BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_A08 (828 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024798-8|AAK29921.3| 1115|Caenorhabditis elegans Hypothetical ... 46 3e-05 U40187-5|AAS80343.1| 1437|Caenorhabditis elegans Cytokinesis def... 45 6e-05 U40187-4|AAS80342.1| 1435|Caenorhabditis elegans Cytokinesis def... 45 6e-05 AF062008-1|AAC17501.1| 1018|Caenorhabditis elegans unknown protein. 45 6e-05 U58751-5|AAN84882.1| 781|Caenorhabditis elegans Wasp (actin cyt... 44 2e-04 U58751-4|AAN84881.1| 607|Caenorhabditis elegans Wasp (actin cyt... 44 2e-04 Z48367-5|CAE54886.1| 993|Caenorhabditis elegans Hypothetical pr... 40 0.002 Z48367-4|CAA88324.1| 1110|Caenorhabditis elegans Hypothetical pr... 40 0.002 Z12018-1|CAD88219.2| 774|Caenorhabditis elegans Hypothetical pr... 40 0.002 Z11126-8|CAD88221.2| 774|Caenorhabditis elegans Hypothetical pr... 40 0.002 AF000298-11|AAM97960.1| 518|Caenorhabditis elegans Prion-like-(... 40 0.002 AF000298-10|AAM97961.1| 539|Caenorhabditis elegans Prion-like-(... 40 0.002 AF000298-8|AAC48255.2| 524|Caenorhabditis elegans Prion-like-(q... 40 0.002 Z70312-3|CAA94385.1| 172|Caenorhabditis elegans Hypothetical pr... 40 0.003 U41538-2|AAG00010.1| 997|Caenorhabditis elegans Hypothetical pr... 40 0.003 Z68338-7|CAA92756.2| 866|Caenorhabditis elegans Hypothetical pr... 39 0.004 AF003386-9|AAB54259.1| 1621|Caenorhabditis elegans Hypothetical ... 39 0.005 Z46676-8|CAB60993.2| 388|Caenorhabditis elegans Hypothetical pr... 38 0.007 U40799-6|AAA81484.2| 210|Caenorhabditis elegans Ground-like (gr... 38 0.007 U24189-3|AAC47514.1| 398|Caenorhabditis elegans RRM-type RNA bi... 38 0.007 AF535160-1|AAN33048.1| 468|Caenorhabditis elegans UNC-34 protein. 38 0.007 AC025722-6|AAO12398.1| 310|Caenorhabditis elegans Uncoordinated... 38 0.007 AC025722-5|AAO12397.1| 454|Caenorhabditis elegans Uncoordinated... 38 0.007 U39852-7|AAK39260.1| 240|Caenorhabditis elegans Ground-like (gr... 38 0.009 Z78013-1|CAB01425.3| 1140|Caenorhabditis elegans Hypothetical pr... 38 0.012 U50310-5|AAA92541.1| 318|Caenorