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PPP PPPP GG PPP P Sbjct: 554 PPPPPPPPGMGGPPPPPMP 572 Score = 36.3 bits (80), Expect = 0.051 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 PP PPPP GG PPPP P Sbjct: 554 PPPPPPPPGMGGPPPPPMP 572 Score = 35.5 bits (78), Expect = 0.089 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 8/29 (27%) Frame = +3 Query: 369 PPPPPX----PPPPXXG----GGXPPPPP 431 PPPPP PPPP G GG PPPPP Sbjct: 557 PPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PPP G G PPPPP Sbjct: 554 PPPPPPPP---GMGGPPPPP 570 Score = 30.7 bits (66), Expect = 2.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PP P PP PP Sbjct: 539 PPPPPPPPMPGRAGGPPPPPP 559 >AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA, isoform A protein. Length = 1091 Score = 46.0 bits (104), Expect = 6e-05 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP P GG PPPPPP Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPP 560 Score = 44.8 bits (101), Expect = 1e-04 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P GGG PPPPPP Sbjct: 524 PPPPPPPMPGRAGGGPPPPPPP 545 Score = 41.5 bits (93), Expect = 0.001 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P GG PPPPPP Sbjct: 540 PPPPPPPMPGRAGGPPPPPPPP 561 Score = 40.7 bits (91), Expect = 0.002 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +3 Query: 381 PXPPPPXXGGGXPPPPPP 434 P PPPP GGG PPPPPP Sbjct: 512 PMPPPPPGGGGAPPPPPP 529 Score = 37.5 bits (83), Expect = 0.022 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 P PPPP GG PPPPPP Sbjct: 512 PMPPPPPGGGGAPPPPPPP 530 Score = 36.7 bits (81), Expect = 0.039 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PPP PPPP GG PPP P Sbjct: 554 PPPPPPPPGMGGPPPPPMP 572 Score = 36.3 bits (80), Expect = 0.051 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 PP PPPP GG PPPP P Sbjct: 554 PPPPPPPPGMGGPPPPPMP 572 Score = 35.5 bits (78), Expect = 0.089 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 8/29 (27%) Frame = +3 Query: 369 PPPPPX----PPPPXXG----GGXPPPPP 431 PPPPP PPPP G GG PPPPP Sbjct: 557 PPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PPP G G PPPPP Sbjct: 554 PPPPPPPP---GMGGPPPPP 570 Score = 30.7 bits (66), Expect = 2.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PP P PP PP Sbjct: 539 PPPPPPPPMPGRAGGPPPPPP 559 >AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA, isoform A protein. Length = 1059 Score = 46.0 bits (104), Expect = 6e-05 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP G PPPPPP Sbjct: 504 PPPPPPPPPPLANYGAPPPPPP 525 Score = 41.9 bits (94), Expect = 0.001 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP G PPPPPP Sbjct: 505 PPPPPPPPPLANYGAPPPPPPP 526 Score = 41.9 bits (94), Expect = 0.001 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P P GGG PPPPPP Sbjct: 534 PPPPPPAPIEGGGGIPPPPPP 554 Score = 41.5 bits (93), Expect = 0.001 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PPPP G PPPPP Sbjct: 520 PPPPPPPPPGSGSAPPPPPP 539 Score = 41.5 bits (93), Expect = 0.001 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPPP G PPPPPP Sbjct: 520 PPPPPPPPPGSGSAPPPPPP 539 Score = 39.5 bits (88), Expect = 0.005 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 485 PPPPPPPPPLHAFVAPPPPPP 505 Score = 38.3 bits (85), Expect = 0.013 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PPPPPP Sbjct: 485 PPPPPPPPPLHAFVAPPPPPPP 506 Score = 35.1 bits (77), Expect = 0.12 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP PPPPPP Sbjct: 486 PPPPPPPPLHAFVAPPPPPPPP 507 Score = 33.9 bits (74), Expect = 0.27 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP PP PP Sbjct: 504 PPPPPPPPPPLANYGAPPPPP 524 Score = 31.5 bits (68), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 485 PPPPPPPPPLHAFVAPPPPP 504 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP Sbjct: 503 PPPPPPPPPPPLANYGAPPPP 523 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 520 PPPPPPPPPGSGSAPPPPPP 539 Score = 29.5 bits (63), Expect = 5.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP PP PP Sbjct: 505 PPPPPPPPPLANYGAPPPPPP 525 Score = 29.1 bits (62), Expect = 7.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP PP PP Sbjct: 485 PPPPPPPPPLHAFVAPPPPPP 505 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 6/27 (22%) Frame = +2 Query: 320 PPPXPXPP------PPXXPXXXPPXPP 382 PPP P PP PP P PP PP Sbjct: 486 PPPPPPPPLHAFVAPPPPPPPPPPPPP 512 >AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB, isoform B protein. Length = 1049 Score = 46.0 bits (104), Expect = 6e-05 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP G PPPPPP Sbjct: 494 PPPPPPPPPPLANYGAPPPPPP 515 Score = 41.9 bits (94), Expect = 0.001 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP G PPPPPP Sbjct: 495 PPPPPPPPPLANYGAPPPPPPP 516 Score = 41.9 bits (94), Expect = 0.001 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P P GGG PPPPPP Sbjct: 524 PPPPPPAPIEGGGGIPPPPPP 544 Score = 41.5 bits (93), Expect = 0.001 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PPPP G PPPPP Sbjct: 510 PPPPPPPPPGSGSAPPPPPP 529 Score = 41.5 bits (93), Expect = 0.001 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPPP G PPPPPP Sbjct: 510 PPPPPPPPPGSGSAPPPPPP 529 Score = 39.5 bits (88), Expect = 0.005 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 475 PPPPPPPPPLHAFVAPPPPPP 495 Score = 38.3 bits (85), Expect = 0.013 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PPPPPP Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPP 496 Score = 35.1 bits (77), Expect = 0.12 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP PPPPPP Sbjct: 476 PPPPPPPPLHAFVAPPPPPPPP 497 Score = 33.9 bits (74), Expect = 0.27 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP PP PP Sbjct: 494 PPPPPPPPPPLANYGAPPPPP 514 Score = 31.5 bits (68), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 475 PPPPPPPPPLHAFVAPPPPP 494 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP Sbjct: 493 PPPPPPPPPPPLANYGAPPPP 513 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 510 PPPPPPPPPGSGSAPPPPPP 529 Score = 29.5 bits (63), Expect = 5.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP PP PP Sbjct: 495 PPPPPPPPPLANYGAPPPPPP 515 Score = 29.1 bits (62), Expect = 7.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP PP PP Sbjct: 475 PPPPPPPPPLHAFVAPPPPPP 495 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 6/27 (22%) Frame = +2 Query: 320 PPPXPXPP------PPXXPXXXPPXPP 382 PPP P PP PP P PP PP Sbjct: 476 PPPPPPPPLHAFVAPPPPPPPPPPPPP 502 >AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD, isoform D protein. Length = 1207 Score = 46.0 bits (104), Expect = 6e-05 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP G PPPPPP Sbjct: 652 PPPPPPPPPPLANYGAPPPPPP 673 Score = 41.9 bits (94), Expect = 0.001 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP G PPPPPP Sbjct: 653 PPPPPPPPPLANYGAPPPPPPP 674 Score = 41.9 bits (94), Expect = 0.001 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P P GGG PPPPPP Sbjct: 682 PPPPPPAPIEGGGGIPPPPPP 702 Score = 41.5 bits (93), Expect = 0.001 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PPPP G PPPPP Sbjct: 668 PPPPPPPPPGSGSAPPPPPP 687 Score = 41.5 bits (93), Expect = 0.001 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPPP G PPPPPP Sbjct: 668 PPPPPPPPPGSGSAPPPPPP 687 Score = 39.5 bits (88), Expect = 0.005 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 633 PPPPPPPPPLHAFVAPPPPPP 653 Score = 38.3 bits (85), Expect = 0.013 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PPPPPP Sbjct: 633 PPPPPPPPPLHAFVAPPPPPPP 654 Score = 35.1 bits (77), Expect = 0.12 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP PPPPPP Sbjct: 634 PPPPPPPPLHAFVAPPPPPPPP 655 Score = 33.9 bits (74), Expect = 0.27 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP PP PP Sbjct: 652 PPPPPPPPPPLANYGAPPPPP 672 Score = 31.5 bits (68), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 633 PPPPPPPPPLHAFVAPPPPP 652 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP Sbjct: 651 PPPPPPPPPPPLANYGAPPPP 671 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 668 PPPPPPPPPGSGSAPPPPPP 687 Score = 29.5 bits (63), Expect = 5.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP PP PP Sbjct: 653 PPPPPPPPPLANYGAPPPPPP 673 Score = 29.1 bits (62), Expect = 7.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP PP PP Sbjct: 633 PPPPPPPPPLHAFVAPPPPPP 653 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 6/27 (22%) Frame = +2 Query: 320 PPPXPXPP------PPXXPXXXPPXPP 382 PPP P PP PP P PP PP Sbjct: 634 PPPPPPPPLHAFVAPPPPPPPPPPPPP 660 >AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC, isoform C protein. Length = 1154 Score = 46.0 bits (104), Expect = 6e-05 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP G PPPPPP Sbjct: 599 PPPPPPPPPPLANYGAPPPPPP 620 Score = 41.9 bits (94), Expect = 0.001 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP G PPPPPP Sbjct: 600 PPPPPPPPPLANYGAPPPPPPP 621 Score = 41.9 bits (94), Expect = 0.001 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P P GGG PPPPPP Sbjct: 629 PPPPPPAPIEGGGGIPPPPPP 649 Score = 41.5 bits (93), Expect = 0.001 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PPPP G PPPPP Sbjct: 615 PPPPPPPPPGSGSAPPPPPP 634 Score = 41.5 bits (93), Expect = 0.001 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPPP G PPPPPP Sbjct: 615 PPPPPPPPPGSGSAPPPPPP 634 Score = 39.5 bits (88), Expect = 0.005 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 580 PPPPPPPPPLHAFVAPPPPPP 600 Score = 38.3 bits (85), Expect = 0.013 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PPPPPP Sbjct: 580 PPPPPPPPPLHAFVAPPPPPPP 601 Score = 35.1 bits (77), Expect = 0.12 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP PPPPPP Sbjct: 581 PPPPPPPPLHAFVAPPPPPPPP 602 Score = 33.9 bits (74), Expect = 0.27 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP PP PP Sbjct: 599 PPPPPPPPPPLANYGAPPPPP 619 Score = 31.5 bits (68), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 580 PPPPPPPPPLHAFVAPPPPP 599 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP Sbjct: 598 PPPPPPPPPPPLANYGAPPPP 618 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 615 PPPPPPPPPGSGSAPPPPPP 634 Score = 29.5 bits (63), Expect = 5.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP PP PP Sbjct: 600 PPPPPPPPPLANYGAPPPPPP 620 Score = 29.1 bits (62), Expect = 7.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP PP PP Sbjct: 580 PPPPPPPPPLHAFVAPPPPPP 600 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 6/27 (22%) Frame = +2 Query: 320 PPPXPXPP------PPXXPXXXPPXPP 382 PPP P PP PP P PP PP Sbjct: 581 PPPPPPPPLHAFVAPPPPPPPPPPPPP 607 >AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA protein. Length = 579 Score = 42.3 bits (95), Expect = 8e-04 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 466 PPPPPPPPPPPPPPTEPPPPPP 487 Score = 42.3 bits (95), Expect = 8e-04 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 467 PPPPPPPPPPPPPTEPPPPPPP 488 Score = 42.3 bits (95), Expect = 8e-04 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 468 PPPPPPPPPPPPTEPPPPPPPP 489 Score = 42.3 bits (95), Expect = 8e-04 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 469 PPPPPPPPPPPTEPPPPPPPPP 490 Score = 39.1 bits (87), Expect = 0.007 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPP Sbjct: 465 PPPPPPPPPPPPPPPTEPPPPP 486 Score = 37.9 bits (84), Expect = 0.017 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 463 PPPPPPPPPP-----PPPPPPP 479 Score = 37.5 bits (83), Expect = 0.022 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 466 PPPPPPPPPPPPPPTEPPPPP 486 Score = 37.5 bits (83), Expect = 0.022 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 467 PPPPPPPPPPPPPTEPPPPPP 487 Score = 37.5 bits (83), Expect = 0.022 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 470 PPPPPPPPPPTEPPPPPPPPP 490 Score = 35.9 bits (79), Expect = 0.068 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PPPP P Sbjct: 471 PPPPPPPPPTEPPPPPPPPPEP 492 Score = 34.3 bits (75), Expect = 0.21 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P P PP Sbjct: 463 PPPPPPPPPPPPPPPPPTEPP 483 Score = 34.3 bits (75), Expect = 0.21 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P P PP Sbjct: 465 PPPPPPPPPPPPPPPTEPPPP 485 Score = 34.3 bits (75), Expect = 0.21 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP PP PP Sbjct: 468 PPPPPPPPPPPPTEPPPPPPP 488 Score = 34.3 bits (75), Expect = 0.21 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP PP PP Sbjct: 469 PPPPPPPPPPPTEPPPPPPPP 489 >AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p protein. Length = 420 Score = 41.5 bits (93), Expect = 0.001 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P G G PPPPPP Sbjct: 209 PPPPPPRPQPTPGYGPPPPPPP 230 Score = 38.7 bits (86), Expect = 0.010 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P G PPPPPP Sbjct: 210 PPPPPRPQPTPGYGPPPPPPPP 231 Score = 35.9 bits (79), Expect = 0.068 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP P P G G P PPP Sbjct: 226 PPPPPPKPQPTPGYGPPTPPP 246 Score = 35.5 bits (78), Expect = 0.089 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP P G PP PP Sbjct: 224 PPPPPPPPKPQPTPGYGPPTPP 245 Score = 35.5 bits (78), Expect = 0.089 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P G PP PPP Sbjct: 225 PPPPPPPKPQPTPGYGPPTPPP 246 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P P P P PP PP Sbjct: 225 PPPPPPPKPQPTPGYGPPTPP 245 Score = 30.7 bits (66), Expect = 2.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P P P P PP PP Sbjct: 208 PPPPPPPRPQPTPGYGPPPPP 228 Score = 29.9 bits (64), Expect = 4.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP P PP P G P PP Sbjct: 80 PPPQPTPPAPRPSYGPPQTQPP 101 Score = 29.9 bits (64), Expect = 4.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP P P P G P P PP Sbjct: 154 PPPQPTPSAPAPSYGPPQPQPP 175 Score = 29.5 bits (63), Expect = 5.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P P PPPP G PPP P Sbjct: 109 PSAPAPPPPSYGPPQTPPPRP 129 Score = 29.5 bits (63), Expect = 5.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPP P P G PPP P Sbjct: 228 PPPPKPQPTPGYGPPTPPPGP 248 Score = 29.5 bits (63), Expect = 5.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP PP P P PP P Sbjct: 348 PPSPPAPPAPTYQPQPPAPPAP 369 Score = 29.1 bits (62), Expect = 7.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP P P PP Sbjct: 75 PPPPPPPPQPTPPAPRPSYGPP 96 Score = 29.1 bits (62), Expect = 7.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP P P P PPPPPP Sbjct: 193 PPDQPKPRPTPSRPQPPPPPPP 214 >AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA protein. Length = 420 Score = 41.5 bits (93), Expect = 0.001 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P G G PPPPPP Sbjct: 209 PPPPPPRPQPTPGYGPPPPPPP 230 Score = 38.7 bits (86), Expect = 0.010 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P G PPPPPP Sbjct: 210 PPPPPRPQPTPGYGPPPPPPPP 231 Score = 35.9 bits (79), Expect = 0.068 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP P P G G P PPP Sbjct: 226 PPPPPPKPQPTPGYGPPTPPP 246 Score = 35.5 bits (78), Expect = 0.089 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP P G PP PP Sbjct: 224 PPPPPPPPKPQPTPGYGPPTPP 245 Score = 35.5 bits (78), Expect = 0.089 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P G PP PPP Sbjct: 225 PPPPPPPKPQPTPGYGPPTPPP 246 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P P P P PP PP Sbjct: 225 PPPPPPPKPQPTPGYGPPTPP 245 Score = 30.7 bits (66), Expect = 2.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P P P P PP PP Sbjct: 208 PPPPPPPRPQPTPGYGPPPPP 228 Score = 29.9 bits (64), Expect = 4.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP P PP P G P PP Sbjct: 80 PPPQPTPPAPRPSYGPPQTQPP 101 Score = 29.9 bits (64), Expect = 4.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP P P P G P P PP Sbjct: 154 PPPQPTPSAPAPSYGPPQPQPP 175 Score = 29.5 bits (63), Expect = 5.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P P PPPP G PPP P Sbjct: 109 PSAPAPPPPSYGPPQTPPPRP 129 Score = 29.5 bits (63), Expect = 5.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPP P P G PPP P Sbjct: 228 PPPPKPQPTPGYGPPTPPPGP 248 Score = 29.5 bits (63), Expect = 5.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP PP P P PP P Sbjct: 348 PPSPPAPPAPTYQPQPPAPPAP 369 Score = 29.1 bits (62), Expect = 7.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP P P PP Sbjct: 75 PPPPPPPPQPTPPAPRPSYGPP 96 Score = 29.1 bits (62), Expect = 7.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP P P P PPPPPP Sbjct: 193 PPDQPKPRPTPSRPQPPPPPPP 214 >AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-PA protein. Length = 1644 Score = 40.7 bits (91), Expect = 0.002 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP G PPPPPP Sbjct: 280 PAAPPPPPPPINGAAPPPPPPP 301 Score = 40.3 bits (90), Expect = 0.003 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPP GG PPPPPP Sbjct: 295 PPPPPPPMINGGALPPPPPP 314 Score = 37.1 bits (82), Expect = 0.029 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 8/30 (26%) Frame = +3 Query: 369 PPPPPX--------PPPPXXGGGXPPPPPP 434 PPPPP PPPP G PPPPPP Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPP 300 Score = 36.7 bits (81), Expect = 0.039 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 7/29 (24%) Frame = +3 Query: 369 PPP-----PPXPPPPXXGGGX--PPPPPP 434 PPP PP PPPP GG PPPPPP Sbjct: 287 PPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 730 PPPPXPXXXXXXXXXXXXXXXAXAPXPPPPP 822 PPPP P AP PPPPP Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPP 301 Score = 29.5 bits (63), Expect = 5.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 332 PXPPPPXXPXXXPPXPP 382 P PPPP P PP PP Sbjct: 272 PPPPPPMAPAAPPPPPP 288 >AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. Length = 1644 Score = 40.7 bits (91), Expect = 0.002 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP G PPPPPP Sbjct: 280 PAAPPPPPPPINGAAPPPPPPP 301 Score = 40.3 bits (90), Expect = 0.003 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPP GG PPPPPP Sbjct: 295 PPPPPPPMINGGALPPPPPP 314 Score = 37.1 bits (82), Expect = 0.029 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 8/30 (26%) Frame = +3 Query: 369 PPPPPX--------PPPPXXGGGXPPPPPP 434 PPPPP PPPP G PPPPPP Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPP 300 Score = 36.7 bits (81), Expect = 0.039 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 7/29 (24%) Frame = +3 Query: 369 PPP-----PPXPPPPXXGGGX--PPPPPP 434 PPP PP PPPP GG PPPPPP Sbjct: 287 PPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 730 PPPPXPXXXXXXXXXXXXXXXAXAPXPPPPP 822 PPPP P AP PPPPP Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPP 301 Score = 29.5 bits (63), Expect = 5.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 332 PXPPPPXXPXXXPPXPP 382 P PPPP P PP PP Sbjct: 272 PPPPPPMAPAAPPPPPP 288 >AY089613-1|AAL90351.1| 798|Drosophila melanogaster RE28061p protein. Length = 798 Score = 39.5 bits (88), Expect = 0.005 Identities = 17/24 (70%), Positives = 17/24 (70%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGX--PPPXXGGGGXGGGGG 368 GGGGGG PPP GG G GGGGG Sbjct: 726 GGGGGGRSGPPPRSGGSGSGGGGG 749 >AE014297-778|AAF54262.1| 798|Drosophila melanogaster CG9748-PA protein. Length = 798 Score = 39.5 bits (88), Expect = 0.005 Identities = 17/24 (70%), Positives = 17/24 (70%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGX--PPPXXGGGGXGGGGG 368 GGGGGG PPP GG G GGGGG Sbjct: 726 GGGGGGRSGPPPRSGGSGSGGGGG 749 >AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p protein. Length = 417 Score = 39.1 bits (87), Expect = 0.007 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 393 PPPPCAPPPPALSLSQPPPPPP 414 Score = 30.3 bits (65), Expect = 3.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP PPPP PP PP Sbjct: 393 PPPPCAPPPPALSLSQPPPPP 413 Score = 29.9 bits (64), Expect = 4.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPP P PPPP Sbjct: 327 PPPMPPPLMPWMSAPQPPPP 346 Score = 29.1 bits (62), Expect = 7.8 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 11/33 (33%) Frame = +3 Query: 369 PPPP--PXPPPPXXGGGX---------PPPPPP 434 PPPP PP P GGG PPPPPP Sbjct: 364 PPPPGTSAPPMPPWGGGAYSGWGGGYAPPPPPP 396 >AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p protein. Length = 222 Score = 39.1 bits (87), Expect = 0.007 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 198 PPPPCAPPPPALSLSQPPPPPP 219 Score = 30.3 bits (65), Expect = 3.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP PPPP PP PP Sbjct: 198 PPPPCAPPPPALSLSQPPPPP 218 Score = 29.9 bits (64), Expect = 4.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPP P PPPP Sbjct: 132 PPPMPPPLMPWMSAPQPPPP 151 Score = 29.1 bits (62), Expect = 7.8 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 11/33 (33%) Frame = +3 Query: 369 PPPP--PXPPPPXXGGGX---------PPPPPP 434 PPPP PP P GGG PPPPPP Sbjct: 169 PPPPGTSAPPMPPWGGGAYSGWGGGYAPPPPPP 201 >AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-PA protein. Length = 290 Score = 39.1 bits (87), Expect = 0.007 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPP PP Sbjct: 73 PPPPPPPPPPPPPPPPPPPSPP 94 Score = 37.5 bits (83), Expect = 0.022 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 74 PPPPPPPPPPPPPPPPPPSPP 94 Score = 34.3 bits (75), Expect = 0.21 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP P Sbjct: 73 PPPPPPPPPPPPPPPPPPPSP 93 Score = 33.9 bits (74), Expect = 0.27 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP P Sbjct: 77 PPPPPPPPPPPPPPPSPPGVP 97 Score = 33.1 bits (72), Expect = 0.48 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPPPP PPPP G P P Sbjct: 81 PPPPPPPPPPPSPPGVPANP 100 Score = 31.5 bits (68), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PPPP P P P Sbjct: 81 PPPPPPPPPPPSPPGVPANP 100 >AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA protein. Length = 787 Score = 39.1 bits (87), Expect = 0.007 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 763 PPPPCAPPPPALSLSQPPPPPP 784 Score = 30.3 bits (65), Expect = 3.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP PPPP PP PP Sbjct: 763 PPPPCAPPPPALSLSQPPPPP 783 Score = 29.9 bits (64), Expect = 4.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPP P PPPP Sbjct: 697 PPPMPPPLMPWMSAPQPPPP 716 Score = 29.1 bits (62), Expect = 7.8 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 11/33 (33%) Frame = +3 Query: 369 PPPP--PXPPPPXXGGGX---------PPPPPP 434 PPPP PP P GGG PPPPPP Sbjct: 734 PPPPGTSAPPMPPWGGGAYSGWGGGYAPPPPPP 766 >BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p protein. Length = 592 Score = 38.3 bits (85), Expect = 0.013 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 152 PPPPPPPPPPP----PPPPPPP 169 Score = 36.3 bits (80), Expect = 0.051 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP PP PP Sbjct: 54 PPPPPPPPPPPQHCNCPPGPP 74 Score = 35.5 bits (78), Expect = 0.089 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PPP PPPP PPPPPP Sbjct: 150 PAPPPPPPPPPP---PPPPPPP 168 Score = 35.1 bits (77), Expect = 0.12 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP P PP P Sbjct: 55 PPPPPPPPPPQHCNCPPGPPGP 76 Score = 34.7 bits (76), Expect = 0.16 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PP P P Sbjct: 238 PPPPPPPPPPPPSYPYPPYPYP 259 Score = 33.9 bits (74), Expect = 0.27 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP PP PP Sbjct: 54 PPPPPPPPPPPQHCNCPPGPP 74 Score = 33.9 bits (74), Expect = 0.27 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP P PPP Sbjct: 240 PPPPPPPPPPSYPYPPYPYPPP 261 Score = 33.5 bits (73), Expect = 0.36 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 P PP PPPP PPPPP Sbjct: 150 PAPPPPPPPPPPPPPPPPPP 169 Score = 33.5 bits (73), Expect = 0.36 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP P P PP Sbjct: 239 PPPPPPPPPPPSYPYPPYPYPP 260 Score = 33.5 bits (73), Expect = 0.36 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P P PP Sbjct: 240 PPPPPPPPPPSYPYPPYPYPP 260 Score = 32.7 bits (71), Expect = 0.63 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 152 PPPPPPPPPPPPP---PPPPP 169 Score = 32.3 bits (70), Expect = 0.83 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PP PP Sbjct: 56 PPPPPPPPPQHCNCPPGPPGPP 77 Score = 32.3 bits (70), Expect = 0.83 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP P PP P Sbjct: 237 PPPPPPPPPPPPPSYPYPPYP 257 Score = 31.9 bits (69), Expect = 1.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 326 PXPXPPPPXXPXXXPPXPP 382 P P PPPP P PP PP Sbjct: 150 PAPPPPPPPPPPPPPPPPP 168 Score = 31.9 bits (69), Expect = 1.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP PP PPPPPP Sbjct: 223 PPGPPGPPGTTYPQPPPPPPPP 244 Score = 31.5 bits (68), Expect = 1.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PP PP Sbjct: 54 PPPPPPPPPPPQHCNCPPGPP 74 Score = 31.5 bits (68), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 P P P PPPP P PP P Sbjct: 150 PAPPPPPPPPPPPPPPPPPP 169 Score = 31.5 bits (68), Expect = 1.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP P PP Sbjct: 160 PPPPPPPPPPHSHPHSHHPHPP 181 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 P PPP PPPP PPPPP Sbjct: 235 PQPPPPPPPP------PPPPP 249 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP PPPPPP Sbjct: 235 PQPPPPPPP------PPPPPP 249 Score = 31.5 bits (68), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PPPP PP P Sbjct: 238 PPPPPPPPPPPPSYPYPPYP 257 Score = 30.3 bits (65), Expect = 3.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P P P Sbjct: 153 PPPPPPPPPPPPPPPPPHSHP 173 Score = 30.3 bits (65), Expect = 3.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP P P PP Sbjct: 161 PPPPPPPPPHSHPHSHHPHPP 181 Score = 30.3 bits (65), Expect = 3.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 P P P PPPP P P PP Sbjct: 235 PQPPPPPPPPPPPPPSYPYPP 255 >BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p protein. Length = 1273 Score = 38.3 bits (85), Expect = 0.013 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P PPPPPP Sbjct: 697 PPPPPMPASPTASSAAPPPPPP 718 Score = 33.1 bits (72), Expect = 0.48 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGG--GXPPPXXGGGGXGGGGG 368 GGG G G P GGGG GGGGG Sbjct: 61 GGGSGSRGLQDPGGGGGGGGGGGG 84 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P PP PPPPP Sbjct: 713 PPPPPPPAPPA------PPPPP 728 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGG GGGGG Sbjct: 60 GGGGSGSRGLQDPGGGGGGGGG 81 >AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p protein. Length = 993 Score = 38.3 bits (85), Expect = 0.013 Identities = 16/27 (59%), Positives = 16/27 (59%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPPPX-----PPPPXXGGGXPPPPPP 434 PPPPP PPPP G PPPPPP Sbjct: 436 PPPPPSGNYGPPPPPPSGNYGPPPPPP 462 Score = 36.7 bits (81), Expect = 0.039 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPX----PPPPXXGGGXPPPPPP 434 PPPPP PPPP G PPPPP Sbjct: 447 PPPPPSGNYGPPPPPPSGNYGPPPPP 472 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPXP---PPPXXGGGXPPPPPP 434 PPPPP PPP G PPPPP Sbjct: 458 PPPPPSGNYGPPPPPSGNYGPPPPP 482 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPXP---PPPXXGGGXPPPPPP 434 PPPPP PPP G PPPPP Sbjct: 468 PPPPPSGNYGPPPPPSGNYGPPPPP 492 Score = 31.9 bits (69), Expect = 1.1 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 381 PXPPPPXXGGGXPPPPP 431 P PPPP G PPPPP Sbjct: 435 PPPPPPSGNYGPPPPPP 451 Score = 31.5 bits (68), Expect = 1.5 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPX----PPPPXXGGGXP--PPPPP 434 PPPPP PPPP P PPPPP Sbjct: 645 PPPPPEPQYLPPPPPLANVRPLGPPPPP 672 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +3 Query: 369 PPPPPXP---PPPXXGGGXPPPPP 431 PPPPP PPP G PPPP Sbjct: 478 PPPPPSGNYGPPPPPSGNYGPPPP 501 Score = 30.7 bits (66), Expect = 2.5 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPP 431 PP PPPP PPPPP Sbjct: 642 PPGPPPPPEPQYLPPPPP 659 Score = 29.9 bits (64), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 387 PPPPXXGGGXPPPPPP 434 PPPP G PPPPP Sbjct: 435 PPPPPPSGNYGPPPPP 450 Score = 29.5 bits (63), Expect = 5.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 332 PXPPPPXXPXXXPPXPP 382 P PPPP P PP PP Sbjct: 643 PGPPPPPEPQYLPPPPP 659 >AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA protein. Length = 993 Score = 38.3 bits (85), Expect = 0.013 Identities = 16/27 (59%), Positives = 16/27 (59%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPPPX-----PPPPXXGGGXPPPPPP 434 PPPPP PPPP G PPPPPP Sbjct: 436 PPPPPSGNYGPPPPPPSGNYGPPPPPP 462 Score = 36.7 bits (81), Expect = 0.039 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPX----PPPPXXGGGXPPPPPP 434 PPPPP PPPP G PPPPP Sbjct: 447 PPPPPSGNYGPPPPPPSGNYGPPPPP 472 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPXP---PPPXXGGGXPPPPPP 434 PPPPP PPP G PPPPP Sbjct: 458 PPPPPSGNYGPPPPPSGNYGPPPPP 482 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPXP---PPPXXGGGXPPPPPP 434 PPPPP PPP G PPPPP Sbjct: 468 PPPPPSGNYGPPPPPSGNYGPPPPP 492 Score = 31.9 bits (69), Expect = 1.1 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 381 PXPPPPXXGGGXPPPPP 431 P PPPP G PPPPP Sbjct: 435 PPPPPPSGNYGPPPPPP 451 Score = 31.5 bits (68), Expect = 1.5 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPX----PPPPXXGGGXP--PPPPP 434 PPPPP PPPP P PPPPP Sbjct: 645 PPPPPEPQYLPPPPPLANVRPLGPPPPP 672 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +3 Query: 369 PPPPPXP---PPPXXGGGXPPPPP 431 PPPPP PPP G PPPP Sbjct: 478 PPPPPSGNYGPPPPPSGNYGPPPP 501 Score = 30.7 bits (66), Expect = 2.5 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPP 431 PP PPPP PPPPP Sbjct: 642 PPGPPPPPEPQYLPPPPP 659 Score = 29.9 bits (64), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 387 PPPPXXGGGXPPPPPP 434 PPPP G PPPPP Sbjct: 435 PPPPPPSGNYGPPPPP 450 Score = 29.5 bits (63), Expect = 5.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 332 PXPPPPXXPXXXPPXPP 382 P PPPP P PP PP Sbjct: 643 PGPPPPPEPQYLPPPPP 659 >AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA protein. Length = 594 Score = 38.3 bits (85), Expect = 0.013 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 154 PPPPPPPPPPP----PPPPPPP 171 Score = 36.3 bits (80), Expect = 0.051 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP PP PP Sbjct: 56 PPPPPPPPPPPQHCNCPPGPP 76 Score = 35.5 bits (78), Expect = 0.089 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PPP PPPP PPPPPP Sbjct: 152 PAPPPPPPPPPP---PPPPPPP 170 Score = 35.1 bits (77), Expect = 0.12 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP P PP P Sbjct: 57 PPPPPPPPPPQHCNCPPGPPGP 78 Score = 34.7 bits (76), Expect = 0.16 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PP P P Sbjct: 240 PPPPPPPPPPPPSYPYPPYPYP 261 Score = 33.9 bits (74), Expect = 0.27 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP PP PP Sbjct: 56 PPPPPPPPPPPQHCNCPPGPP 76 Score = 33.9 bits (74), Expect = 0.27 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP P PPP Sbjct: 242 PPPPPPPPPPSYPYPPYPYPPP 263 Score = 33.5 bits (73), Expect = 0.36 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 P PP PPPP PPPPP Sbjct: 152 PAPPPPPPPPPPPPPPPPPP 171 Score = 33.5 bits (73), Expect = 0.36 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP P P PP Sbjct: 241 PPPPPPPPPPPSYPYPPYPYPP 262 Score = 33.5 bits (73), Expect = 0.36 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P P PP Sbjct: 242 PPPPPPPPPPSYPYPPYPYPP 262 Score = 32.7 bits (71), Expect = 0.63 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 154 PPPPPPPPPPPPP---PPPPP 171 Score = 32.3 bits (70), Expect = 0.83 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PP PP Sbjct: 58 PPPPPPPPPQHCNCPPGPPGPP 79 Score = 32.3 bits (70), Expect = 0.83 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP P PP P Sbjct: 239 PPPPPPPPPPPPPSYPYPPYP 259 Score = 31.9 bits (69), Expect = 1.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 326 PXPXPPPPXXPXXXPPXPP 382 P P PPPP P PP PP Sbjct: 152 PAPPPPPPPPPPPPPPPPP 170 Score = 31.9 bits (69), Expect = 1.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP PP PPPPPP Sbjct: 225 PPGPPGPPGTTYPQPPPPPPPP 246 Score = 31.5 bits (68), Expect = 1.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PP PP Sbjct: 56 PPPPPPPPPPPQHCNCPPGPP 76 Score = 31.5 bits (68), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 P P P PPPP P PP P Sbjct: 152 PAPPPPPPPPPPPPPPPPPP 171 Score = 31.5 bits (68), Expect = 1.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP P PP Sbjct: 162 PPPPPPPPPPHSHPHSHHPHPP 183 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 P PPP PPPP PPPPP Sbjct: 237 PQPPPPPPPP------PPPPP 251 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP PPPPPP Sbjct: 237 PQPPPPPPP------PPPPPP 251 Score = 31.5 bits (68), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PPPP PP P Sbjct: 240 PPPPPPPPPPPPSYPYPPYP 259 Score = 30.3 bits (65), Expect = 3.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P P P Sbjct: 155 PPPPPPPPPPPPPPPPPHSHP 175 Score = 30.3 bits (65), Expect = 3.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP P P PP Sbjct: 163 PPPPPPPPPHSHPHSHHPHPP 183 Score = 30.3 bits (65), Expect = 3.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 P P P PPPP P P PP Sbjct: 237 PQPPPPPPPPPPPPPSYPYPP 257 >M19692-1|AAA28934.1| 1520|Drosophila melanogaster protein ( D.melanogaster tyrosinekinase gene, exons 3 to 10 (with a region homologous tothe Abelson oncogene). ). Length = 1520 Score = 37.9 bits (84), Expect = 0.017 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP PPPP G PPPPPP Sbjct: 1074 PPPLDLPPPPEEFEGGPPPPPP 1095 Score = 29.9 bits (64), Expect = 4.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP PPPP PP PP Sbjct: 1074 PPPLDLPPPPEEFEGGPPPPP 1094 >AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p protein. Length = 499 Score = 37.9 bits (84), Expect = 0.017 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP P PPP Sbjct: 341 PPPPPPPPPPAQTSAIPSPPP 361 Score = 37.5 bits (83), Expect = 0.022 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 335 PPPPPPPPPP------PPPPPP 350 Score = 35.9 bits (79), Expect = 0.068 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP P PPP Sbjct: 340 PPPPPPPPPPPAQTSAIPSPPP 361 Score = 32.3 bits (70), Expect = 0.83 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PPP P Sbjct: 342 PPPPPPPPPAQTSAIPSPPPFP 363 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP Sbjct: 341 PPPPPPPPPPAQTSAIPSPPP 361 Score = 30.3 bits (65), Expect = 3.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP Sbjct: 340 PPPPPPPPPPPAQTSAIPSPP 360 >AY058497-1|AAL13726.1| 1249|Drosophila melanogaster LD03455p protein. Length = 1249 Score = 37.9 bits (84), Expect = 0.017 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP PPPP G PPPPPP Sbjct: 686 PPPLDLPPPPEEFEGGPPPPPP 707 Score = 29.9 bits (64), Expect = 4.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP PPPP PP PP Sbjct: 686 PPPLDLPPPPEEFEGGPPPPP 706 >AE014296-2776|AAF49431.2| 1620|Drosophila melanogaster CG4032-PA protein. Length = 1620 Score = 37.9 bits (84), Expect = 0.017 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP PPPP G PPPPPP Sbjct: 1057 PPPLDLPPPPEEFEGGPPPPPP 1078 Score = 29.9 bits (64), Expect = 4.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP PPPP PP PP Sbjct: 1057 PPPLDLPPPPEEFEGGPPPPP 1077 >AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-PA protein. Length = 499 Score = 37.9 bits (84), Expect = 0.017 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP P PPP Sbjct: 341 PPPPPPPPPPAQTSAIPSPPP 361 Score = 37.5 bits (83), Expect = 0.022 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 335 PPPPPPPPPP------PPPPPP 350 Score = 35.9 bits (79), Expect = 0.068 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP P PPP Sbjct: 340 PPPPPPPPPPPAQTSAIPSPPP 361 Score = 32.3 bits (70), Expect = 0.83 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PPP P Sbjct: 342 PPPPPPPPPAQTSAIPSPPPFP 363 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP Sbjct: 341 PPPPPPPPPPAQTSAIPSPPP 361 Score = 30.3 bits (65), Expect = 3.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP Sbjct: 340 PPPPPPPPPPPAQTSAIPSPP 360 >BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p protein. Length = 212 Score = 37.5 bits (83), Expect = 0.022 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP G PPPP P Sbjct: 96 PPPPPGPPPP----GPPPPPGP 113 Score = 35.1 bits (77), Expect = 0.12 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP G PPPP P Sbjct: 81 PGPPAYPPPPQRPWGPPPPPGP 102 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPP--PXPPPPXXGGGXPPPPPP 434 PPPP P PPP G P PPPP Sbjct: 87 PPPPQRPWGPPPPPGPPPPGPPPP 110 Score = 30.3 bits (65), Expect = 3.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PPPP P PP P Sbjct: 96 PPPPPGPPPPGPP--PPPGP 113 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 2/23 (8%) Frame = +2 Query: 320 PPPXPX--PPPPXXPXXXPPXPP 382 PP P PPPP P PP PP Sbjct: 89 PPQRPWGPPPPPGPPPPGPPPPP 111 >BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p protein. Length = 468 Score = 37.5 bits (83), Expect = 0.022 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 P P PPPP G PPPPPP Sbjct: 180 PKPAPPPPAAGAPKPPPPPP 199 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPP------PXPPPPXXGGGXPPPPPP 434 PPPP P PPPP PPPP P Sbjct: 184 PPPPAAGAPKPPPPPPPKAAPRPPPPAP 211 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P P P PP G P PPPP Sbjct: 176 PAAAPKPAPPPPAAGAPKPPPP 197 >AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p protein. Length = 242 Score = 37.5 bits (83), Expect = 0.022 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP G PPPP P Sbjct: 126 PPPPPGPPPP----GPPPPPGP 143 Score = 35.1 bits (77), Expect = 0.12 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP G PPPP P Sbjct: 111 PGPPAYPPPPQRPWGPPPPPGP 132 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPP--PXPPPPXXGGGXPPPPPP 434 PPPP P PPP G P PPPP Sbjct: 117 PPPPQRPWGPPPPPGPPPPGPPPP 140 Score = 30.3 bits (65), Expect = 3.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PPPP P PP P Sbjct: 126 PPPPPGPPPPGPP--PPPGP 143 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 2/23 (8%) Frame = +2 Query: 320 PPPXPX--PPPPXXPXXXPPXPP 382 PP P PPPP P PP PP Sbjct: 119 PPQRPWGPPPPPGPPPPGPPPPP 141 >AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p protein. Length = 468 Score = 37.5 bits (83), Expect = 0.022 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 P P PPPP G PPPPPP Sbjct: 180 PKPAPPPPAAGAPKPPPPPP 199 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPP------PXPPPPXXGGGXPPPPPP 434 PPPP P PPPP PPPP P Sbjct: 184 PPPPAAGAPKPPPPPPPKAAPRPPPPAP 211 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P P P PP G P PPPP Sbjct: 176 PAAAPKPAPPPPAAGAPKPPPP 197 >AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA protein. Length = 468 Score = 37.5 bits (83), Expect = 0.022 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 P P PPPP G PPPPPP Sbjct: 180 PKPAPPPPAAGAPKPPPPPP 199 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPP------PXPPPPXXGGGXPPPPPP 434 PPPP P PPPP PPPP P Sbjct: 184 PPPPAAGAPKPPPPPPPKAAPRPPPPAP 211 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P P P PP G P PPPP Sbjct: 176 PAAAPKPAPPPPAAGAPKPPPP 197 >AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA, isoform A protein. Length = 242 Score = 37.5 bits (83), Expect = 0.022 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP G PPPP P Sbjct: 126 PPPPPGPPPP----GPPPPPGP 143 Score = 35.1 bits (77), Expect = 0.12 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP G PPPP P Sbjct: 111 PGPPAYPPPPQRPWGPPPPPGP 132 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPP--PXPPPPXXGGGXPPPPPP 434 PPPP P PPP G P PPPP Sbjct: 117 PPPPQRPWGPPPPPGPPPPGPPPP 140 Score = 30.3 bits (65), Expect = 3.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PPPP P PP P Sbjct: 126 PPPPPGPPPPGPP--PPPGP 143 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 2/23 (8%) Frame = +2 Query: 320 PPPXPX--PPPPXXPXXXPPXPP 382 PP P PPPP P PP PP Sbjct: 119 PPQRPWGPPPPPGPPPPGPPPPP 141 >AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB, isoform B protein. Length = 212 Score = 37.5 bits (83), Expect = 0.022 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP G PPPP P Sbjct: 96 PPPPPGPPPP----GPPPPPGP 113 Score = 35.1 bits (77), Expect = 0.12 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP G PPPP P Sbjct: 81 PGPPAYPPPPQRPWGPPPPPGP 102 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPP--PXPPPPXXGGGXPPPPPP 434 PPPP P PPP G P PPPP Sbjct: 87 PPPPQRPWGPPPPPGPPPPGPPPP 110 Score = 30.3 bits (65), Expect = 3.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PPPP P PP P Sbjct: 96 PPPPPGPPPPGPP--PPPGP 113 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 2/23 (8%) Frame = +2 Query: 320 PPPXPX--PPPPXXPXXXPPXPP 382 PP P PPPP P PP PP Sbjct: 89 PPQRPWGPPPPPGPPPPGPPPPP 111 >J03177-1|AAA28535.1| 510|Drosophila melanogaster protein ( D.melanogaster forkhead protein (fkh) gene, complete cds. ). Length = 510 Score = 36.7 bits (81), Expect = 0.039 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -3 Query: 424 GGGXPPPXXGGGGXGGGGG 368 GGG PP GGGG GGGGG Sbjct: 21 GGGGPPSGGGGGGGGGGGG 39 Score = 35.5 bits (78), Expect = 0.089 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGGG 368 GGGG P GGGG GGGGG Sbjct: 21 GGGGPPSGGGGGGGGGGGGG 40 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 21 GGGGPPSGGGGGGGGGGGGG 40 >DQ017435-1|AAY82217.1| 53|Drosophila melanogaster CG10002 protein. Length = 53 Score = 36.7 bits (81), Expect = 0.039 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -3 Query: 424 GGGXPPPXXGGGGXGGGGG 368 GGG PP GGGG GGGGG Sbjct: 21 GGGGPPSGGGGGGGGGGGG 39 Score = 35.5 bits (78), Expect = 0.089 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGGG 368 GGGG P GGGG GGGGG Sbjct: 21 GGGGPPSGGGGGGGGGGGGG 40 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 21 GGGGPPSGGGGGGGGGGGGG 40 >DQ017434-1|AAY82216.1| 53|Drosophila melanogaster CG10002 protein. Length = 53 Score = 36.7 bits (81), Expect = 0.039 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -3 Query: 424 GGGXPPPXXGGGGXGGGGG 368 GGG PP GGGG GGGGG Sbjct: 21 GGGGPPSGGGGGGGGGGGG 39 Score = 35.5 bits (78), Expect = 0.089 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGGG 368 GGGG P GGGG GGGGG Sbjct: 21 GGGGPPSGGGGGGGGGGGGG 40 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 21 GGGGPPSGGGGGGGGGGGGG 40 >BT023936-1|ABB36440.1| 510|Drosophila melanogaster RE06859p protein. Length = 510 Score = 36.7 bits (81), Expect = 0.039 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -3 Query: 424 GGGXPPPXXGGGGXGGGGG 368 GGG PP GGGG GGGGG Sbjct: 21 GGGGPPSGGGGGGGGGGGG 39 Score = 35.5 bits (78), Expect = 0.089 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGGG 368 GGGG P GGGG GGGGG Sbjct: 21 GGGGPPSGGGGGGGGGGGGG 40 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 21 GGGGPPSGGGGGGGGGGGGG 40 >BT010029-1|AAQ22498.1| 426|Drosophila melanogaster RE03865p protein. Length = 426 Score = 36.7 bits (81), Expect = 0.039 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -3 Query: 424 GGGXPPPXXGGGGXGGGGG 368 GGG PP GGGG GGGGG Sbjct: 21 GGGGPPSGGGGGGGGGGGG 39 Score = 35.5 bits (78), Expect = 0.089 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGGG 368 GGGG P GGGG GGGGG Sbjct: 21 GGGGPPSGGGGGGGGGGGGG 40 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 21 GGGGPPSGGGGGGGGGGGGG 40 >AY121649-1|AAM51976.1| 950|Drosophila melanogaster LD23647p protein. Length = 950 Score = 36.7 bits (81), Expect = 0.039 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 418 GGGGGGGRSGGGGGGGAGGGGG 439 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGG Sbjct: 417 GGGGGGGGRSGGGGGGGAGGGG 438 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 419 GGGGGGRSGGGGGGGAGGGGG 439 Score = 30.7 bits (66), Expect = 2.5 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXG---GGGG 368 GGGGGG GGGG G GGGG Sbjct: 30 GGGGGGMYSSNYGGGGSGANFGGGG 54 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 417 GGGGGGGGRSGGGGGGGAGGG 437 >AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p protein. Length = 527 Score = 36.7 bits (81), Expect = 0.039 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 382 PPPPPPPPP---AAVPPPPPP 399 Score = 35.1 bits (77), Expect = 0.12 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 PP PPPP PPPPPP Sbjct: 382 PPPPPPPPPAAVPPPPPPP 400 Score = 34.3 bits (75), Expect = 0.21 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PPP PPPP PPPPP Sbjct: 382 PPPPPPPPPAAVPPPPPPP 400 Score = 31.9 bits (69), Expect = 1.1 Identities = 18/63 (28%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +2 Query: 200 KXPNPVNPXL--GXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPPPXPXPPPPXXPXXXPP 373 + P P P G PPP PPP P PPP P PP Sbjct: 340 RQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPP 399 Query: 374 XPP 382 P Sbjct: 400 PMP 402 Score = 30.3 bits (65), Expect = 3.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P PPPPPP Sbjct: 370 PPPPPVSAPVVAPPPPPPPPP 390 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PPP PPPPP Sbjct: 357 PPPPNRPPPI--STAPPPPP 374 >AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC, isoform C protein. Length = 494 Score = 36.7 bits (81), Expect = 0.039 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 349 PPPPPPPPP---AAVPPPPPP 366 Score = 35.1 bits (77), Expect = 0.12 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 PP PPPP PPPPPP Sbjct: 349 PPPPPPPPPAAVPPPPPPP 367 Score = 34.3 bits (75), Expect = 0.21 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PPP PPPP PPPPP Sbjct: 349 PPPPPPPPPAAVPPPPPPP 367 Score = 31.9 bits (69), Expect = 1.1 Identities = 18/63 (28%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +2 Query: 200 KXPNPVNPXL--GXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPPPXPXPPPPXXPXXXPP 373 + P P P G PPP PPP P PPP P PP Sbjct: 307 RQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPP 366 Query: 374 XPP 382 P Sbjct: 367 PMP 369 Score = 30.3 bits (65), Expect = 3.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P PPPPPP Sbjct: 337 PPPPPVSAPVVAPPPPPPPPP 357 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PPP PPPPP Sbjct: 324 PPPPNRPPPI--STAPPPPP 341 >AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB, isoform B protein. Length = 527 Score = 36.7 bits (81), Expect = 0.039 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 382 PPPPPPPPP---AAVPPPPPP 399 Score = 35.1 bits (77), Expect = 0.12 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 PP PPPP PPPPPP Sbjct: 382 PPPPPPPPPAAVPPPPPPP 400 Score = 34.3 bits (75), Expect = 0.21 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PPP PPPP PPPPP Sbjct: 382 PPPPPPPPPAAVPPPPPPP 400 Score = 31.9 bits (69), Expect = 1.1 Identities = 18/63 (28%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +2 Query: 200 KXPNPVNPXL--GXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPPPXPXPPPPXXPXXXPP 373 + P P P G PPP PPP P PPP P PP Sbjct: 340 RQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPP 399 Query: 374 XPP 382 P Sbjct: 400 PMP 402 Score = 30.3 bits (65), Expect = 3.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P PPPPPP Sbjct: 370 PPPPPVSAPVVAPPPPPPPPP 390 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PPP PPPPP Sbjct: 357 PPPPNRPPPI--STAPPPPP 374 >AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA, isoform A protein. Length = 527 Score = 36.7 bits (81), Expect = 0.039 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 382 PPPPPPPPP---AAVPPPPPP 399 Score = 35.1 bits (77), Expect = 0.12 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 PP PPPP PPPPPP Sbjct: 382 PPPPPPPPPAAVPPPPPPP 400 Score = 34.3 bits (75), Expect = 0.21 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PPP PPPP PPPPP Sbjct: 382 PPPPPPPPPAAVPPPPPPP 400 Score = 31.9 bits (69), Expect = 1.1 Identities = 18/63 (28%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +2 Query: 200 KXPNPVNPXL--GXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPPPXPXPPPPXXPXXXPP 373 + P P P G PPP PPP P PPP P PP Sbjct: 340 RQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPP 399 Query: 374 XPP 382 P Sbjct: 400 PMP 402 Score = 30.3 bits (65), Expect = 3.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P PPPPPP Sbjct: 370 PPPPPVSAPVVAPPPPPPPPP 390 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PPP PPPPP Sbjct: 357 PPPPNRPPPI--STAPPPPP 374 >AE014297-4241|AAF56798.1| 510|Drosophila melanogaster CG10002-PA protein. Length = 510 Score = 36.7 bits (81), Expect = 0.039 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -3 Query: 424 GGGXPPPXXGGGGXGGGGG 368 GGG PP GGGG GGGGG Sbjct: 21 GGGGPPSGGGGGGGGGGGG 39 Score = 35.5 bits (78), Expect = 0.089 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGGG 368 GGGG P GGGG GGGGG Sbjct: 21 GGGGPPSGGGGGGGGGGGGG 40 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 21 GGGGPPSGGGGGGGGGGGGG 40 >AE014134-2238|AAF53220.2| 950|Drosophila melanogaster CG5787-PA protein. Length = 950 Score = 36.7 bits (81), Expect = 0.039 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 418 GGGGGGGRSGGGGGGGAGGGGG 439 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGG Sbjct: 417 GGGGGGGGRSGGGGGGGAGGGG 438 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 419 GGGGGGRSGGGGGGGAGGGGG 439 Score = 30.7 bits (66), Expect = 2.5 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXG---GGGG 368 GGGGGG GGGG G GGGG Sbjct: 30 GGGGGGMYSSNYGGGGSGANFGGGG 54 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 417 GGGGGGGGRSGGGGGGGAGGG 437 >BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p protein. Length = 399 Score = 36.3 bits (80), Expect = 0.051 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 249 GGGGGGGRYDRGGGGGGGGGGG 270 Score = 33.9 bits (74), Expect = 0.27 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXFXFXPKXG 220 GG GG G GGGG G GGG GGG P+ G Sbjct: 224 GGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNVQPRDG 277 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGGG Sbjct: 220 GGGRGGFGGRRGGGGGGGGGGG 241 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGGG Sbjct: 219 GGGGRGGFGGRRGGGGGGGGGG 240 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGG--GGXGGGGG 368 GGGGGG GG GG GGGGG Sbjct: 215 GGGGGGGGRGGFGGRRGGGGGGGG 238 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXG--GGGXGGGGG 368 GGGGGG G GGG GGGGG Sbjct: 216 GGGGGGGRGGFGGRRGGGGGGGGG 239 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 224 GGFGGRRGGGGGGGGGGGGGG 244 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGG Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGG 234 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG GGGGG Sbjct: 214 GGGGGGGGGRGGFGGRRGGGGG 235 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 221 GGRGGFGGRRGGGGGGGGGGGG 242 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GG G GGGG GGGGG Sbjct: 222 GRGGFGGRRGGGGGGGGGGGGG 243 Score = 29.1 bits (62), Expect = 7.8 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GG GG Sbjct: 97 GGGGGG------GGGGGGGSGG 112 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 220 GGGRGGFGGRRGGGGGGGGGG 240 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 221 GGRGGFGGRRGGGGGGGGGGG 241 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GG GGGGG Sbjct: 333 GSGGGGYHNRDRGGNSQGGGGG 354 >AY094783-1|AAM11136.1| 118|Drosophila melanogaster LD12750p protein. Length = 118 Score = 36.3 bits (80), Expect = 0.051 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 65 GGGGGGGGGGGGGGGGGGGGGG 86 Score = 36.3 bits (80), Expect = 0.051 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 66 GGGGGGGGGGGGGGGGGGGGGG 87 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 68 GGGGGGGGGGGGGGGGGGGGSG 89 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 65 GGGGGGGGGGGGGGGGGGGGG 85 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 66 GGGGGGGGGGGGGGGGGGGGG 86 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 67 GGGGGGGGGGGGGGGGGGGGG 87 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 69 GGGGGGGGGGGGGGGGGGGSG 89 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GG Sbjct: 72 GGGGGGGGGGGGGGGGSGYRGG 93 >AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p protein. Length = 514 Score = 36.3 bits (80), Expect = 0.051 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PP P P P GG PPPPPP Sbjct: 394 PPAPPPMPVFGAGGAPPPPPP 414 Score = 34.7 bits (76), Expect = 0.16 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP P GG PPPPPP Sbjct: 394 PPAPPPMPVFGAGGAPPPPPPP 415 Score = 34.3 bits (75), Expect = 0.21 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PPP PPP G PPPPP Sbjct: 409 PPPPPPPSSGMAGVPPPPP 427 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPX------PPPPXXGGGXPPPPPP 434 PPPP PPPP G PP PPP Sbjct: 372 PPPPTAASVGVPPPPPAPPAGVPPAPPP 399 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPP 428 PPPP PP G PPPP Sbjct: 409 PPPPPPPSSGMAGVPPPPP 427 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +3 Query: 372 PPPPXPPPPXXGG-GXPPPPP 431 P P PPPP G PPPPP Sbjct: 367 PVPVSPPPPTAASVGVPPPPP 387 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 730 PPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 PPPP P A PPPPPP Sbjct: 384 PPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPP 415 >AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB, isoform B protein. Length = 399 Score = 36.3 bits (80), Expect = 0.051 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 249 GGGGGGGRYDRGGGGGGGGGGG 270 Score = 33.9 bits (74), Expect = 0.27 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXFXFXPKXG 220 GG GG G GGGG G GGG GGG P+ G Sbjct: 224 GGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNVQPRDG 277 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGGG Sbjct: 220 GGGRGGFGGRRGGGGGGGGGGG 241 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGGG Sbjct: 219 GGGGRGGFGGRRGGGGGGGGGG 240 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGG--GGXGGGGG 368 GGGGGG GG GG GGGGG Sbjct: 215 GGGGGGGGRGGFGGRRGGGGGGGG 238 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXG--GGGXGGGGG 368 GGGGGG G GGG GGGGG Sbjct: 216 GGGGGGGRGGFGGRRGGGGGGGGG 239 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 224 GGFGGRRGGGGGGGGGGGGGG 244 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGG Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGG 234 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG GGGGG Sbjct: 214 GGGGGGGGGRGGFGGRRGGGGG 235 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 221 GGRGGFGGRRGGGGGGGGGGGG 242 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GG G GGGG GGGGG Sbjct: 222 GRGGFGGRRGGGGGGGGGGGGG 243 Score = 29.1 bits (62), Expect = 7.8 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GG GG Sbjct: 97 GGGGGG------GGGGGGGSGG 112 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 220 GGGRGGFGGRRGGGGGGGGGG 240 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 221 GGRGGFGGRRGGGGGGGGGGG 241 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GG GGGGG Sbjct: 333 GSGGGGYHNRDRGGNSQGGGGG 354 >AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA, isoform A protein. Length = 399 Score = 36.3 bits (80), Expect = 0.051 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 249 GGGGGGGRYDRGGGGGGGGGGG 270 Score = 33.9 bits (74), Expect = 0.27 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXFXFXPKXG 220 GG GG G GGGG G GGG GGG P+ G Sbjct: 224 GGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNVQPRDG 277 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGGG Sbjct: 220 GGGRGGFGGRRGGGGGGGGGGG 241 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGGG Sbjct: 219 GGGGRGGFGGRRGGGGGGGGGG 240 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGG--GGXGGGGG 368 GGGGGG GG GG GGGGG Sbjct: 215 GGGGGGGGRGGFGGRRGGGGGGGG 238 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXG--GGGXGGGGG 368 GGGGGG G GGG GGGGG Sbjct: 216 GGGGGGGRGGFGGRRGGGGGGGGG 239 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 224 GGFGGRRGGGGGGGGGGGGGG 244 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGG Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGG 234 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG GGGGG Sbjct: 214 GGGGGGGGGRGGFGGRRGGGGG 235 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 221 GGRGGFGGRRGGGGGGGGGGGG 242 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GG G GGGG GGGGG Sbjct: 222 GRGGFGGRRGGGGGGGGGGGGG 243 Score = 29.1 bits (62), Expect = 7.8 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GG GG Sbjct: 97 GGGGGG------GGGGGGGSGG 112 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 220 GGGRGGFGGRRGGGGGGGGGG 240 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 221 GGRGGFGGRRGGGGGGGGGGG 241 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GG GGGGG Sbjct: 333 GSGGGGYHNRDRGGNSQGGGGG 354 >AE014298-1712|AAF48112.1| 118|Drosophila melanogaster CG1840-PA protein. Length = 118 Score = 36.3 bits (80), Expect = 0.051 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 65 GGGGGGGGGGGGGGGGGGGGGG 86 Score = 36.3 bits (80), Expect = 0.051 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 66 GGGGGGGGGGGGGGGGGGGGGG 87 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 68 GGGGGGGGGGGGGGGGGGGGSG 89 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 65 GGGGGGGGGGGGGGGGGGGGG 85 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 66 GGGGGGGGGGGGGGGGGGGGG 86 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 67 GGGGGGGGGGGGGGGGGGGGG 87 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 69 GGGGGGGGGGGGGGGGGGGSG 89 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GG Sbjct: 72 GGGGGGGGGGGGGGGGSGYRGG 93 >AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-PA, isoform A protein. Length = 514 Score = 36.3 bits (80), Expect = 0.051 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PP P P P GG PPPPPP Sbjct: 394 PPAPPPMPVFGAGGAPPPPPP 414 Score = 34.7 bits (76), Expect = 0.16 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP P GG PPPPPP Sbjct: 394 PPAPPPMPVFGAGGAPPPPPPP 415 Score = 34.3 bits (75), Expect = 0.21 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PPP PPP G PPPPP Sbjct: 409 PPPPPPPSSGMAGVPPPPP 427 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPX------PPPPXXGGGXPPPPPP 434 PPPP PPPP G PP PPP Sbjct: 372 PPPPTAASVGVPPPPPAPPAGVPPAPPP 399 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPP 428 PPPP PP G PPPP Sbjct: 409 PPPPPPPSSGMAGVPPPPP 427 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +3 Query: 372 PPPPXPPPPXXGG-GXPPPPP 431 P P PPPP G PPPPP Sbjct: 367 PVPVSPPPPTAASVGVPPPPP 387 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 730 PPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 PPPP P A PPPPPP Sbjct: 384 PPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPP 415 >AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-PB, isoform B protein. Length = 630 Score = 36.3 bits (80), Expect = 0.051 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PP P P P GG PPPPPP Sbjct: 510 PPAPPPMPVFGAGGAPPPPPP 530 Score = 34.7 bits (76), Expect = 0.16 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP P GG PPPPPP Sbjct: 510 PPAPPPMPVFGAGGAPPPPPPP 531 Score = 34.3 bits (75), Expect = 0.21 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PPP PPP G PPPPP Sbjct: 525 PPPPPPPSSGMAGVPPPPP 543 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPX------PPPPXXGGGXPPPPPP 434 PPPP PPPP G PP PPP Sbjct: 488 PPPPTAASVGVPPPPPAPPAGVPPAPPP 515 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPP 428 PPPP PP G PPPP Sbjct: 525 PPPPPPPSSGMAGVPPPPP 543 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +3 Query: 372 PPPPXPPPPXXGG-GXPPPPP 431 P P PPPP G PPPPP Sbjct: 483 PVPVSPPPPTAASVGVPPPPP 503 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 730 PPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 PPPP P A PPPPPP Sbjct: 500 PPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPP 531 >AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-PA protein. Length = 239 Score = 36.3 bits (80), Expect = 0.051 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPPPXPP--PPXXGGGXPPPPPP 434 PPPPP PP PP PPPPPP Sbjct: 186 PPPPPPPPYYPPYPYYPPPPPPPP 209 Score = 29.5 bits (63), Expect = 5.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P P P P PP PP Sbjct: 187 PPPPPPPYYPPYPYYPPPPPP 207 >U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptide protein. Length = 684 Score = 35.9 bits (79), Expect = 0.068 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 7/29 (24%) Frame = +3 Query: 369 PPPPPXPP------PPXXGG-GXPPPPPP 434 PP PP PP PP GG G PPPPPP Sbjct: 447 PPAPPAPPAMGGGPPPAPGGPGAPPPPPP 475 Score = 35.5 bits (78), Expect = 0.089 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPXPPPPXXGG----GXPPPPPP 434 P P P PPPP GG G PPP PP Sbjct: 405 PAPAPPPPPPSFGGAAGGGPPPPAPP 430 Score = 35.1 bits (77), Expect = 0.12 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 5/26 (19%) Frame = +3 Query: 369 PPPPPX-----PPPPXXGGGXPPPPP 431 PP PP PPPP GGG PP PP Sbjct: 426 PPAPPQMFNGAPPPPAMGGGPPPAPP 451 Score = 33.9 bits (74), Expect = 0.27 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPP 428 PPP P PP GGG PP P Sbjct: 446 PPPAPPAPPAMGGGPPPAP 464 Score = 33.5 bits (73), Expect = 0.36 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPXP------PPPXXGGGXPPPPPP 434 PPPP P PPP GG PPP PP Sbjct: 424 PPPPAPPQMFNGAPPPPAMGGGPPPAPP 451 Score = 33.5 bits (73), Expect = 0.36 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PPP PP P GG PPP P Sbjct: 446 PPPAPPAPPAMGGGPPPAP 464 >U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 35.9 bits (79), Expect = 0.068 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 238 GGGGGGRFDRGGGGGGNGGGGG 259 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGGG Sbjct: 255 GGGGGGRYDRGGGGGGGGGGG 275 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 255 GGGGGGRYDRGGGGGGGGGGG 275 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGG Sbjct: 237 GGGGGGGRFDRGGGGGGNGGGG 258 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 253 GNGGGGGGRYDRGGGGGGGGGG 274 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGGG Sbjct: 219 GGGRGGFGGRRGGGGGGGGGGG 240 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 236 GGGGGGGGRFDRGGGGGGNGGG 257 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGGG Sbjct: 218 GGGGRGGFGGRRGGGGGGGGGG 239 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 223 GGFGGRRGGGGGGGGGGGGGG 243 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGG--GGXGGGGG 368 GGGGGG GG GG GGGGG Sbjct: 214 GGGGGGGGRGGFGGRRGGGGGGGG 237 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXG--GGGXGGGGG 368 GGGGGG G GGG GGGGG Sbjct: 215 GGGGGGGRGGFGGRRGGGGGGGGG 238 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GG GG Sbjct: 235 GGGGGGGGGRFDRGGGGGGNGG 256 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGGG Sbjct: 252 GGNGGGGGGRYDRGGGGGGGGG 273 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 223 GGFGGRRGGGGGGGGGGGGGG 243 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGG Sbjct: 212 GGGGGGGGGGRGGFGGRRGGGG 233 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG GGGGG Sbjct: 213 GGGGGGGGGRGGFGGRRGGGGG 234 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 220 GGRGGFGGRRGGGGGGGGGGGG 241 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GG G GGGG GGGGG Sbjct: 221 GRGGFGGRRGGGGGGGGGGGGG 242 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 255 GGGGGGRYDRGGGGGGGGGGG 275 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 219 GGGRGGFGGRRGGGGGGGGGG 239 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 220 GGRGGFGGRRGGGGGGGGGGG 240 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 239 GGGGGRFDRGGGGGGNGGGGG 259 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GG GGGGG Sbjct: 338 GSGGGGYHNRDRGGNSQGGGGG 359 >M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protein protein. Length = 365 Score = 35.9 bits (79), Expect = 0.068 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 200 GGGGGGRFDRGGGGGGNGGGGG 221 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGGG Sbjct: 217 GGGGGGRYDRGGGGGGGGGGG 237 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 217 GGGGGGRYDRGGGGGGGGGGG 237 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGG Sbjct: 199 GGGGGGGRFDRGGGGGGNGGGG 220 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 215 GNGGGGGGRYDRGGGGGGGGGG 236 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGGG Sbjct: 181 GGGRGGFGGRRGGGGGGGGGGG 202 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 198 GGGGGGGGRFDRGGGGGGNGGG 219 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGGG Sbjct: 180 GGGGRGGFGGRRGGGGGGGGGG 201 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 185 GGFGGRRGGGGGGGGGGGGGG 205 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGG--GGXGGGGG 368 GGGGGG GG GG GGGGG Sbjct: 176 GGGGGGGGRGGFGGRRGGGGGGGG 199 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXG--GGGXGGGGG 368 GGGGGG G GGG GGGGG Sbjct: 177 GGGGGGGRGGFGGRRGGGGGGGGG 200 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GG GG Sbjct: 197 GGGGGGGGGRFDRGGGGGGNGG 218 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGGG Sbjct: 214 GGNGGGGGGRYDRGGGGGGGGG 235 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 185 GGFGGRRGGGGGGGGGGGGGG 205 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGG Sbjct: 174 GGGGGGGGGGRGGFGGRRGGGG 195 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG GGGGG Sbjct: 175 GGGGGGGGGRGGFGGRRGGGGG 196 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 182 GGRGGFGGRRGGGGGGGGGGGG 203 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GG G GGGG GGGGG Sbjct: 183 GRGGFGGRRGGGGGGGGGGGGG 204 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 217 GGGGGGRYDRGGGGGGGGGGG 237 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 181 GGGRGGFGGRRGGGGGGGGGG 201 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 182 GGRGGFGGRRGGGGGGGGGGG 202 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 201 GGGGGRFDRGGGGGGNGGGGG 221 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GG GGGGG Sbjct: 300 GSGGGGYHNRDRGGNSQGGGGG 321 >L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 35.9 bits (79), Expect = 0.068 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 238 GGGGGGRFDRGGGGGGNGGGGG 259 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGGG Sbjct: 255 GGGGGGRYDRGGGGGGGGGGG 275 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 255 GGGGGGRYDRGGGGGGGGGGG 275 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGG Sbjct: 237 GGGGGGGRFDRGGGGGGNGGGG 258 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 253 GNGGGGGGRYDRGGGGGGGGGG 274 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGGG Sbjct: 219 GGGRGGFGGRRGGGGGGGGGGG 240 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 236 GGGGGGGGRFDRGGGGGGNGGG 257 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGGG Sbjct: 218 GGGGRGGFGGRRGGGGGGGGGG 239 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 223 GGFGGRRGGGGGGGGGGGGGG 243 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGG--GGXGGGGG 368 GGGGGG GG GG GGGGG Sbjct: 214 GGGGGGGGRGGFGGRRGGGGGGGG 237 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXG--GGGXGGGGG 368 GGGGGG G GGG GGGGG Sbjct: 215 GGGGGGGRGGFGGRRGGGGGGGGG 238 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GG GG Sbjct: 235 GGGGGGGGGRFDRGGGGGGNGG 256 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGGG Sbjct: 252 GGNGGGGGGRYDRGGGGGGGGG 273 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 223 GGFGGRRGGGGGGGGGGGGGG 243 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGG Sbjct: 212 GGGGGGGGGGRGGFGGRRGGGG 233 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG GGGGG Sbjct: 213 GGGGGGGGGRGGFGGRRGGGGG 234 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 220 GGRGGFGGRRGGGGGGGGGGGG 241 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GG G GGGG GGGGG Sbjct: 221 GRGGFGGRRGGGGGGGGGGGGG 242 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 255 GGGGGGRYDRGGGGGGGGGGG 275 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 219 GGGRGGFGGRRGGGGGGGGGG 239 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 220 GGRGGFGGRRGGGGGGGGGGG 240 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 239 GGGGGRFDRGGGGGGNGGGGG 259 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GG GGGGG Sbjct: 338 GSGGGGYHNRDRGGNSQGGGGG 359 >BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p protein. Length = 687 Score = 35.9 bits (79), Expect = 0.068 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 7/29 (24%) Frame = +3 Query: 369 PPPPPXPP------PPXXGG-GXPPPPPP 434 PP PP PP PP GG G PPPPPP Sbjct: 450 PPAPPAPPAMGGGPPPAPGGPGAPPPPPP 478 Score = 35.5 bits (78), Expect = 0.089 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPXPPPPXXGG----GXPPPPPP 434 P P P PPPP GG G PPP PP Sbjct: 408 PAPAPPPPPPSFGGAAGGGPPPPAPP 433 Score = 35.1 bits (77), Expect = 0.12 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 5/26 (19%) Frame = +3 Query: 369 PPPPPX-----PPPPXXGGGXPPPPP 431 PP PP PPPP GGG PP PP Sbjct: 429 PPAPPQMFNGAPPPPAMGGGPPPAPP 454 Score = 33.9 bits (74), Expect = 0.27 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPP 428 PPP P PP GGG PP P Sbjct: 449 PPPAPPAPPAMGGGPPPAP 467 Score = 33.5 bits (73), Expect = 0.36 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPXP------PPPXXGGGXPPPPPP 434 PPPP P PPP GG PPP PP Sbjct: 427 PPPPAPPQMFNGAPPPPAMGGGPPPAPP 454 Score = 33.5 bits (73), Expect = 0.36 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PPP PP P GG PPP P Sbjct: 449 PPPAPPAPPAMGGGPPPAP 467 >AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p protein. Length = 846 Score = 35.9 bits (79), Expect = 0.068 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P PP PPPP P Sbjct: 172 PPPPPPPAPPTVEPPPPPPPAP 193 Score = 33.5 bits (73), Expect = 0.36 Identities = 17/59 (28%), Positives = 18/59 (30%) Frame = +2 Query: 206 PNPVNPXLGXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPPPXPXPPPPXXPXXXPPXPP 382 P P P + PPP PP PPPP P PP PP Sbjct: 119 PGP-QPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPP 176 Score = 33.5 bits (73), Expect = 0.36 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPX------PPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 150 PPPPPAPPTIKPPPPPAPPTVEPPPPPP 177 Score = 31.9 bits (69), Expect = 1.1 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 8/30 (26%) Frame = +3 Query: 369 PPPPPX--------PPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 161 PPPPPAPPTVEPPPPPPPAPPTVEPPPPPP 190 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPPPXP-----PPPXXGGGXPPPPPP 434 PPPPP P PPP PPPPP Sbjct: 139 PPPPPAPPTLVPPPPPAPPTIKPPPPP 165 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPPPXP-----PPPXXGGGXPPPPPP 434 PPPPP P PPP PPPPP Sbjct: 198 PPPPPAPAEVEPPPPPAPTELEPPPPP 224 Score = 31.1 bits (67), Expect = 1.9 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 4/65 (6%) Frame = +2 Query: 200 KXPNPVNPXLGXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPPPXPX----PPPPXXPXXX 367 K P P P PPP PPP P PPPP Sbjct: 160 KPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELE 219 Query: 368 PPXPP 382 PP PP Sbjct: 220 PPPPP 224 Score = 30.7 bits (66), Expect = 2.5 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPP------PXPPPPXXGGGXPPPPPP 434 PPPP P PPPP PPPPP Sbjct: 175 PPPPAPPTVEPPPPPPPAPTKVEPPPPP 202 Score = 30.7 bits (66), Expect = 2.5 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 7/29 (24%) Frame = +3 Query: 369 PPPPPX-------PPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPP Sbjct: 185 PPPPPPPAPTKVEPPPPPAPAEVEPPPPP 213 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +3 Query: 372 PPPPX---PPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPP Sbjct: 131 PPPPHTIEPPPPPAPPTLVPPPPP 154 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P PPPP P Sbjct: 94 PPPPPRPASPKV---EPPPPAP 112 >AY113557-1|AAM29562.1| 93|Drosophila melanogaster RH06401p protein. Length = 93 Score = 35.9 bits (79), Expect = 0.068 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 24 GGGGGGGGYGGGGGGGYGGGGG 45 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 25 GGGGGGGYGGGGGGGYGGGGGG 46 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 25 GGGGGGGYGGGGGGGYGGGGG 45 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 24 GGGGGGGGYGGGGGGGYGGG 43 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 33 GGGGGGGYGGGGGGQSGYGGG 53 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GGGG Sbjct: 41 GGGGGGQSGYGGGGQKNGGGG 61 >AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p protein. Length = 831 Score = 35.9 bits (79), Expect = 0.068 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 7/29 (24%) Frame = +3 Query: 369 PPPPPXPP------PPXXGG-GXPPPPPP 434 PP PP PP PP GG G PPPPPP Sbjct: 593 PPAPPAPPAMGGGPPPAPGGPGAPPPPPP 621 Score = 35.5 bits (78), Expect = 0.089 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPXPPPPXXGG----GXPPPPPP 434 P P P PPPP GG G PPP PP Sbjct: 551 PAPAPPPPPPSFGGAAGGGPPPPAPP 576 Score = 35.1 bits (77), Expect = 0.12 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 5/26 (19%) Frame = +3 Query: 369 PPPPPX-----PPPPXXGGGXPPPPP 431 PP PP PPPP GGG PP PP Sbjct: 572 PPAPPQMFNGAPPPPAMGGGPPPAPP 597 Score = 33.9 bits (74), Expect = 0.27 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPP 428 PPP P PP GGG PP P Sbjct: 592 PPPAPPAPPAMGGGPPPAP 610 Score = 33.5 bits (73), Expect = 0.36 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPXP------PPPXXGGGXPPPPPP 434 PPPP P PPP GG PPP PP Sbjct: 570 PPPPAPPQMFNGAPPPPAMGGGPPPAPP 597 Score = 33.5 bits (73), Expect = 0.36 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PPP PP P GG PPP P Sbjct: 592 PPPAPPAPPAMGGGPPPAP 610 >AY070547-1|AAL48018.1| 335|Drosophila melanogaster LD27487p protein. Length = 335 Score = 35.9 bits (79), Expect = 0.068 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 26 GGGGGGGGLNLGGGGGNGGGGG 47 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGG Sbjct: 25 GGGGGGGGGLNLGGGGGNGGGG 46 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 27 GGGGGGGLNLGGGGGNGGGGGG 48 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG G GGG Sbjct: 24 GGGGGGGGGGLNLGGGGGNGGG 45 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 27 GGGGGGGLNLGGGGGNGGGGG 47 Score = 29.1 bits (62), Expect = 7.8 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXGG-GGXGGGGG 368 GGGGGG GG GG GGG G Sbjct: 28 GGGGGGLNLGGGGGNGGGGGGSG 50 >AE014298-2542|AAF48711.1| 133|Drosophila melanogaster CG5172-PA, isoform A protein. Length = 133 Score = 35.9 bits (79), Expect = 0.068 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 24 GGGGGGGGYGGGGGGGYGGGGG 45 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 25 GGGGGGGYGGGGGGGYGGGGGG 46 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 25 GGGGGGGYGGGGGGGYGGGGG 45 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 24 GGGGGGGGYGGGGGGGYGGG 43 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 33 GGGGGGGYGGGGGGQSGYGGG 53 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GGGG Sbjct: 41 GGGGGGQSGYGGGGQKNGGGG 61 >AE014298-2541|AAS65393.1| 95|Drosophila melanogaster CG5172-PB, isoform B protein. Length = 95 Score = 35.9 bits (79), Expect = 0.068 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 24 GGGGGGGGYGGGGGGGYGGGGG 45 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 25 GGGGGGGYGGGGGGGYGGGGGG 46 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 25 GGGGGGGYGGGGGGGYGGGGG 45 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 24 GGGGGGGGYGGGGGGGYGGG 43 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 33 GGGGGGGYGGGGGGQSGYGGG 53 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GGGG Sbjct: 41 GGGGGGQSGYGGGGQKNGGGG 61 >AE014298-1420|AAF46562.2| 376|Drosophila melanogaster CG2962-PA protein. Length = 376 Score = 35.9 bits (79), Expect = 0.068 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 26 GGGGGGGGLNLGGGGGNGGGGG 47 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGG Sbjct: 25 GGGGGGGGGLNLGGGGGNGGGG 46 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 27 GGGGGGGLNLGGGGGNGGGGGG 48 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG G GGG Sbjct: 24 GGGGGGGGGGLNLGGGGGNGGG 45 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 27 GGGGGGGLNLGGGGGNGGGGG 47 Score = 29.1 bits (62), Expect = 7.8 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXGG-GGXGGGGG 368 GGGGGG GG GG GGG G Sbjct: 28 GGGGGGLNLGGGGGNGGGGGGSG 50 >AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA, isoform A protein. Length = 1109 Score = 35.9 bits (79), Expect = 0.068 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P PP PPPP P Sbjct: 435 PPPPPPPAPPTVEPPPPPPPAP 456 Score = 33.5 bits (73), Expect = 0.36 Identities = 17/59 (28%), Positives = 18/59 (30%) Frame = +2 Query: 206 PNPVNPXLGXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPPPXPXPPPPXXPXXXPPXPP 382 P P P + PPP PP PPPP P PP PP Sbjct: 382 PGP-QPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPP 439 Score = 33.5 bits (73), Expect = 0.36 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPX------PPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 413 PPPPPAPPTIKPPPPPAPPTVEPPPPPP 440 Score = 31.9 bits (69), Expect = 1.1 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 8/30 (26%) Frame = +3 Query: 369 PPPPPX--------PPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 424 PPPPPAPPTVEPPPPPPPAPPTVEPPPPPP 453 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPPPXP-----PPPXXGGGXPPPPPP 434 PPPPP P PPP PPPPP Sbjct: 402 PPPPPAPPTLVPPPPPAPPTIKPPPPP 428 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPPPXP-----PPPXXGGGXPPPPPP 434 PPPPP P PPP PPPPP Sbjct: 461 PPPPPAPAEVEPPPPPAPTELEPPPPP 487 Score = 31.1 bits (67), Expect = 1.9 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 4/65 (6%) Frame = +2 Query: 200 KXPNPVNPXLGXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPPPXPX----PPPPXXPXXX 367 K P P P PPP PPP P PPPP Sbjct: 423 KPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELE 482 Query: 368 PPXPP 382 PP PP Sbjct: 483 PPPPP 487 Score = 30.7 bits (66), Expect = 2.5 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPP------PXPPPPXXGGGXPPPPPP 434 PPPP P PPPP PPPPP Sbjct: 438 PPPPAPPTVEPPPPPPPAPTKVEPPPPP 465 Score = 30.7 bits (66), Expect = 2.5 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 7/29 (24%) Frame = +3 Query: 369 PPPPPX-------PPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPP Sbjct: 448 PPPPPPPAPTKVEPPPPPAPAEVEPPPPP 476 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +3 Query: 372 PPPPX---PPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPP Sbjct: 394 PPPPHTIEPPPPPAPPTLVPPPPP 417 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P PPPP P Sbjct: 357 PPPPPRPASPKV---EPPPPAP 375 >AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB, isoform B protein. Length = 1150 Score = 35.9 bits (79), Expect = 0.068 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P PP PPPP P Sbjct: 435 PPPPPPPAPPTVEPPPPPPPAP 456 Score = 33.5 bits (73), Expect = 0.36 Identities = 17/59 (28%), Positives = 18/59 (30%) Frame = +2 Query: 206 PNPVNPXLGXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPPPXPXPPPPXXPXXXPPXPP 382 P P P + PPP PP PPPP P PP PP Sbjct: 382 PGP-QPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPP 439 Score = 33.5 bits (73), Expect = 0.36 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPX------PPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 413 PPPPPAPPTIKPPPPPAPPTVEPPPPPP 440 Score = 31.9 bits (69), Expect = 1.1 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 8/30 (26%) Frame = +3 Query: 369 PPPPPX--------PPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 424 PPPPPAPPTVEPPPPPPPAPPTVEPPPPPP 453 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPPPXP-----PPPXXGGGXPPPPPP 434 PPPPP P PPP PPPPP Sbjct: 402 PPPPPAPPTLVPPPPPAPPTIKPPPPP 428 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPPPXP-----PPPXXGGGXPPPPPP 434 PPPPP P PPP PPPPP Sbjct: 461 PPPPPAPAEVEPPPPPAPTELEPPPPP 487 Score = 31.1 bits (67), Expect = 1.9 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 4/65 (6%) Frame = +2 Query: 200 KXPNPVNPXLGXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPPPXPX----PPPPXXPXXX 367 K P P P PPP PPP P PPPP Sbjct: 423 KPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELE 482 Query: 368 PPXPP 382 PP PP Sbjct: 483 PPPPP 487 Score = 30.7 bits (66), Expect = 2.5 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPP------PXPPPPXXGGGXPPPPPP 434 PPPP P PPPP PPPPP Sbjct: 438 PPPPAPPTVEPPPPPPPAPTKVEPPPPP 465 Score = 30.7 bits (66), Expect = 2.5 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 7/29 (24%) Frame = +3 Query: 369 PPPPPX-------PPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPP Sbjct: 448 PPPPPPPAPTKVEPPPPPAPAEVEPPPPP 476 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +3 Query: 372 PPPPX---PPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPP Sbjct: 394 PPPPHTIEPPPPPAPPTLVPPPPP 417 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P PPPP P Sbjct: 357 PPPPPRPASPKV---EPPPPAP 375 >AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-PB, isoform B protein. Length = 829 Score = 35.9 bits (79), Expect = 0.068 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 7/29 (24%) Frame = +3 Query: 369 PPPPPXPP------PPXXGG-GXPPPPPP 434 PP PP PP PP GG G PPPPPP Sbjct: 592 PPAPPAPPAMGGGPPPAPGGPGAPPPPPP 620 Score = 35.5 bits (78), Expect = 0.089 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPXPPPPXXGG----GXPPPPPP 434 P P P PPPP GG G PPP PP Sbjct: 550 PAPAPPPPPPSFGGAAGGGPPPPAPP 575 Score = 35.1 bits (77), Expect = 0.12 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 5/26 (19%) Frame = +3 Query: 369 PPPPPX-----PPPPXXGGGXPPPPP 431 PP PP PPPP GGG PP PP Sbjct: 571 PPAPPQMFNGAPPPPAMGGGPPPAPP 596 Score = 33.9 bits (74), Expect = 0.27 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPP 428 PPP P PP GGG PP P Sbjct: 591 PPPAPPAPPAMGGGPPPAP 609 Score = 33.5 bits (73), Expect = 0.36 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPXP------PPPXXGGGXPPPPPP 434 PPPP P PPP GG PPP PP Sbjct: 569 PPPPAPPQMFNGAPPPPAMGGGPPPAPP 596 Score = 33.5 bits (73), Expect = 0.36 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PPP PP P GG PPP P Sbjct: 591 PPPAPPAPPAMGGGPPPAP 609 >AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-PE, isoform E protein. Length = 684 Score = 35.9 bits (79), Expect = 0.068 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 7/29 (24%) Frame = +3 Query: 369 PPPPPXPP------PPXXGG-GXPPPPPP 434 PP PP PP PP GG G PPPPPP Sbjct: 447 PPAPPAPPAMGGGPPPAPGGPGAPPPPPP 475 Score = 35.5 bits (78), Expect = 0.089 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPXPPPPXXGG----GXPPPPPP 434 P P P PPPP GG G PPP PP Sbjct: 405 PAPAPPPPPPSFGGAAGGGPPPPAPP 430 Score = 35.1 bits (77), Expect = 0.12 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 5/26 (19%) Frame = +3 Query: 369 PPPPPX-----PPPPXXGGGXPPPPP 431 PP PP PPPP GGG PP PP Sbjct: 426 PPAPPQMFNGAPPPPAMGGGPPPAPP 451 Score = 33.9 bits (74), Expect = 0.27 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPP 428 PPP P PP GGG PP P Sbjct: 446 PPPAPPAPPAMGGGPPPAP 464 Score = 33.5 bits (73), Expect = 0.36 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPXP------PPPXXGGGXPPPPPP 434 PPPP P PPP GG PPP PP Sbjct: 424 PPPPAPPQMFNGAPPPPAMGGGPPPAPP 451 Score = 33.5 bits (73), Expect = 0.36 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PPP PP P GG PPP P Sbjct: 446 PPPAPPAPPAMGGGPPPAP 464 >AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-PC, isoform C protein. Length = 684 Score = 35.9 bits (79), Expect = 0.068 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 7/29 (24%) Frame = +3 Query: 369 PPPPPXPP------PPXXGG-GXPPPPPP 434 PP PP PP PP GG G PPPPPP Sbjct: 447 PPAPPAPPAMGGGPPPAPGGPGAPPPPPP 475 Score = 35.5 bits (78), Expect = 0.089 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPXPPPPXXGG----GXPPPPPP 434 P P P PPPP GG G PPP PP Sbjct: 405 PAPAPPPPPPSFGGAAGGGPPPPAPP 430 Score = 35.1 bits (77), Expect = 0.12 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 5/26 (19%) Frame = +3 Query: 369 PPPPPX-----PPPPXXGGGXPPPPP 431 PP PP PPPP GGG PP PP Sbjct: 426 PPAPPQMFNGAPPPPAMGGGPPPAPP 451 Score = 33.9 bits (74), Expect = 0.27 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPP 428 PPP P PP GGG PP P Sbjct: 446 PPPAPPAPPAMGGGPPPAP 464 Score = 33.5 bits (73), Expect = 0.36 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPXP------PPPXXGGGXPPPPPP 434 PPPP P PPP GG PPP PP Sbjct: 424 PPPPAPPQMFNGAPPPPAMGGGPPPAPP 451 Score = 33.5 bits (73), Expect = 0.36 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PPP PP P GG PPP P Sbjct: 446 PPPAPPAPPAMGGGPPPAP 464 >AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-PA, isoform A protein. Length = 684 Score = 35.9 bits (79), Expect = 0.068 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 7/29 (24%) Frame = +3 Query: 369 PPPPPXPP------PPXXGG-GXPPPPPP 434 PP PP PP PP GG G PPPPPP Sbjct: 447 PPAPPAPPAMGGGPPPAPGGPGAPPPPPP 475 Score = 35.5 bits (78), Expect = 0.089 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPXPPPPXXGG----GXPPPPPP 434 P P P PPPP GG G PPP PP Sbjct: 405 PAPAPPPPPPSFGGAAGGGPPPPAPP 430 Score = 35.1 bits (77), Expect = 0.12 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 5/26 (19%) Frame = +3 Query: 369 PPPPPX-----PPPPXXGGGXPPPPP 431 PP PP PPPP GGG PP PP Sbjct: 426 PPAPPQMFNGAPPPPAMGGGPPPAPP 451 Score = 33.9 bits (74), Expect = 0.27 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPP 428 PPP P PP GGG PP P Sbjct: 446 PPPAPPAPPAMGGGPPPAP 464 Score = 33.5 bits (73), Expect = 0.36 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPXP------PPPXXGGGXPPPPPP 434 PPPP P PPP GG PPP PP Sbjct: 424 PPPPAPPQMFNGAPPPPAMGGGPPPAPP 451 Score = 33.5 bits (73), Expect = 0.36 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PPP PP P GG PPP P Sbjct: 446 PPPAPPAPPAMGGGPPPAP 464 >AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-PD, isoform D protein. Length = 687 Score = 35.9 bits (79), Expect = 0.068 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 7/29 (24%) Frame = +3 Query: 369 PPPPPXPP------PPXXGG-GXPPPPPP 434 PP PP PP PP GG G PPPPPP Sbjct: 450 PPAPPAPPAMGGGPPPAPGGPGAPPPPPP 478 Score = 35.5 bits (78), Expect = 0.089 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPXPPPPXXGG----GXPPPPPP 434 P P P PPPP GG G PPP PP Sbjct: 408 PAPAPPPPPPSFGGAAGGGPPPPAPP 433 Score = 35.1 bits (77), Expect = 0.12 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 5/26 (19%) Frame = +3 Query: 369 PPPPPX-----PPPPXXGGGXPPPPP 431 PP PP PPPP GGG PP PP Sbjct: 429 PPAPPQMFNGAPPPPAMGGGPPPAPP 454 Score = 33.9 bits (74), Expect = 0.27 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPP 428 PPP P PP GGG PP P Sbjct: 449 PPPAPPAPPAMGGGPPPAP 467 Score = 33.5 bits (73), Expect = 0.36 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPXP------PPPXXGGGXPPPPPP 434 PPPP P PPP GG PPP PP Sbjct: 427 PPPPAPPQMFNGAPPPPAMGGGPPPAPP 454 Score = 33.5 bits (73), Expect = 0.36 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PPP PP P GG PPP P Sbjct: 449 PPPAPPAPPAMGGGPPPAP 467 >X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin protein. Length = 147 Score = 35.5 bits (78), Expect = 0.089 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 21 GGGGGGGGFRGRGGGGGGGGGG 42 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGGG Sbjct: 19 GGGGGGGGGGFRGRGGGGGGGG 40 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 23 GGGGGGFRGRGGGGGGGGGGFG 44 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 20 GGGGGGGGGFRGRGGGGGGGGG 41 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGG 371 GGGGG GGGG GGGG Sbjct: 85 GGGGGRGGGGRGGGGRGGGG 104 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GG G GGGG Sbjct: 33 GGGGGGGGGGFGGGRGRGGGG 53 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGG G Sbjct: 89 GRGGGGRGGGGRGGGGRGGGAG 110 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GG GG Sbjct: 71 GGGGGGGRGAFGGRGGGGGRGG 92 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G G GGGGG Sbjct: 18 GGGGGGGGGGGFRGRGGGGGGG 39 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G GGGG GGGG Sbjct: 74 GGGGRGAFGGRGGGGGRGGGG 94 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG G GGG Sbjct: 72 GGGGGGRGAFGGRGGGGGRGGG 93 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGG Sbjct: 73 GGGGGRGAFGGRGGGGGRGGGG 94 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 22 GGGGGGGFRGRGGGGGGGGGG 42 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GG GG Sbjct: 24 GGGGGFRGRGGGGGGGGGGFGG 45 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 56 GGRGGFGGGRGGGGRGGGGGG 76 >BT001738-1|AAN71493.1| 331|Drosophila melanogaster RE72617p protein. Length = 331 Score = 35.5 bits (78), Expect = 0.089 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 14 GGGGGGGGFRGRGGGGGGGGGG 35 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGGG Sbjct: 12 GGGGGGGGGGFRGRGGGGGGGG 33 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 16 GGGGGGFRGRGGGGGGGGGGFG 37 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 13 GGGGGGGGGFRGRGGGGGGGGG 34 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGG 371 GGGGG GGGG GGGG Sbjct: 65 GGGGGRGGGGRGGGGRGGGG 84 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GG G GGGG Sbjct: 26 GGGGGGGGGGFGGGRGRGGGG 46 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGG G Sbjct: 69 GRGGGGRGGGGRGGGGRGGGAG 90 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G G GGGGG Sbjct: 11 GGGGGGGGGGGFRGRGGGGGGG 32 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGGG 368 G G P GGGG GGGGG Sbjct: 2 GKPGFSPRGGGGGGGGGGGG 21 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 15 GGGGGGGFRGRGGGGGGGGGG 35 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GG GG Sbjct: 17 GGGGGFRGRGGGGGGGGGGFGG 38 >AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p protein. Length = 299 Score = 35.5 bits (78), Expect = 0.089 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 19 GGGGGGGRGFGGGGGGRGGGGG 40 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGG Sbjct: 18 GGGGGGGGRGFGGGGGGRGGGG 39 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 29 GGGGGG----RGGGGGRGGGGG 46 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 27 GFGGGGGGRGGGGGRGGGGG 46 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG G GGG Sbjct: 31 GGGGRGGGGGRGGGGGFGRGGG 52 Score = 29.5 bits (63), Expect = 5.9 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXG---GGGG 368 GGGGGG GGGG G GGGG Sbjct: 8 GGGGGGGRGFGGGGGGGGRGFGGGG 32 Score = 29.5 bits (63), Expect = 5.9 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGX---GGGGG 368 GGGGGG GGGG GGGGG Sbjct: 9 GGGGGGRGFGGGGGGGGRGFGGGGG 33 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 11 GGGGRGFGGGGGGGGRGFGGG 31 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 18 GGGGGGGGRGFGGGGGGRGGG 38 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 19 GGGGGGGRGFGGGGGGRGGGG 39 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 32 GGGRGGGGGRGGGGGFGRGGG 52 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 38 GGGRGGGGGFGRGGGGRGGGRG 59 >AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA protein. Length = 344 Score = 35.5 bits (78), Expect = 0.089 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 14 GGGGGGGGFRGRGGGGGGGGGG 35 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGGG Sbjct: 12 GGGGGGGGGGFRGRGGGGGGGG 33 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 16 GGGGGGFRGRGGGGGGGGGGFG 37 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 13 GGGGGGGGGFRGRGGGGGGGGG 34 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGG 371 GGGGG GGGG GGGG Sbjct: 78 GGGGGRGGGGRGGGGRGGGG 97 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GG G GGGG Sbjct: 26 GGGGGGGGGGFGGGRGRGGGG 46 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGG G Sbjct: 82 GRGGGGRGGGGRGGGGRGGGAG 103 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GG GG Sbjct: 64 GGGGGGGRGAFGGRGGGGGRGG 85 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G G GGGGG Sbjct: 11 GGGGGGGGGGGFRGRGGGGGGG 32 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G GGGG GGGG Sbjct: 67 GGGGRGAFGGRGGGGGRGGGG 87 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG G GGG Sbjct: 65 GGGGGGRGAFGGRGGGGGRGGG 86 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGG Sbjct: 66 GGGGGRGAFGGRGGGGGRGGGG 87 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGGG 368 G G P GGGG GGGGG Sbjct: 2 GKPGFSPRGGGGGGGGGGGG 21 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 15 GGGGGGGFRGRGGGGGGGGGG 35 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GG GG Sbjct: 17 GGGGGFRGRGGGGGGGGGGFGG 38 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 49 GGRGGFGGGRGGGGRGGGGGG 69 >AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA protein. Length = 237 Score = 35.5 bits (78), Expect = 0.089 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 19 GGGGGGGRGFGGGGGGRGGGGG 40 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGG Sbjct: 18 GGGGGGGGRGFGGGGGGRGGGG 39 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGGG Sbjct: 213 GGGGGGGFNRGRGGGGGGGGG 233 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 214 GGGGGGFNRGRGGGGGGGGGRG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGGG Sbjct: 177 GGGGFGGRGGGRGGGGRGGGGG 198 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 29 GGGGGG----RGGGGGRGGGGG 46 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 212 GGGGGGGGFNRGRGGGGGGGGG 233 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 27 GFGGGGGGRGGGGGRGGGGG 46 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG G GGG Sbjct: 31 GGGGRGGGGGRGGGGGFGRGGG 52 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG G GGG Sbjct: 175 GGGGGGFGGRGGGRGGGGRGGG 196 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGG Sbjct: 182 GGRGGGRGGGGRGGGGGRGGGG 203 Score = 29.5 bits (63), Expect = 5.9 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXG---GGGG 368 GGGGGG GGGG G GGGG Sbjct: 8 GGGGGGGRGFGGGGGGGGRGFGGGG 32 Score = 29.5 bits (63), Expect = 5.9 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGX---GGGGG 368 GGGGGG GGGG GGGGG Sbjct: 9 GGGGGGRGFGGGGGGGGRGFGGGGG 33 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 11 GGGGRGFGGGGGGGGRGFGGG 31 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 18 GGGGGGGGRGFGGGGGGRGGG 38 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 19 GGGGGGGRGFGGGGGGRGGGG 39 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 32 GGGRGGGGGRGGGGGFGRGGG 52 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 38 GGGRGGGGGFGRGGGGRGGGRG 59 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGG G Sbjct: 173 GGGGGGGGFGGRGGGRGGGGRG 194 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GG GG Sbjct: 174 GGGGGGGFGGRGGGRGGGGRGG 195 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 182 GGRGGGRGGGGRGGGGGRGGG 202 >X15586-1|CAA33611.1| 1443|Drosophila melanogaster protein ( D.melanogaster 75B mRNAencoding hypothetical 75B protein. ). Length = 1443 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP PPPPP Sbjct: 271 PPPPPPPPPP------PPPPP 285 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 271 PPPPPPPPP------PPPPPP 285 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PP P PPPP P PP PP Sbjct: 267 PPLAPPPPPP--PPPPPPPPP 285 >U42699-1|AAA96754.1| 924|Drosophila melanogaster trachealess protein. Length = 924 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 209 GGGGGGGGSSSSGGGGGGAGGG 230 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 210 GGGGGGGSSSSGGGGGGAGGG 230 >BT023503-1|AAY84903.1| 1327|Drosophila melanogaster LD20030p protein. Length = 1327 Score = 34.7 bits (76), Expect = 0.16 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 PP PPPP PPPPPP Sbjct: 4 PPLPPPPVQPAPPPPPPPP 22 Score = 29.5 bits (63), Expect = 5.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 332 PXPPPPXXPXXXPPXPP 382 P PPPP P PP PP Sbjct: 5 PLPPPPVQPAPPPPPPP 21 >BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p protein. Length = 1011 Score = 34.7 bits (76), Expect = 0.16 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 5/26 (19%) Frame = +3 Query: 369 PPPPPX-----PPPPXXGGGXPPPPP 431 PPPPP PPPP G PPPPP Sbjct: 598 PPPPPMAPSMMPPPPPPCPGAPPPPP 623 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPP-----PXPPPPXXGGGXPPPPPP 434 P PP P PPPP PPPPPP Sbjct: 588 PAPPMLKAIPPPPPPMAPSMMPPPPPP 614 Score = 29.5 bits (63), Expect = 5.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 332 PXPPPPXXPXXXPPXPP 382 P PPPP P PP PP Sbjct: 597 PPPPPPMAPSMMPPPPP 613 >AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p protein. Length = 1114 Score = 34.7 bits (76), Expect = 0.16 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 5/26 (19%) Frame = +3 Query: 369 PPPPPX-----PPPPXXGGGXPPPPP 431 PPPPP PPPP G PPPPP Sbjct: 559 PPPPPMAPSMMPPPPPPCPGAPPPPP 584 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPP-----PXPPPPXXGGGXPPPPPP 434 P PP P PPPP PPPPPP Sbjct: 549 PAPPMLKAIPPPPPPMAPSMMPPPPPP 575 Score = 29.5 bits (63), Expect = 5.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 332 PXPPPPXXPXXXPPXPP 382 P PPPP P PP PP Sbjct: 558 PPPPPPMAPSMMPPPPP 574 >AY118423-1|AAM48452.1| 263|Drosophila melanogaster RH04014p protein. Length = 263 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 143 GGAGGGGSAGGGGGGGGGGGGG 164 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GG G GGGG GGGGG Sbjct: 141 GAGGAGGGGSAGGGGGGGGGGG 162 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 140 GGAGGAGGGGSAGGGGGGGGGG 161 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 140 GGAGGAGGGGSAGGGGGGGGG 160 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 143 GGAGGGGSAGGGGGGGGGGGG 163 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 144 GAGGGGSAGGGGGGGGGGGGG 164 Score = 29.1 bits (62), Expect = 7.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 381 PXPPPPXXGGGXPPPPPP 434 P PPPP G PP PP Sbjct: 46 PPPPPPEDDGSYKPPSPP 63 >AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p protein. Length = 1211 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP PPPPP Sbjct: 476 PPPPPPPPPP------PPPPP 490 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 476 PPPPPPPPP------PPPPPP 490 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPP 422 PPPPP PPPP G P Sbjct: 479 PPPPPPPPPPPPGWWHAP 496 Score = 30.3 bits (65), Expect = 3.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPP 425 PPPPP PPPP G P Sbjct: 478 PPPPPPPPPPPPPGWWHAP 496 Score = 25.0 bits (52), Expect(2) = 3.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 605 PPXPPPPXPXG 637 PP PPPP P G Sbjct: 481 PPPPPPPPPPG 491 Score = 23.4 bits (48), Expect(2) = 3.9 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 602 SPPXPPPPXP 631 +PP PPPP P Sbjct: 475 APPPPPPPPP 484 >AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p protein. Length = 1294 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP PPPPP Sbjct: 658 PPPPPPPPPP------PPPPP 672 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 658 PPPPPPPPP------PPPPPP 672 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPP 422 PPPPP PPPP G P Sbjct: 661 PPPPPPPPPPPPGWWHAP 678 Score = 30.3 bits (65), Expect = 3.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPP 425 PPPPP PPPP G P Sbjct: 660 PPPPPPPPPPPPPGWWHAP 678 Score = 24.2 bits (50), Expect(2) = 6.5 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 605 PPXPPPPXPXGG 640 PP PPPP P G Sbjct: 662 PPPPPPPPPPPG 673 Score = 23.4 bits (48), Expect(2) = 6.5 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 602 SPPXPPPPXP 631 +PP PPPP P Sbjct: 657 APPPPPPPPP 666 >AY051568-1|AAK92992.1| 263|Drosophila melanogaster GH21518p protein. Length = 263 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 143 GGAGGGGSAGGGGGGGGGGGGG 164 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GG G GGGG GGGGG Sbjct: 141 GAGGAGGGGSAGGGGGGGGGGG 162 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 140 GGAGGAGGGGSAGGGGGGGGGG 161 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 140 GGAGGAGGGGSAGGGGGGGGG 160 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 143 GGAGGGGSAGGGGGGGGGGGG 163 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 144 GAGGGGSAGGGGGGGGGGGGG 164 Score = 29.1 bits (62), Expect = 7.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 381 PXPPPPXXGGGXPPPPPP 434 P PPPP G PP PP Sbjct: 46 PPPPPPEDDGSYKPPSPP 63 >AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 protein. Length = 979 Score = 34.7 bits (76), Expect = 0.16 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 5/26 (19%) Frame = +3 Query: 369 PPPPPX-----PPPPXXGGGXPPPPP 431 PPPPP PPPP G PPPPP Sbjct: 404 PPPPPMAPSMMPPPPPPCPGAPPPPP 429 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPP-----PXPPPPXXGGGXPPPPPP 434 P PP P PPPP PPPPPP Sbjct: 394 PAPPMLKAIPPPPPPMAPSMMPPPPPP 420 Score = 29.5 bits (63), Expect = 5.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 332 PXPPPPXXPXXXPPXPP 382 P PPPP P PP PP Sbjct: 403 PPPPPPMAPSMMPPPPP 419 >AF116572-1|AAD31170.1| 1327|Drosophila melanogaster ribonuclease protein. Length = 1327 Score = 34.7 bits (76), Expect = 0.16 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 PP PPPP PPPPPP Sbjct: 4 PPLPPPPVQPAPPPPPPPP 22 Score = 29.5 bits (63), Expect = 5.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 332 PXPPPPXXPXXXPPXPP 382 P PPPP P PP PP Sbjct: 5 PLPPPPVQPAPPPPPPP 21 >AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA, isoform A protein. Length = 1114 Score = 34.7 bits (76), Expect = 0.16 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 5/26 (19%) Frame = +3 Query: 369 PPPPPX-----PPPPXXGGGXPPPPP 431 PPPPP PPPP G PPPPP Sbjct: 559 PPPPPMAPSMMPPPPPPCPGAPPPPP 584 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPP-----PXPPPPXXGGGXPPPPPP 434 P PP P PPPP PPPPPP Sbjct: 549 PAPPMLKAIPPPPPPMAPSMMPPPPPP 575 Score = 29.5 bits (63), Expect = 5.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 332 PXPPPPXXPXXXPPXPP 382 P PPPP P PP PP Sbjct: 558 PPPPPPMAPSMMPPPPP 574 >AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB, isoform B protein. Length = 1153 Score = 34.7 bits (76), Expect = 0.16 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 5/26 (19%) Frame = +3 Query: 369 PPPPPX-----PPPPXXGGGXPPPPP 431 PPPPP PPPP G PPPPP Sbjct: 598 PPPPPMAPSMMPPPPPPCPGAPPPPP 623 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPP-----PXPPPPXXGGGXPPPPPP 434 P PP P PPPP PPPPPP Sbjct: 588 PAPPMLKAIPPPPPPMAPSMMPPPPPP 614 Score = 29.5 bits (63), Expect = 5.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 332 PXPPPPXXPXXXPPXPP 382 P PPPP P PP PP Sbjct: 597 PPPPPPMAPSMMPPPPP 613 >AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC, isoform C protein. Length = 1455 Score = 34.7 bits (76), Expect = 0.16 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 5/26 (19%) Frame = +3 Query: 369 PPPPPX-----PPPPXXGGGXPPPPP 431 PPPPP PPPP G PPPPP Sbjct: 900 PPPPPMAPSMMPPPPPPCPGAPPPPP 925 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPP-----PXPPPPXXGGGXPPPPPP 434 P PP P PPPP PPPPPP Sbjct: 890 PAPPMLKAIPPPPPPMAPSMMPPPPPP 916 Score = 29.5 bits (63), Expect = 5.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 332 PXPPPPXXPXXXPPXPP 382 P PPPP P PP PP Sbjct: 899 PPPPPPMAPSMMPPPPP 915 >AE014297-2841|AAF55795.1| 263|Drosophila melanogaster CG4000-PA protein. Length = 263 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 143 GGAGGGGSAGGGGGGGGGGGGG 164 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GG G GGGG GGGGG Sbjct: 141 GAGGAGGGGSAGGGGGGGGGGG 162 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 140 GGAGGAGGGGSAGGGGGGGGGG 161 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 140 GGAGGAGGGGSAGGGGGGGGG 160 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 143 GGAGGGGSAGGGGGGGGGGGG 163 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 144 GAGGGGSAGGGGGGGGGGGGG 164 Score = 29.1 bits (62), Expect = 7.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 381 PXPPPPXXGGGXPPPPPP 434 P PPPP G PP PP Sbjct: 46 PPPPPPEDDGSYKPPSPP 63 >AE014297-1087|AAF54491.1| 695|Drosophila melanogaster CG12809-PA protein. Length = 695 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPPPXPPPPXXG--GGXPPPPPP 434 PPPPP PPPP PP PPP Sbjct: 356 PPPPPPPPPPATSTIPATPPLPPP 379 Score = 29.5 bits (63), Expect = 5.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P PPPP Sbjct: 359 PPPPPPPATSTIPATPPLPPPP 380 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 2/23 (8%) Frame = +2 Query: 320 PPPXPXPPPPXXP--XXXPPXPP 382 PPP P PPPP PP PP Sbjct: 356 PPPPPPPPPPATSTIPATPPLPP 378 >AE014296-2989|AAF49282.3| 1412|Drosophila melanogaster CG8127-PB, isoform B protein. Length = 1412 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP PPPPP Sbjct: 269 PPPPPPPPPP------PPPPP 283 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 269 PPPPPPPPP------PPPPPP 283 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PP P PPPP P PP PP Sbjct: 265 PPLAPPPPPP--PPPPPPPPP 283 >AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-PB, isoform B protein. Length = 1294 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP PPPPP Sbjct: 658 PPPPPPPPPP------PPPPP 672 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 658 PPPPPPPPP------PPPPPP 672 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPP 422 PPPPP PPPP G P Sbjct: 661 PPPPPPPPPPPPGWWHAP 678 Score = 30.3 bits (65), Expect = 3.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPP 425 PPPPP PPPP G P Sbjct: 660 PPPPPPPPPPPPPGWWHAP 678 Score = 25.0 bits (52), Expect(2) = 3.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 605 PPXPPPPXPXG 637 PP PPPP P G Sbjct: 663 PPPPPPPPPPG 673 Score = 23.4 bits (48), Expect(2) = 3.9 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 602 SPPXPPPPXP 631 +PP PPPP P Sbjct: 657 APPPPPPPPP 666 >AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-PA, isoform A protein. Length = 1393 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP PPPPP Sbjct: 658 PPPPPPPPPP------PPPPP 672 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 658 PPPPPPPPP------PPPPPP 672 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPP 422 PPPPP PPPP G P Sbjct: 661 PPPPPPPPPPPPGWWHAP 678 Score = 30.3 bits (65), Expect = 3.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPP 425 PPPPP PPPP G P Sbjct: 660 PPPPPPPPPPPPPGWWHAP 678 Score = 25.0 bits (52), Expect(2) = 3.8 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 605 PPXPPPPXPXG 637 PP PPPP P G Sbjct: 663 PPPPPPPPPPG 673 Score = 23.4 bits (48), Expect(2) = 3.8 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 602 SPPXPPPPXP 631 +PP PPPP P Sbjct: 657 APPPPPPPPP 666 >AE013599-1244|AAS64915.1| 253|Drosophila melanogaster CG13214-PB, isoform B protein. Length = 253 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GGG GGG G Sbjct: 63 GGGGGGGPAGGFGGGPGGGGAG 84 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GGGGG Sbjct: 48 GGGGGFGGGGAGGGYGGGGGG 68 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGG GGGGG Sbjct: 46 GFGGGGGFGGGGAGGGYGGGGG 67 >AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-PA, isoform A protein. Length = 610 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GGG GGG G Sbjct: 63 GGGGGGGPAGGFGGGPGGGGAG 84 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 238 GGPGGQGAGGGGGGGSGYGGG 258 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 268 GGSGGGGGGAGGGGGYGSGGG 288 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 340 GGQGGAGGGYGGGGGGGRGGG 360 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGG GGGG GGGGG Sbjct: 262 GGGGAGGGSGGGGGGAGGGGG 282 Score = 31.9 bits (69), Expect = 1.1 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXP--PPXXGGGGXGGGGG 368 G GGGG P P GGGG GG GG Sbjct: 356 GRGGGGAPGAPGSPGGGGFGGQGG 379 Score = 31.9 bits (69), Expect = 1.1 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXP--PPXXGGGGXGGGGG 368 GGG GG P P GGGG GG GG Sbjct: 386 GGGRGGAPGAPGSPGGGGYGGQGG 409 Score = 31.9 bits (69), Expect = 1.1 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXP--PPXXGGGGXGGGGG 368 GGG GG P P GGGG GG GG Sbjct: 452 GGGRGGAPGAPGSPGGGGFGGQGG 475 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG G GGG Sbjct: 267 GGGSGGGGGGAGGGGGYGSGGG 288 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GGGGG Sbjct: 48 GGGGGFGGGGAGGGYGGGGGG 68 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGG Sbjct: 260 GFGGGGAGGGSGGGGGGAGGGG 281 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGG GGGG GGGGG Sbjct: 367 GSPGGGGFGGQGGGGGFGGGGG 388 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGG 322 GG GG G GGGG G GG Sbjct: 405 GGQGGAGGGYGGGGGRGGGG 424 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGG GGGG GGGGG Sbjct: 433 GSPGGGGFGGQGGGGGFGGGGG 454 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGG GGGGG Sbjct: 46 GFGGGGGFGGGGAGGGYGGGGG 67 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGG 371 GGGGG GG G GGGG Sbjct: 246 GGGGGGGSGYGGGSGFGGGG 265 Score = 29.5 bits (63), Expect = 5.9 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 260 GFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGF 306 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G GGG GGGG Sbjct: 262 GGGGAGGGSGGGGGGAGGGGG 282 Score = 29.5 bits (63), Expect = 5.9 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXP--PPXXGGGGXGGGGG 368 G G GG P P GGGG GG GG Sbjct: 288 GSGRGGAPGGPGAPGGGGFGGQGG 311 Score = 29.5 bits (63), Expect = 5.9 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXP--PPXXGGGGXGGGGG 368 G G GG P P GGGG GG GG Sbjct: 321 GAGRGGSPGGPGSPGGGGFGGQGG 344 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GG G GGGGG Sbjct: 335 GGGGFGGQGGAGGGYGGGGGGG 356 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGGG 368 GGGG GGG GGGGG Sbjct: 400 GGGGYGGQGGAGGGYGGGGG 419 Score = 29.5 bits (63), Expect = 5.9 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXP--PPXXGGGGXGGGGG 368 GGG G P P GGGG GG GG Sbjct: 422 GGGAPGAPGAPGSPGGGGFGGQGG 445 Score = 29.5 bits (63), Expect = 5.9 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXP--PPXXGGGGXGGGGG 368 G G GG P P GGGG GG GG Sbjct: 482 GAGRGGAPGAPGSPGGGGFGGQGG 505 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG G P GGG GGG G Sbjct: 233 GGGYSGGPGGQGAGGGGGGGSG 254 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GGG GGGGG Sbjct: 256 GGGSGFGGGGAGGGSGGGGGG 276 >AE013599-540|AAF59169.1| 1327|Drosophila melanogaster CG8730-PA protein. Length = 1327 Score = 34.7 bits (76), Expect = 0.16 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 PP PPPP PPPPPP Sbjct: 4 PPLPPPPVQPAPPPPPPPP 22 Score = 29.5 bits (63), Expect = 5.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 332 PXPPPPXXPXXXPPXPP 382 P PPPP P PP PP Sbjct: 5 PLPPPPVQPAPPPPPPP 21 >AE013599-399|AAM68891.2| 409|Drosophila melanogaster CG11112-PB, isoform B protein. Length = 409 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP PPPPP Sbjct: 228 PPPPPPPPPP------PPPPP 242 Score = 34.7 bits (76), Expect = 0.16 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 228 PPPPPPPPP------PPPPPP 242 Score = 31.5 bits (68), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PPPP P P P Sbjct: 230 PPPPPPPPPPPPPTLSPSLP 249 Score = 30.3 bits (65), Expect = 3.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P P P Sbjct: 229 PPPPPPPPPPPPPPTLSPSLP 249 Score = 29.9 bits (64), Expect = 4.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXP 419 PPPPP PPPP P Sbjct: 233 PPPPPPPPPPTLSPSLP 249 Score = 29.1 bits (62), Expect = 7.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PPP P PPPPPP Sbjct: 213 PRPPPFYKPSRPNRRPPPPPPP 234 >DQ539309-1|ABG02830.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539308-1|ABG02829.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539307-1|ABG02828.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539306-1|ABG02827.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539305-1|ABG02826.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539304-1|ABG02825.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539303-1|ABG02824.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539302-1|ABG02823.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539301-1|ABG02822.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539300-1|ABG02821.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539299-1|ABG02820.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539298-1|ABG02819.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539297-1|ABG02818.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539296-1|ABG02817.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539295-1|ABG02816.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539294-1|ABG02815.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539293-1|ABG02814.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539292-1|ABG02813.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539291-1|ABG02812.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539290-1|ABG02811.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539289-1|ABG02810.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539288-1|ABG02809.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539287-1|ABG02808.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539286-1|ABG02807.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539285-1|ABG02806.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539284-1|ABG02805.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539283-1|ABG02804.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539282-1|ABG02803.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >DQ539281-1|ABG02802.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >BT030113-1|ABN49252.1| 342|Drosophila melanogaster IP06991p protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >BT011144-1|AAR82812.1| 356|Drosophila melanogaster GH24939p protein. Length = 356 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 287 GGGGGFKGGYGGGGGGGGGGG 307 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 228 GHGGGGFGPGGGGGGGFGPGGG 249 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 285 GHGGGGGFKGGYGGGGGGGGGG 306 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 238 GGGGGGFGPGGGGFGPGIGGGGG 260 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 287 GGGGGFKGGYGGGGGGGGGGGG 308 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 287 GGGGGFKGGYGGGGGGGGGGG 307 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 237 GGGGGGGFGPGGGGFGPGIGGG 258 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 230 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 275 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 256 GGGGGGFGPGIGGGSGGGHFGG 277 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 306 GGGGYGIGPAVSLGGGPGGGG 326 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 121 GGGGGFGGGPGFGSGGHSGGG 141 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 180 GGGIGGGGGHSGGGGGIGGGPG 201 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 227 GGHGGGGFGPGGGGGGGFGPGG 248 >BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p protein. Length = 478 Score = 34.3 bits (75), Expect = 0.21 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP G PPPPP Sbjct: 237 PRPPPPPPPAGGVLVMPPPPP 257 Score = 31.1 bits (67), Expect = 1.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 P PPP PPP PPPPP Sbjct: 237 PRPPPPPPPAGGVLVMPPPPP 257 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = +3 Query: 375 PPPXPPPPXXG---GGXPPPPPP 434 P P PPPP G PPPPPP Sbjct: 222 PSPTPPPPAGGVLVMPRPPPPPP 244 Score = 29.5 bits (63), Expect = 5.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P PPPP P Sbjct: 155 PPPPPLEEPEKCPLSPPPPPSP 176 >AM294881-1|CAL26867.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 57 GGGGGGGGSGGGGGGGSGSGGG 78 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 58 GGGGGGGSGGGGGGGSGSGGG 78 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GG Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGG 77 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSG 76 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGG G Sbjct: 59 GGGGGGSGGGGGGGSGSGGGSG 80 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 56 GGGGGGGGGSGGGGGGGSGSG 76 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GG G G GGG Sbjct: 66 GGGGGGGSGSGGGSGSGDGGG 86 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G G GGGG Sbjct: 66 GGGGGGGSGSGGGSGSGDGGGG 87 >AM294880-1|CAL26866.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 57 GGGGGGGGSGGGGGGGSGSGGG 78 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 58 GGGGGGGSGGGGGGGSGSGGG 78 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GG Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGG 77 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSG 76 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGG G Sbjct: 59 GGGGGGSGGGGGGGSGSGGGSG 80 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 56 GGGGGGGGGSGGGGGGGSGSG 76 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GG G G GGG Sbjct: 66 GGGGGGGSGSGGGSGSGDGGG 86 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G G GGGG Sbjct: 66 GGGGGGGSGSGGGSGSGDGGGG 87 >AM294879-1|CAL26865.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 57 GGGGGGGGSGGGGGGGSGSGGG 78 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 58 GGGGGGGSGGGGGGGSGSGGG 78 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GG Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGG 77 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSG 76 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGG G Sbjct: 59 GGGGGGSGGGGGGGSGSGGGSG 80 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 56 GGGGGGGGGSGGGGGGGSGSG 76 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GG G G GGG Sbjct: 66 GGGGGGGSGSGGGSGSGDGGG 86 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G G GGGG Sbjct: 66 GGGGGGGSGSGGGSGSGDGGGG 87 >AM294878-1|CAL26864.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 57 GGGGGGGGSGGGGGGGSGSGGG 78 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 58 GGGGGGGSGGGGGGGSGSGGG 78 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GG Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGG 77 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGG G Sbjct: 59 GGGGGGSGGGGGGGSGSGGGSG 80 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 56 GGGGGGGGGSGGGGGGGSGSG 76 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GG G G GGG Sbjct: 66 GGGGGGGSGSGGGSGSGDGGG 86 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G G GGGG Sbjct: 66 GGGGGGGSGSGGGSGSGDGGGG 87 >AM294877-1|CAL26863.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 57 GGGGGGGGSGGGGGGGSGSGGG 78 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 58 GGGGGGGSGGGGGGGSGSGGG 78 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GG Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGG 77 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGG G Sbjct: 59 GGGGGGSGGGGGGGSGSGGGSG 80 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 56 GGGGGGGGGSGGGGGGGSGSG 76 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GG G G GGG Sbjct: 66 GGGGGGGSGSGGGSGSGDGGG 86 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G G GGGG Sbjct: 66 GGGGGGGSGSGGGSGSGDGGGG 87 >AM294875-1|CAL26861.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 57 GGGGGGGGSGGGGGGGSGSGGG 78 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 58 GGGGGGGSGGGGGGGSGSGGG 78 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GG Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGG 77 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSG 76 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGG G Sbjct: 59 GGGGGGSGGGGGGGSGSGGGSG 80 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 56 GGGGGGGGGSGGGGGGGSGSG 76 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GG G G GGG Sbjct: 66 GGGGGGGSGSGGGSGSGDGGG 86 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G G GGGG Sbjct: 66 GGGGGGGSGSGGGSGSGDGGGG 87 >AM294874-1|CAL26860.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 57 GGGGGGGGSGGGGGGGSGSGGG 78 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 58 GGGGGGGSGGGGGGGSGSGGG 78 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GG Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGG 77 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSG 76 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGG G Sbjct: 59 GGGGGGSGGGGGGGSGSGGGSG 80 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 56 GGGGGGGGGSGGGGGGGSGSG 76 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GG G G GGG Sbjct: 66 GGGGGGGSGSGGGSGSGDGGG 86 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G G GGGG Sbjct: 66 GGGGGGGSGSGGGSGSGDGGGG 87 >AM294872-1|CAL26858.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 57 GGGGGGGGSGGGGGGGSGSGGG 78 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 58 GGGGGGGSGGGGGGGSGSGGG 78 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GG Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGG 77 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGG G Sbjct: 59 GGGGGGSGGGGGGGSGSGGGSG 80 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 56 GGGGGGGGGSGGGGGGGSGSG 76 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GG G G GGG Sbjct: 66 GGGGGGGSGSGGGSGSGDGGG 86 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G G GGGG Sbjct: 66 GGGGGGGSGSGGGSGSGDGGGG 87 >AE014298-1193|AAF46385.1| 679|Drosophila melanogaster CG33181-PA protein. Length = 679 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GG GG Sbjct: 200 GGGGGGIGGAGGGGGGGGGNGG 221 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGGGG Sbjct: 195 GGGGGGGGGGGIGGAGGGGGGG 216 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGGG Sbjct: 196 GGGGGGGGGGIGGAGGGGGGGG 217 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 197 GGGGGGGGGIGGAGGGGGGGGG 218 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 199 GGGGGGGIGGAGGGGGGGGGNG 220 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGGG Sbjct: 193 GGGGGGGGGGGGGIGGAGGGGG 214 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGGG Sbjct: 192 GGGGGGGGGGGGGGIGGAGGGG 213 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GG G G GGG Sbjct: 196 GGGGGGGGGGIGGAGGGGGGG 216 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G G GG G GGG Sbjct: 197 GGGGGGGGGIGGAGGGGGGGG 217 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGG 322 GG GG G GGGG G GG Sbjct: 199 GGGGGGGIGGAGGGGGGGGG 218 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 200 GGGGGGIGGAGGGGGGGGGNG 220 >AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-PA protein. Length = 460 Score = 34.3 bits (75), Expect = 0.21 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP G PPP PP Sbjct: 52 PPPPPSPPCGRPPPGSPPPGPP 73 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPXPPP---PXXGGGXPPPPPP 434 PPPPP PP P G P PPPP Sbjct: 51 PPPPPPSPPCGRPPPGSPPPGPPPP 75 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPP--PPP 434 P P PPPP G PPP PPP Sbjct: 48 PTRPPPPPPSPPCGRPPPGSPPP 70 >AE014134-1932|AAF52992.1| 342|Drosophila melanogaster CG17108-PA protein. Length = 342 Score = 34.3 bits (75), Expect = 0.21 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG P GGGG G GGG Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGG 235 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGGGG 368 GGGGGG P G G G GGGGG Sbjct: 224 GGGGGGFGPGGGGFGPGIGGGGG 246 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGG 293 Score = 31.5 bits (68), Expect = 1.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GGG Sbjct: 223 GGGGGGGFGPGGGGFGPGIGGG 244 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 216 GGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHF 261 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P GG G G GG Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGG 263 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G P GGG GGGG Sbjct: 292 GGGGYGIGPAVSLGGGPGGGG 312 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGG P G GG GGG Sbjct: 107 GGGGGFGGGPGFGSGGHSGGG 127 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 166 GGGIGGGGGHSGGGGGIGGGPG 187 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GGGG G GG Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGG 234 >AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA, isoform A protein. Length = 478 Score = 34.3 bits (75), Expect = 0.21 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP G PPPPP Sbjct: 237 PRPPPPPPPAGGVLVMPPPPP 257 Score = 31.1 bits (67), Expect = 1.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 P PPP PPP PPPPP Sbjct: 237 PRPPPPPPPAGGVLVMPPPPP 257 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = +3 Query: 375 PPPXPPPPXXG---GGXPPPPPP 434 P P PPPP G PPPPPP Sbjct: 222 PSPTPPPPAGGVLVMPRPPPPPP 244 Score = 29.5 bits (63), Expect = 5.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P PPPP P Sbjct: 155 PPPPPLEEPEKCPLSPPPPPSP 176 >AY113490-1|AAM29495.1| 158|Drosophila melanogaster RE47308p protein. Length = 158 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 92 GGGGGGGGGGGSGGGGRGGGSG 113 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G G GG G GGG Sbjct: 91 GGGGGGGGGGGGSGGGGRGGG 111 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 93 GGGGGGGGGGSGGGGRGGGSG 113 >AY075437-1|AAL68252.1| 155|Drosophila melanogaster LP09837p protein. Length = 155 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 56 GGGGGGSGGGGGGGGGAGGGSG 77 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 55 GGGGGGGSGGGGGGGGGAGGG 75 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGG Sbjct: 55 GGGGGGGSGGGGGGGGGAGGG 75 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG G GGG Sbjct: 55 GGGGGGGSGGGGGGGGGAGGG 75 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 57 GGGGGSGGGGGGGGGAGGGSG 77 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GG G G GGG Sbjct: 63 GGGGGGGGGAGGGSGSGEGGG 83 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG G G GGGG Sbjct: 64 GGGGGGGGAGGGSGSGEGGGG 84 >AL031583-7|CAB41346.1| 359|Drosophila melanogaster EG:34F3.10 protein. Length = 359 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPP P Sbjct: 169 PPPPPLPPPP------PPPPRP 184 Score = 31.5 bits (68), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PPPP P P P Sbjct: 169 PPPPPLPPPPPPPPRPTPIP 188 >AE014298-2787|AAF48900.2| 2030|Drosophila melanogaster CG32542-PA protein. Length = 2030 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 1280 GSGGGGNGGGGNGGGGGGGGGG 1301 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGGG Sbjct: 1282 GGGGNGGGGNGGGGGGGGGGGG 1303 Score = 31.9 bits (69), Expect = 1.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PP PP PP G PPPPP Sbjct: 1763 PPGPPMGPPQGYYGPPPPPPP 1783 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/21 (61%), Positives = 13/21 (61%), Gaps = 2/21 (9%) Frame = +3 Query: 378 PPXPP--PPXXGGGXPPPPPP 434 PP PP PP G PPPPPP Sbjct: 1763 PPGPPMGPPQGYYGPPPPPPP 1783 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 1282 GGGGNGGGGNGGGGGGGGGGG 1302 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGG 322 GG GG G GGGG G GG Sbjct: 1284 GGNGGGGNGGGGGGGGGGGG 1303 >AE014298-1899|AAF48264.2| 158|Drosophila melanogaster CG1987-PA protein. Length = 158 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 92 GGGGGGGGGGGSGGGGRGGGSG 113 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G G GG G GGG Sbjct: 91 GGGGGGGGGGGGSGGGGRGGG 111 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 93 GGGGGGGGGGSGGGGRGGGSG 113 >AE014298-111|AAF45553.2| 359|Drosophila melanogaster CG13358-PA protein. Length = 359 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPP P Sbjct: 169 PPPPPLPPPP------PPPPRP 184 Score = 31.5 bits (68), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PPPP P P P Sbjct: 169 PPPPPLPPPPPPPPRPTPIP 188 >AE014296-723|AAF47815.1| 155|Drosophila melanogaster CG10853-PA protein. Length = 155 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 56 GGGGGGSGGGGGGGGGAGGGSG 77 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 55 GGGGGGGSGGGGGGGGGAGGG 75 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGG Sbjct: 55 GGGGGGGSGGGGGGGGGAGGG 75 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG G GGG Sbjct: 55 GGGGGGGSGGGGGGGGGAGGG 75 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G G G Sbjct: 57 GGGGGSGGGGGGGGGAGGGSG 77 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GG G G GGG Sbjct: 63 GGGGGGGGGAGGGSGSGEGGG 83 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG G G GGGG Sbjct: 64 GGGGGGGGAGGGSGSGEGGGG 84 >AE013599-1122|AAF58779.3| 757|Drosophila melanogaster CG12052-PJ, isoform J protein. Length = 757 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 680 GGAGGGIGGGGSGGGGGGGGGG 701 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GGGG GGGGG Sbjct: 676 GGGSGGAGGGIGGGGSGGGGG 696 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGG GGGGG Sbjct: 676 GGGSGGAGGGIGGGGSGGGGGG 697 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 676 GGGSGGAGGGIGGGGSGGGGG 696 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 677 GGSGGAGGGIGGGGSGGGGGG 697 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 680 GGAGGGIGGGGSGGGGGGGGG 700 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 681 GAGGGIGGGGSGGGGGGGGGG 701 >AB107346-1|BAC67651.1| 757|Drosophila melanogaster Lola protein isoform O protein. Length = 757 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 680 GGAGGGIGGGGSGGGGGGGGGG 701 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GGGG GGGGG Sbjct: 676 GGGSGGAGGGIGGGGSGGGGG 696 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGG GGGGG Sbjct: 676 GGGSGGAGGGIGGGGSGGGGGG 697 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 676 GGGSGGAGGGIGGGGSGGGGG 696 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 677 GGSGGAGGGIGGGGSGGGGGG 697 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 680 GGAGGGIGGGGSGGGGGGGGG 700 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 681 GAGGGIGGGGSGGGGGGGGGG 701 >AB107326-1|BAC67631.1| 757|Drosophila melanogaster Lola protein isoform O protein. Length = 757 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 680 GGAGGGIGGGGSGGGGGGGGGG 701 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GGGG GGGGG Sbjct: 676 GGGSGGAGGGIGGGGSGGGGG 696 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGG GGGGG Sbjct: 676 GGGSGGAGGGIGGGGSGGGGGG 697 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 676 GGGSGGAGGGIGGGGSGGGGG 696 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 677 GGSGGAGGGIGGGGSGGGGGG 697 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 680 GGAGGGIGGGGSGGGGGGGGG 700 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 681 GAGGGIGGGGSGGGGGGGGGG 701 >AB107306-1|BAC67611.1| 757|Drosophila melanogaster Lola protein isoform O protein. Length = 757 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 680 GGAGGGIGGGGSGGGGGGGGGG 701 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GGGG GGGGG Sbjct: 676 GGGSGGAGGGIGGGGSGGGGG 696 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGG GGGGG Sbjct: 676 GGGSGGAGGGIGGGGSGGGGGG 697 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 676 GGGSGGAGGGIGGGGSGGGGG 696 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 677 GGSGGAGGGIGGGGSGGGGGG 697 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 680 GGAGGGIGGGGSGGGGGGGGG 700 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 681 GAGGGIGGGGSGGGGGGGGGG 701 >AB107286-1|BAC67591.1| 757|Drosophila melanogaster Lola protein isoform O protein. Length = 757 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 680 GGAGGGIGGGGSGGGGGGGGGG 701 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GGGG GGGGG Sbjct: 676 GGGSGGAGGGIGGGGSGGGGG 696 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGG GGGGG Sbjct: 676 GGGSGGAGGGIGGGGSGGGGGG 697 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 676 GGGSGGAGGGIGGGGSGGGGG 696 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 677 GGSGGAGGGIGGGGSGGGGGG 697 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 680 GGAGGGIGGGGSGGGGGGGGG 700 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 681 GAGGGIGGGGSGGGGGGGGGG 701 >BT010114-1|AAQ22583.1| 515|Drosophila melanogaster GH02426p protein. Length = 515 Score = 33.5 bits (73), Expect = 0.36 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPP 422 PPPPP PPPP G PP Sbjct: 395 PPPPPPPPPPMPGKLFPP 412 Score = 32.7 bits (71), Expect = 0.63 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPP 425 PPPPP PPPP G PP Sbjct: 394 PPPPPPPPPPPMPGKLFPP 412 >AY119067-1|AAM50927.1| 217|Drosophila melanogaster LP08165p protein. Length = 217 Score = 33.5 bits (73), Expect = 0.36 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PPPP PPPPP Sbjct: 98 PPPPPPPPPAPA---PPPPP 114 Score = 29.5 bits (63), Expect = 5.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 332 PXPPPPXXPXXXPPXPP 382 P PPPP P PP PP Sbjct: 98 PPPPPPPPPAPAPPPPP 114 >AY118596-1|AAM49965.1| 165|Drosophila melanogaster LD48005p protein. Length = 165 Score = 33.5 bits (73), Expect = 0.36 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG P GGGG GGGGG Sbjct: 23 GGGGG--PGGVGGGGGGGGGG 41 >AY118420-1|AAM48449.1| 250|Drosophila melanogaster RE74758p protein. Length = 250 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 87 GGGGGSGWTAGGGGGHGGGGG 107 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GGGGG Sbjct: 87 GGGGGSGWTAGGGGGHGGGGGG 108 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 87 GGGGGSGWTAGGGGGHGGGGG 107 >AY075371-1|AAL68216.1| 165|Drosophila melanogaster GM14667p protein. Length = 165 Score = 33.5 bits (73), Expect = 0.36 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG P GGGG GGGGG Sbjct: 23 GGGGG--PGGVGGGGGGGGGG 41 >AE014297-3395|AAX52972.1| 515|Drosophila melanogaster CG33111-PC, isoform C protein. Length = 515 Score = 33.5 bits (73), Expect = 0.36 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPP 422 PPPPP PPPP G PP Sbjct: 395 PPPPPPPPPPMPGKLFPP 412 Score = 32.7 bits (71), Expect = 0.63 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPP 425 PPPPP PPPP G PP Sbjct: 394 PPPPPPPPPPPMPGKLFPP 412 >AE014297-3394|AAS65199.1| 515|Drosophila melanogaster CG33111-PB, isoform B protein. Length = 515 Score = 33.5 bits (73), Expect = 0.36 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPP 422 PPPPP PPPP G PP Sbjct: 395 PPPPPPPPPPMPGKLFPP 412 Score = 32.7 bits (71), Expect = 0.63 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPP 425 PPPPP PPPP G PP Sbjct: 394 PPPPPPPPPPPMPGKLFPP 412 >AE014297-3393|AAF56193.2| 515|Drosophila melanogaster CG33111-PA, isoform A protein. Length = 515 Score = 33.5 bits (73), Expect = 0.36 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPP 422 PPPPP PPPP G PP Sbjct: 395 PPPPPPPPPPMPGKLFPP 412 Score = 32.7 bits (71), Expect = 0.63 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPP 425 PPPPP PPPP G PP Sbjct: 394 PPPPPPPPPPPMPGKLFPP 412 >AE014296-1850|AAF50135.2| 250|Drosophila melanogaster CG12523-PA protein. Length = 250 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 87 GGGGGSGWTAGGGGGHGGGGG 107 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GGGGG Sbjct: 87 GGGGGSGWTAGGGGGHGGGGGG 108 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 87 GGGGGSGWTAGGGGGHGGGGG 107 >AE013599-3513|AAN16117.1| 165|Drosophila melanogaster CG3800-PA protein. Length = 165 Score = 33.5 bits (73), Expect = 0.36 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG P GGGG GGGGG Sbjct: 23 GGGGG--PGGVGGGGGGGGGG 41 >X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. Length = 239 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 18 GGGGGGRGFGGGGGGRGGGGG 38 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGGG Sbjct: 215 GGGGGGGFNRGRGGGGGGGGG 235 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 216 GGGGGGFNRGRGGGGGGGGGRG 237 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 27 GGGGGGR----GGGGGRGGGGG 44 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGGG Sbjct: 213 GGGGGGGGGFNRGRGGGGGGGG 234 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 214 GGGGGGGGFNRGRGGGGGGGGG 235 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 8 GGGGGGGRGFGGGGGGRGFGGG 29 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXGGG-GXGGGGG 368 GGGGGG GGG G GGGGG Sbjct: 9 GGGGGGRGFGGGGGGRGFGGGGG 31 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGG GGGG Sbjct: 173 GGGGGGFGGRGGRGGGRGGGG 193 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGG GGGG Sbjct: 18 GGGGGGRGFGGGGGGRGGGGG 38 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 25 GFGGGGGGRGGGGGRGGGGG 44 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG G GGG Sbjct: 29 GGGGRGGGGGRGGGGGFGRGGG 50 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGG Sbjct: 183 GGRGGGRGGGGRGGGGGRGGGG 204 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GG G GGGG GGGGG Sbjct: 178 GFGGRGGRGGGRGGGGRGGGGG 199 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 30 GGGRGGGGGRGGGGGFGRGGG 50 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 36 GGGRGGGGGFGRGGGGRGGGRG 57 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G G GGG Sbjct: 171 GGGGGGGGFGGRGGRGGGRGGG 192 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGG Sbjct: 172 GGGGGGGFGGRGGRGGGRGGGG 193 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 183 GGRGGGRGGGGRGGGGGRGGG 203 >U02042-1|AAA19249.1| 606|Drosophila melanogaster GABA receptor protein. Length = 606 Score = 33.1 bits (72), Expect = 0.48 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G G GG PP GGGG GGGGG Sbjct: 510 GPGQGGGPP--GGGGGGGGGGG 529 >M69057-3|AAA28558.1| 595|Drosophila melanogaster GABA-alpha receptor protein. Length = 595 Score = 33.1 bits (72), Expect = 0.48 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G G GG PP GGGG GGGGG Sbjct: 499 GPGQGGGPP--GGGGGGGGGGG 518 >M69057-2|AAA28557.1| 601|Drosophila melanogaster GABA-alpha receptor protein. Length = 601 Score = 33.1 bits (72), Expect = 0.48 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G G GG PP GGGG GGGGG Sbjct: 505 GPGQGGGPP--GGGGGGGGGGG 524 >M69057-1|AAA28556.1| 606|Drosophila melanogaster GABA-alpha receptor protein. Length = 606 Score = 33.1 bits (72), Expect = 0.48 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G G GG PP GGGG GGGGG Sbjct: 510 GPGQGGGPP--GGGGGGGGGGG 529 >BT015282-1|AAT94511.1| 1250|Drosophila melanogaster LD04601p protein. Length = 1250 Score = 33.1 bits (72), Expect = 0.48 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG P P GG G G G G Sbjct: 770 GGGGGPGPGPGGGGSGRGAGSG 791 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGG G Sbjct: 816 GGGGSGGWGSGTGGGGLGGGKG 837 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 G G G GGGG GGGGG Sbjct: 787 GAGSGGWSSGPGGGGSGGGGG 807 >BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p protein. Length = 145 Score = 33.1 bits (72), Expect = 0.48 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PPP P Sbjct: 42 PPPPPPPPPAPKNTYIPPPAAP 63 Score = 33.1 bits (72), Expect = 0.48 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PP P P Sbjct: 69 PPPPPPPPPAPKNTYIPPAPAP 90 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 730 PPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 PPPP P A P PPPPPP Sbjct: 45 PPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPP 76 Score = 29.9 bits (64), Expect = 4.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 P P PP P PPPPPP Sbjct: 29 PQPAPPAPVKSYIPPPPPPP 48 Score = 29.9 bits (64), Expect = 4.4 Identities = 16/58 (27%), Positives = 16/58 (27%) Frame = +2 Query: 206 PNPVNPXLGXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPPPXPXPPPPXXPXXXPPXP 379 P P P PPP PPP P PPP PP P Sbjct: 31 PAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIPPAP 88 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 730 PPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 PPPP P A A PPPPPP Sbjct: 43 PPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPP 74 >BT011110-1|AAR82777.1| 1777|Drosophila melanogaster LD32107p protein. Length = 1777 Score = 33.1 bits (72), Expect = 0.48 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P P PPPPPP Sbjct: 1282 PPPPLPLTPPAAPPPPPPPPP 1302 Score = 29.9 bits (64), Expect = 4.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 P P PP P PPPPPP Sbjct: 1280 PVPPPPLPLTPPAAPPPPPP 1299 >AY094731-1|AAM11084.1| 708|Drosophila melanogaster GH25793p protein. Length = 708 Score = 33.1 bits (72), Expect = 0.48 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPP 428 PPPP PPPP G PPPP Sbjct: 4 PPPPGPPPPP---GPPPPP 19 Score = 31.9 bits (69), Expect = 1.1 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 369 PPPPPXPPPPXXGGG 413 PPPPP PPPP GG Sbjct: 9 PPPPPGPPPPPAMGG 23 >AY052130-1|AAK93554.1| 455|Drosophila melanogaster SD08037p protein. Length = 455 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGGG Sbjct: 350 GGGGGGGFGGGRGGGGGGGGG 370 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 340 GGGGNFRGGRGGGGGGGFGGG 360 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GG G GGGGG Sbjct: 347 GGRGGGGGGGFGGGRGGGGGGG 368 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGG 322 GG GG G GGGG G GG Sbjct: 351 GGGGGGFGGGRGGGGGGGGG 370 Score = 29.5 bits (63), Expect = 5.9 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGGG Sbjct: 351 GGGGGGF---GGGRGGGGGGGG 369 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 347 GGRGGGGGGGFGGGRGGGGGG 367 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 350 GGGGGGGFGGGRGGGGGGGGG 370 >AY052129-1|AAK93553.1| 1601|Drosophila melanogaster SD07967p protein. Length = 1601 Score = 33.1 bits (72), Expect = 0.48 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP PP G PPPPPP Sbjct: 1372 PPPSNYPPMDDPNGDFPPPPPP 1393 >AF299248-1|AAG22814.1| 2836|Drosophila melanogaster talin protein. Length = 2836 Score = 33.1 bits (72), Expect = 0.48 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP PP G PPPPPP Sbjct: 2607 PPPSNYPPMDDPNGDFPPPPPP 2628 >AF255733-1|AAF71288.1| 1250|Drosophila melanogaster DNA topoisomerase III alpha protein. Length = 1250 Score = 33.1 bits (72), Expect = 0.48 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG P P GG G G G G Sbjct: 770 GGGGGPGPGPGGGGSGRGAGSG 791 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGG G Sbjct: 816 GGGGSGGWGSGTGGGGLGGGKG 837 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 G G G GGGG GGGGG Sbjct: 787 GAGSGGWSSGPGGGGSGGGGG 807 >AE014298-2877|AAF48974.1| 348|Drosophila melanogaster CG14218-PA protein. Length = 348 Score = 33.1 bits (72), Expect = 0.48 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP P P P Sbjct: 170 PPPPPPPPPPPTAPPRPRPRP 190 Score = 31.5 bits (68), Expect = 1.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP P P P Sbjct: 171 PPPPPPPPPPTAPPRPRPRPRP 192 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PPPP P P P Sbjct: 171 PPPPPPPPPPTAPPRPRPRP 190 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 718 PXXXPPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 P PPP P A P PPPPPP Sbjct: 143 PTTLAPPPPPNYDYDYDYDAQPAAPAEPPPPPPPPP 178 Score = 29.5 bits (63), Expect = 5.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP P P P Sbjct: 170 PPPPPPPPPPPTAPPRPRPRP 190 >AE014298-1311|AAF46472.2| 1837|Drosophila melanogaster CG12124-PA protein. Length = 1837 Score = 33.1 bits (72), Expect = 0.48 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P P PPPPPP Sbjct: 1342 PPPPLPLTPPAAPPPPPPPPP 1362 Score = 29.9 bits (64), Expect = 4.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 P P PP P PPPPPP Sbjct: 1340 PVPPPPLPLTPPAAPPPPPP 1359 >AE014298-1168|AAF46366.1| 926|Drosophila melanogaster CG10555-PA protein. Length = 926 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPPPXPP--PPXXGGGXPPPPPP 434 PPP P PP PP G PPP PP Sbjct: 555 PPPGPPPPGQPPTGGQQQPPPGPP 578 >AE014297-3872|AAF56525.1| 454|Drosophila melanogaster CG5913-PA protein. Length = 454 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGGG Sbjct: 350 GGGGGGGFGGGRGGGGGGGGG 370 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 340 GGGGNFRGGRGGGGGGGFGGG 360 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GG G GGGGG Sbjct: 347 GGRGGGGGGGFGGGRGGGGGGG 368 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGG 322 GG GG G GGGG G GG Sbjct: 351 GGGGGGFGGGRGGGGGGGGG 370 Score = 29.5 bits (63), Expect = 5.9 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGGG Sbjct: 351 GGGGGGF---GGGRGGGGGGGG 369 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 347 GGRGGGGGGGFGGGRGGGGGG 367 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 350 GGGGGGGFGGGRGGGGGGGGG 370 >AE014296-3444|AAF51657.1| 98|Drosophila melanogaster CG11458-PA protein. Length = 98 Score = 33.1 bits (72), Expect = 0.48 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGG Sbjct: 63 GGGGGGKHGGGNGGGGKHGGGG 84 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGG GG GGGG GGGG Sbjct: 71 GGGNGGGGKHGGGGGGGGGGG 91 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GGGG GGGGG Sbjct: 71 GGGNGGGGKHGGGGGGGGGGG 91 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG GGGGG Sbjct: 23 GGGGGGGQGGWQKNGGGGGGGG 44 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGG GGGG Sbjct: 38 GGGGGGGQGGWQKGGGGGGGG 58 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGG Sbjct: 53 GGGGGGKHGGGGGGGGKHGGG 73 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG GGGGG Sbjct: 37 GGGGGGGGQGGWQKGGGGGGGG 58 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GG Sbjct: 51 GGGGGGGGKHGGGGGGGGKHGG 72 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG Sbjct: 52 GGGGGGGKHGGGGGGGGKHGGG 73 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GG GG Sbjct: 26 GGGGQGGWQKNGGGGGGGGQGG 47 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGG G Sbjct: 25 GGGGGQGGWQKNGGGGGGGGQG 46 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 43 GGQGGWQKGGGGGGGGKHGGG 63 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 53 GGGGGGKHGGGGGGGGKHGGG 73 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 64 GGGGGKHGGGNGGGGKHGGGG 84 >AE014296-1598|AAN11989.1| 585|Drosophila melanogaster CG10537-PB, isoform B protein. Length = 585 Score = 33.1 bits (72), Expect = 0.48 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G G GG PP GGGG GGGGG Sbjct: 489 GPGQGGGPP--GGGGGGGGGGG 508 >AE014296-1597|AAF50311.1| 606|Drosophila melanogaster CG10537-PA, isoform A protein. Length = 606 Score = 33.1 bits (72), Expect = 0.48 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G G GG PP GGGG GGGGG Sbjct: 510 GPGQGGGPP--GGGGGGGGGGG 529 >AE014296-1596|AAN11988.1| 606|Drosophila melanogaster CG10537-PC, isoform C protein. Length = 606 Score = 33.1 bits (72), Expect = 0.48 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G G GG PP GGGG GGGGG Sbjct: 510 GPGQGGGPP--GGGGGGGGGGG 529 >AE014296-1476|AAF50399.1| 2836|Drosophila melanogaster CG6831-PA protein. Length = 2836 Score = 33.1 bits (72), Expect = 0.48 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP PP G PPPPPP Sbjct: 2607 PPPSNYPPMDDPNGDFPPPPPP 2628 >AE014134-3114|AAF53813.2| 1250|Drosophila melanogaster CG10123-PA protein. Length = 1250 Score = 33.1 bits (72), Expect = 0.48 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG P P GG G G G G Sbjct: 770 GGGGGPGPGPGGGGSGRGAGSG 791 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGG G Sbjct: 816 GGGGSGGWGSGTGGGGLGGGKG 837 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 G G G GGGG GGGGG Sbjct: 787 GAGSGGWSSGPGGGGSGGGGG 807 >AE013599-3336|AAM68207.1| 751|Drosophila melanogaster CG13503-PD, isoform D protein. Length = 751 Score = 33.1 bits (72), Expect = 0.48 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPP 428 PPPP PPPP G PPPP Sbjct: 4 PPPPGPPPPP---GPPPPP 19 Score = 31.9 bits (69), Expect = 1.1 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 369 PPPPPXPPPPXXGGG 413 PPPPP PPPP GG Sbjct: 9 PPPPPGPPPPPAMGG 23 >AE013599-3335|AAM68206.1| 751|Drosophila melanogaster CG13503-PC, isoform C protein. Length = 751 Score = 33.1 bits (72), Expect = 0.48 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPP 428 PPPP PPPP G PPPP Sbjct: 4 PPPPGPPPPP---GPPPPP 19 Score = 31.9 bits (69), Expect = 1.1 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 369 PPPPPXPPPPXXGGG 413 PPPPP PPPP GG Sbjct: 9 PPPPPGPPPPPAMGG 23 >AE013599-3334|AAM68205.1| 751|Drosophila melanogaster CG13503-PB, isoform B protein. Length = 751 Score = 33.1 bits (72), Expect = 0.48 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPP 428 PPPP PPPP G PPPP Sbjct: 4 PPPPGPPPPP---GPPPPP 19 Score = 31.9 bits (69), Expect = 1.1 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 369 PPPPPXPPPPXXGGG 413 PPPPP PPPP GG Sbjct: 9 PPPPPGPPPPPAMGG 23 >AE013599-3333|AAF46800.2| 751|Drosophila melanogaster CG13503-PA, isoform A protein. Length = 751 Score = 33.1 bits (72), Expect = 0.48 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPP 428 PPPP PPPP G PPPP Sbjct: 4 PPPPGPPPPP---GPPPPP 19 Score = 31.9 bits (69), Expect = 1.1 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 369 PPPPPXPPPPXXGGG 413 PPPPP PPPP GG Sbjct: 9 PPPPPGPPPPPAMGG 23 >AE013599-3332|AAM68204.1| 708|Drosophila melanogaster CG13503-PF, isoform F protein. Length = 708 Score = 33.1 bits (72), Expect = 0.48 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPP 428 PPPP PPPP G PPPP Sbjct: 4 PPPPGPPPPP---GPPPPP 19 Score = 31.9 bits (69), Expect = 1.1 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 369 PPPPPXPPPPXXGGG 413 PPPPP PPPP GG Sbjct: 9 PPPPPGPPPPPAMGG 23 >AE013599-3331|AAM68208.2| 761|Drosophila melanogaster CG13503-PE, isoform E protein. Length = 761 Score = 33.1 bits (72), Expect = 0.48 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPP 428 PPPP PPPP G PPPP Sbjct: 14 PPPPGPPPPP---GPPPPP 29 Score = 31.9 bits (69), Expect = 1.1 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 369 PPPPPXPPPPXXGGG 413 PPPPP PPPP GG Sbjct: 19 PPPPPGPPPPPAMGG 33 >AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-PA protein. Length = 145 Score = 33.1 bits (72), Expect = 0.48 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PPP P Sbjct: 42 PPPPPPPPPAPKNTYIPPPAAP 63 Score = 33.1 bits (72), Expect = 0.48 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PP P P Sbjct: 69 PPPPPPPPPAPKNTYIPPAPAP 90 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 730 PPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 PPPP P A P PPPPPP Sbjct: 45 PPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPP 76 Score = 29.9 bits (64), Expect = 4.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 P P PP P PPPPPP Sbjct: 29 PQPAPPAPVKSYIPPPPPPP 48 Score = 29.9 bits (64), Expect = 4.4 Identities = 16/58 (27%), Positives = 16/58 (27%) Frame = +2 Query: 206 PNPVNPXLGXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPPPXPXPPPPXXPXXXPPXP 379 P P P PPP PPP P PPP PP P Sbjct: 31 PAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIPPAP 88 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 730 PPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 PPPP P A A PPPPPP Sbjct: 43 PPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPP 74 >U33427-1|AAA96257.1| 949|Drosophila melanogaster bHLH-PAS protein protein. Length = 949 Score = 32.7 bits (71), Expect = 0.63 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGG Sbjct: 235 GGGGGGGSSSSGGGGGGAGGG 255 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG G GGG Sbjct: 235 GGGGGGGSSSSGGGGGGAGGG 255 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 235 GGGGGGGSSSSGGGGGGAGGG 255 >BT023949-1|ABB36453.1| 1312|Drosophila melanogaster IP03879p protein. Length = 1312 Score = 32.7 bits (71), Expect = 0.63 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PP PPP Sbjct: 341 PPPPPPPPPDSRS---PPSPPP 359 >AY122174-1|AAM52686.1| 877|Drosophila melanogaster LD34142p protein. Length = 877 Score = 32.7 bits (71), Expect = 0.63 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 G G G PPP GGGG GGG Sbjct: 144 GPGPGPGPPPHYGGGGGGGG 163 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GG G G PP GGG GGGG Sbjct: 143 GGPGPGPGPPPHYGGGGGGGG 163 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Frame = +3 Query: 369 PP--PPPXPPPPXXGGGXPPPPP 431 PP PPP P GGG PPPP Sbjct: 181 PPGGPPPTQQPGGAGGGGGPPPP 203 Score = 29.5 bits (63), Expect(2) = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +3 Query: 369 PPPPPX---PPPPXXGGGXPPPPP 431 P PPP P P GG PPPPP Sbjct: 272 PLPPPLNANPSLPLRGGSVPPPPP 295 Score = 21.0 bits (42), Expect(2) = 1.1 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 405 GGGXPPPPPP 434 G G PPPPP Sbjct: 332 GPGPGPPPPP 341 >AY094911-1|AAM11264.1| 902|Drosophila melanogaster RH17284p protein. Length = 902 Score = 32.7 bits (71), Expect = 0.63 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGG Sbjct: 217 GGGGGGGSSSSGGGGGGAGGG 237 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG G GGG Sbjct: 217 GGGGGGGSSSSGGGGGGAGGG 237 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 217 GGGGGGGSSSSGGGGGGAGGG 237 >AE014298-2781|AAF48895.2| 1868|Drosophila melanogaster CG7282-PA protein. Length = 1868 Score = 32.7 bits (71), Expect = 0.63 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 158 GGGGGGG---GGGGGGGGGGGG 176 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 G GGGG GGGG GGGG Sbjct: 156 GSGGGGGGGGGGGGGGGGGGG 176 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 156 GSGGGGGGGGGGGGGGGGGGG 176 >AE014298-2334|AAF48566.2| 1311|Drosophila melanogaster CG32577-PA protein. Length = 1311 Score = 32.7 bits (71), Expect = 0.63 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PP PPP Sbjct: 340 PPPPPPPPPDSRS---PPSPPP 358 >AE014296-2433|AAF49702.1| 2061|Drosophila melanogaster CG9425-PA, isoform A protein. Length = 2061 Score = 32.7 bits (71), Expect = 0.63 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 G G G PPP GGGG GGG Sbjct: 1328 GPGPGPGPPPHYGGGGGGGG 1347 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GG G G PP GGG GGGG Sbjct: 1327 GGPGPGPGPPPHYGGGGGGGG 1347 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Frame = +3 Query: 369 PP--PPPXPPPPXXGGGXPPPPP 431 PP PPP P GGG PPPP Sbjct: 1365 PPGGPPPTQQPGGAGGGGGPPPP 1387 Score = 29.5 bits (63), Expect(2) = 1.0 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +3 Query: 369 PPPPPX---PPPPXXGGGXPPPPP 431 P PPP P P GG PPPPP Sbjct: 1456 PLPPPLNANPSLPLRGGSVPPPPP 1479 Score = 21.0 bits (42), Expect(2) = 1.0 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 405 GGGXPPPPPP 434 G G PPPPP Sbjct: 1516 GPGPGPPPPP 1525 >AE014296-2432|AAS65008.1| 2103|Drosophila melanogaster CG9425-PB, isoform B protein. Length = 2103 Score = 32.7 bits (71), Expect = 0.63 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 G G G PPP GGGG GGG Sbjct: 1370 GPGPGPGPPPHYGGGGGGGG 1389 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GG G G PP GGG GGGG Sbjct: 1369 GGPGPGPGPPPHYGGGGGGGG 1389 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Frame = +3 Query: 369 PP--PPPXPPPPXXGGGXPPPPP 431 PP PPP P GGG PPPP Sbjct: 1407 PPGGPPPTQQPGGAGGGGGPPPP 1429 Score = 29.5 bits (63), Expect(2) = 1.0 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +3 Query: 369 PPPPPX---PPPPXXGGGXPPPPP 431 P PPP P P GG PPPPP Sbjct: 1498 PLPPPLNANPSLPLRGGSVPPPPP 1521 Score = 21.0 bits (42), Expect(2) = 1.0 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 405 GGGXPPPPPP 434 G G PPPPP Sbjct: 1558 GPGPGPPPPP 1567 >AE014296-101|AAF47386.1| 958|Drosophila melanogaster CG6883-PA, isoform A protein. Length = 958 Score = 32.7 bits (71), Expect = 0.63 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGG Sbjct: 244 GGGGGGGSSSSGGGGGGAGGG 264 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG G GGG Sbjct: 244 GGGGGGGSSSSGGGGGGAGGG 264 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 244 GGGGGGGSSSSGGGGGGAGGG 264 >AE014296-100|ABI31226.1| 929|Drosophila melanogaster CG6883-PB, isoform B protein. Length = 929 Score = 32.7 bits (71), Expect = 0.63 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGG Sbjct: 244 GGGGGGGSSSSGGGGGGAGGG 264 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG G GGG Sbjct: 244 GGGGGGGSSSSGGGGGGAGGG 264 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 244 GGGGGGGSSSSGGGGGGAGGG 264 >AE014134-1928|AAF52988.1| 96|Drosophila melanogaster CG17107-PA protein. Length = 96 Score = 32.7 bits (71), Expect = 0.63 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GG GG Sbjct: 29 GGGGGGGRGGGGGGGGVGGVGG 50 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 22 GGFGGFGGGGGGGGRGGGGGG 42 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GG G Sbjct: 28 GGGGGGGGRGGGGGGGGVGGVG 49 >X73134-1|CAA51651.1| 127|Drosophila melanogaster GCR 20 protein. Length = 127 Score = 32.3 bits (70), Expect = 0.83 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXFXFXPKXGFTGFG 205 GG GG G GG G G GGG GGG F P GF G G Sbjct: 54 GGPGGGFGGPGGGFG-GQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGGPG 111 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P G GG GGG G Sbjct: 54 GGPGGGFGGPGGGFGGQGGGFG 75 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P G GG GGG G Sbjct: 68 GGQGGGFGGPGGGFGGQGGGFG 89 >X71976-1|CAA50796.1| 188|Drosophila melanogaster GCR 1 protein protein. Length = 188 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 39 GGFGGGFGGGLGGGGGGGGGG 59 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGGG Sbjct: 38 GGGFGGGFGGGLGGGGGGGGGG 59 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGG--GGXGGGGG 368 GGGGGG GG GG GGGGG Sbjct: 31 GGGGGGFGGGFGGGFGGGLGGGGG 54 >X55902-1|CAA39395.1| 700|Drosophila melanogaster Bj6 protein protein. Length = 700 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 242 GGAGGAMNSTNMGGGGGGGGGG 263 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGG GGGGG Sbjct: 241 GGGAGGAMNSTNMGGGGGGGGG 262 >M33496-2|AAA03215.1| 698|Drosophila melanogaster protein ( D.melanogaster no-on-transient A gene product, complete cds. ). Length = 698 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 242 GGAGGAMNSTNMGGGGGGGGGG 263 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGG GGGGG Sbjct: 241 GGGAGGAMNSTNMGGGGGGGGG 262 >M33496-1|AAA03214.1| 700|Drosophila melanogaster protein ( D.melanogaster no-on-transient A gene product, complete cds. ). Length = 700 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 242 GGAGGAMNSTNMGGGGGGGGGG 263 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGG GGGGG Sbjct: 241 GGGAGGAMNSTNMGGGGGGGGG 262 >D21203-1|BAA04745.2| 1408|Drosophila melanogaster large Forked protein protein. Length = 1408 Score = 32.3 bits (70), Expect = 0.83 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PP P PPPP G PP PP Sbjct: 1051 PPLPPPPPPLPHGMLPPQPP 1070 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 1051 PPLPPPPPPLPHGMLPPQPP 1070 >D17528-1|BAA04479.1| 604|Drosophila melanogaster small forked protein protein. Length = 604 Score = 32.3 bits (70), Expect = 0.83 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PP P PPPP G PP PP Sbjct: 250 PPLPPPPPPLPHGMLPPQPP 269 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 250 PPLPPPPPPLPHGMLPPQPP 269 >BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p protein. Length = 286 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 76 GGGGGFSSGVGGGGGGGFGGG 96 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G G GGG Sbjct: 87 GGGGGGFGGGFGGGSGGGSGGG 108 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG G GGG Sbjct: 76 GGGGGFSSGVGGGGGGGFGGG 96 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GG GG Sbjct: 86 GGGGGGGFGGGFGGGSGGGSGG 107 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GG GGG GGGG GGGG Sbjct: 107 GGFGGGGSIGGFGGGGGGGGG 127 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 58 GGFGGGFGGGSGGGGFSSGGG 78 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GG G G GGG Sbjct: 88 GGGGGFGGGFGGGSGGGSGGG 108 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGG GGGGG Sbjct: 106 GGGFGGGGSIGGFGGGGGGGGG 127 >BT024335-1|ABC86397.1| 257|Drosophila melanogaster IP09958p protein. Length = 257 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 92 GGGGGGGGGGGGGGGSGAGGG 112 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGG Sbjct: 92 GGGGGGGGGGGGGGGSGAGGGG 113 >BT023944-1|ABB36448.1| 834|Drosophila melanogaster LD32364p protein. Length = 834 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG G GGG Sbjct: 55 GGGGGGGSAGGGGGGSGNGGG 75 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGG GGG Sbjct: 55 GGGGGGGSAGGGGGGSGNGGG 75 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 55 GGGGGGGSAGGGGGGSGNGGG 75 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG G GG Sbjct: 53 GAGGGGGGGSAGGGGGGSGNGG 74 >BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p protein. Length = 538 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 166 GGPGGQGAGGGGGGGSGYGGG 186 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 196 GGSGGGGGGAGGGGGYGSGGG 216 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 268 GGQGGAGGGYGGGGGGGRGGG 288 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGG GGGG GGGGG Sbjct: 190 GGGGAGGGSGGGGGGAGGGGG 210 Score = 31.9 bits (69), Expect = 1.1 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXP--PPXXGGGGXGGGGG 368 G GGGG P P GGGG GG GG Sbjct: 284 GRGGGGAPGAPGSPGGGGFGGQGG 307 Score = 31.9 bits (69), Expect = 1.1 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXP--PPXXGGGGXGGGGG 368 GGG GG P P GGGG GG GG Sbjct: 314 GGGRGGAPGAPGSPGGGGYGGQGG 337 Score = 31.9 bits (69), Expect = 1.1 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXP--PPXXGGGGXGGGGG 368 GGG GG P P GGGG GG GG Sbjct: 380 GGGRGGAPGAPGSPGGGGFGGQGG 403 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG G GGG Sbjct: 195 GGGSGGGGGGAGGGGGYGSGGG 216 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGG Sbjct: 188 GFGGGGAGGGSGGGGGGAGGGG 209 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGG GGGG GGGGG Sbjct: 295 GSPGGGGFGGQGGGGGFGGGGG 316 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGG 322 GG GG G GGGG G GG Sbjct: 333 GGQGGAGGGYGGGGGRGGGG 352 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGG GGGG GGGGG Sbjct: 361 GSPGGGGFGGQGGGGGFGGGGG 382 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGG 371 GGGGG GG G GGGG Sbjct: 174 GGGGGGGSGYGGGSGFGGGG 193 Score = 29.5 bits (63), Expect = 5.9 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXF 241 G GG G GGGG G GGG GGG F Sbjct: 188 GFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGF 234 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G GGG GGGG Sbjct: 190 GGGGAGGGSGGGGGGAGGGGG 210 Score = 29.5 bits (63), Expect = 5.9 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXP--PPXXGGGGXGGGGG 368 G G GG P P GGGG GG GG Sbjct: 216 GSGRGGAPGGPGAPGGGGFGGQGG 239 Score = 29.5 bits (63), Expect = 5.9 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXP--PPXXGGGGXGGGGG 368 G G GG P P GGGG GG GG Sbjct: 249 GAGRGGSPGGPGSPGGGGFGGQGG 272 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GG G GGGGG Sbjct: 263 GGGGFGGQGGAGGGYGGGGGGG 284 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGGG 368 GGGG GGG GGGGG Sbjct: 328 GGGGYGGQGGAGGGYGGGGG 347 Score = 29.5 bits (63), Expect = 5.9 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXP--PPXXGGGGXGGGGG 368 GGG G P P GGGG GG GG Sbjct: 350 GGGAPGAPGAPGSPGGGGFGGQGG 373 Score = 29.5 bits (63), Expect = 5.9 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXP--PPXXGGGGXGGGGG 368 G G GG P P GGGG GG GG Sbjct: 410 GAGRGGAPGAPGSPGGGGFGGQGG 433 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG G P GGG GGG G Sbjct: 161 GGGYSGGPGGQGAGGGGGGGSG 182 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GGG GGGGG Sbjct: 184 GGGSGFGGGGAGGGSGGGGGG 204 >BT021407-1|AAX33555.1| 720|Drosophila melanogaster LD06749p protein. Length = 720 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 650 GGRGGGGGFGGRGGGGRGGGGG 671 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GG GGG GGGG GGGG Sbjct: 664 GGRGGGGGFGGRGGGGRGGGG 684 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GG GG Sbjct: 669 GGGFGGRGGGGRGGGGFGGRGG 690 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 651 GRGGGGGFGGRGGGGRGGGGG 671 >BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p protein. Length = 286 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 76 GGGGGFSSGGGGGGGGGFGGG 96 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G G GGG Sbjct: 87 GGGGGGFGGGFGGGSGGGSGGG 108 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG G GGG Sbjct: 76 GGGGGFSSGGGGGGGGGFGGG 96 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GG GG Sbjct: 86 GGGGGGGFGGGFGGGSGGGSGG 107 Score = 30.3 bits (65), Expect = 3.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GG GGG GGGG GGGG Sbjct: 107 GGFGGGGSIGGFGGGGGGGGG 127 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 58 GGFGGGFGGGSGGGGFSSGGG 78 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GG G G GGG Sbjct: 88 GGGGGFGGGFGGGSGGGSGGG 108 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGG G Sbjct: 85 GGGGGGGGFGGGFGGGSGGGSG 106 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGG GGGGG Sbjct: 106 GGGFGGGGSIGGFGGGGGGGGG 127 >AY119651-1|AAM50305.1| 700|Drosophila melanogaster RE58280p protein. Length = 700 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 242 GGAGGAMNSTNMGGGGGGGGGG 263 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGG GGGGG Sbjct: 241 GGGAGGAMNSTNMGGGGGGGGG 262 >AY119132-1|AAM50992.1| 188|Drosophila melanogaster RE35358p protein. Length = 188 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 39 GGFGGGFGGGLGGGGGGGGGG 59 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGGG Sbjct: 38 GGGFGGGFGGGLGGGGGGGGGG 59 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGG--GGXGGGGG 368 GGGGGG GG GG GGGGG Sbjct: 31 GGGGGGFGGGFGGGFGGGLGGGGG 54 >AY094861-1|AAM11214.1| 362|Drosophila melanogaster RE22192p protein. Length = 362 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 8/30 (26%) Frame = +3 Query: 369 PPPP--------PXPPPPXXGGGXPPPPPP 434 PPPP P PP P GG PPPP P Sbjct: 176 PPPPRPGWNGGGPPPPMPGWNGGGPPPPRP 205 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 8/30 (26%) Frame = +3 Query: 369 PPPP--------PXPPPPXXGGGXPPPPPP 434 PPPP P PP P GG PPPP P Sbjct: 188 PPPPMPGWNGGGPPPPRPGWNGGGPPPPRP 217 Score = 31.9 bits (69), Expect = 1.1 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 7/29 (24%) Frame = +3 Query: 369 PPPPPX-----PPPPXXG--GGXPPPPPP 434 PPP P PPPP G GG PPPP P Sbjct: 165 PPPRPGFNGGGPPPPRPGWNGGGPPPPMP 193 >AY070976-1|AAL48598.1| 127|Drosophila melanogaster RE07460p protein. Length = 127 Score = 32.3 bits (70), Expect = 0.83 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGGXXXXXXXXXXXXXXXXXXXXXGGGXFXFXPKXGFTGFG 205 GG GG G GG G G GGG GGG F P GF G G Sbjct: 54 GGPGGGFGGPGGGFG-GQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGGPG 111 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P G GG GGG G Sbjct: 54 GGPGGGFGGPGGGFGGQGGGFG 75 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P G GG GGG G Sbjct: 68 GGQGGGFGGPGGGFGGQGGGFG 89 >AY051622-1|AAK93046.1| 456|Drosophila melanogaster GH27042p protein. Length = 456 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 89 GGGGGGS----GGGGGNGGGGG 106 >AM294873-1|CAL26859.1| 155|Drosophila melanogaster CG10853 protein. Length = 155 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 55 GGGGGGGSGGGGGGGSGSGGG 75 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG G GGG Sbjct: 55 GGGGGGGSGGGGGGGSGSGGG 75 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGG G Sbjct: 56 GGGGGGSGGGGGGGSGSGGGSG 77 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GG G G GGG Sbjct: 63 GGGGGGGSGSGGGSGSGDGGG 83 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGG GGG Sbjct: 55 GGGGGGGSGGGGGGGSGSGGG 75 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G G GGGG Sbjct: 63 GGGGGGGSGSGGGSGSGDGGGG 84 >AM294870-1|CAL26856.1| 155|Drosophila melanogaster CG10853 protein. Length = 155 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 55 GGGGGGGSGGGGGGGSGSGGG 75 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG G GGG Sbjct: 55 GGGGGGGSGGGGGGGSGSGGG 75 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGG G Sbjct: 56 GGGGGGSGGGGGGGSGSGGGSG 77 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GG G G GGG Sbjct: 63 GGGGGGGSGSGGGSGSGDGGG 83 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGG GGG Sbjct: 55 GGGGGGGSGGGGGGGSGSGGG 75 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G G GGGG Sbjct: 63 GGGGGGGSGSGGGSGSGDGGGG 84 >AJ271041-1|CAB66004.1| 286|Drosophila melanogaster Gly-rich protein protein. Length = 286 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 76 GGGGGFSSGGGGGGGGGFGGG 96 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G G GGG Sbjct: 87 GGGGGGFGGGFGGGSGGGSGGG 108 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG G GGG Sbjct: 76 GGGGGFSSGGGGGGGGGFGGG 96 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GG GG Sbjct: 86 GGGGGGGFGGGFGGGSGGGSGG 107 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 58 GGFGGGFGGGSGGGGFSSGGG 78 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GG G G GGG Sbjct: 88 GGGGGFGGGFGGGSGGGSGGG 108 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGG G Sbjct: 85 GGGGGGGGFGGGFGGGSGGGSG 106 >AF162774-1|AAF68853.2| 720|Drosophila melanogaster Nopp140-like nucleolar protein protein. Length = 720 Score = 32.3 bits (70), Expect = 0.83 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 650 GGRGGGGGFGGRGGGGRGGGGG 671 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GG GGG GGGG GGGG Sbjct: 664 GGRGGGGGFGGRGGGGRGGGG 684 Score = 29.5 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GG GG Sbjct: 669 GGGFGGRGGGGRGGGGFGGRGG 690 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 651 GRGGGGGFGGRGGGGRGGGGG 671 >AE014298-2555|AAO41691.1| 426|Drosophila melanogaster CG5424-PE, isoform E protein. Length = 426 Score = 32.3 bits (70), Expect = 0.83 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PP P PPPP G PP PP Sbjct: 69 PPLPPPPPPLPHGMLPPQPP 88 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 69 PPLPPPPPPLPHGMLPPQPP 88 >AE014298-2554|AAF48719.1| 608|Drosophila melanogaster CG5424-PA, isoform A protein. Length = 608 Score = 32.3 bits (70), Expect = 0.83 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PP P PPPP G PP PP Sbjct: 251 PPLPPPPPPLPHGMLPPQPP 270 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 251 PPLPPPPPPLPHGMLPPQPP 270 >AE014298-2553|AAO41690.1| 1509|Drosophila melanogaster CG5424-PC, isoform C protein. Length = 1509 Score = 32.3 bits (70), Expect = 0.83 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PP P PPPP G PP PP Sbjct: 1152 PPLPPPPPPLPHGMLPPQPP 1171 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 1152 PPLPPPPPPLPHGMLPPQPP 1171 >AE014298-2552|AAO41689.1| 1436|Drosophila melanogaster CG5424-PD, isoform D protein. Length = 1436 Score = 32.3 bits (70), Expect = 0.83 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PP P PPPP G PP PP Sbjct: 1079 PPLPPPPPPLPHGMLPPQPP 1098 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 1079 PPLPPPPPPLPHGMLPPQPP 1098 >AE014298-2551|AAF48718.2| 1436|Drosophila melanogaster CG5424-PB, isoform B protein. Length = 1436 Score = 32.3 bits (70), Expect = 0.83 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PP P PPPP G PP PP Sbjct: 1079 PPLPPPPPPLPHGMLPPQPP 1098 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 1079 PPLPPPPPPLPHGMLPPQPP 1098 >AE014298-2550|ABI30989.1| 1918|Drosophila melanogaster CG5424-PF, isoform F protein. Length = 1918 Score = 32.3 bits (70), Expect = 0.83 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PP P PPPP G PP PP Sbjct: 1565 PPLPPPPPPLPHGMLPPQPP 1584 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 1565 PPLPPPPPPLPHGMLPPQPP 1584 >AE014298-2513|AAF48690.2| 834|Drosophila melanogaster CG8949-PA protein. Length = 834 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG G GGG Sbjct: 55 GGGGGGGSAGGGGGGSGNGGG 75 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGG GGG Sbjct: 55 GGGGGGGSAGGGGGGSGNGGG 75 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 55 GGGGGGGSAGGGGGGSGNGGG 75 Score = 29.5 bits (63), Expect = 5.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG G GG Sbjct: 53 GAGGGGGGGSAGGGGGGSGNGG 74 >AE014298-2380|AAX52501.1| 698|Drosophila melanogaster CG4211-PC, isoform C protein. Length = 698 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 242 GGAGGAMNSTNMGGGGGGGGGG 263 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGG GGGGG Sbjct: 241 GGGAGGAMNSTNMGGGGGGGGG 262 >AE014298-2379|AAF48597.2| 700|Drosophila melanogaster CG4211-PA, isoform A protein. Length = 700 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 242 GGAGGAMNSTNMGGGGGGGGGG 263 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGG GGGGG Sbjct: 241 GGGAGGAMNSTNMGGGGGGGGG 262 >AE014298-2378|AAN09398.1| 742|Drosophila melanogaster CG4211-PB, isoform B protein. Length = 742 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 242 GGAGGAMNSTNMGGGGGGGGGG 263 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGG GGGGG Sbjct: 241 GGGAGGAMNSTNMGGGGGGGGG 262 >AE014298-950|AAF46198.2| 456|Drosophila melanogaster CG3135-PA protein. Length = 456 Score = 32.3 bits (70), Expect = 0.83 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 89 GGGGGGS----GGGGGNGGGGG 106 >AE014298-9|AAX52465.1| 193|Drosophila melanogaster CG13376-PA protein. Length = 193 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GG GGG GGGG GGGG Sbjct: 23 GGSGGGWSSGGGGGGGHGGGG 43 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG Sbjct: 81 GGGGGGGWSSGGGGGGWSSGGG 102 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGG Sbjct: 82 GGGGGGWSSGGGGGGWSSGGGG 103 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGX---GGGGG 368 GGGGGG GGGG GGGGG Sbjct: 60 GGGGGGWSSGGGGGGGGWSSGGGGG 84 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGX---GGGGG 368 GGGGGG GGGG GGGGG Sbjct: 71 GGGGGGWSSGGGGGGGGWSSGGGGG 95 Score = 29.9 bits (64), Expect = 4.4 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGG---GGG 368 GGGGGG GGGG GG GGG Sbjct: 58 GGGGGGGGWSSGGGGGGGGWSSGGG 82 Score = 29.9 bits (64), Expect = 4.4 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGG---GGG 368 GGGGGG GGGG GG GGG Sbjct: 69 GGGGGGGGWSSGGGGGGGGWSSGGG 93 Score = 29.9 bits (64), Expect = 4.4 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGX---GGGGG 368 GGGGGG GGGG GGGGG Sbjct: 80 GGGGGGGGWSSGGGGGGWSSGGGGG 104 Score = 29.1 bits (62), Expect = 7.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GG G GGG Sbjct: 134 GGGGGGWSSGGSGGHGSSGGG 154 >AE014297-4805|AAF57194.1| 188|Drosophila melanogaster CG2150-PA protein. Length = 188 Score = 32.3 bits (70), Expect = 0.83 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 39 GGFGGGFGGGLGGGGGGGGGG 59 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGGG Sbjct: 38 GGGFGGGFGGGLGGGGGGGGGG 59 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGG--GGXGGGGG 368 GGGGGG GG GG GGGGG Sbjct: 31 GGGGGGFGGGFGGGFGGGLGGGGG 54 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,322,895 Number of Sequences: 53049 Number of extensions: 932956 Number of successful extensions: 59791 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4810 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40159 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3921660132 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -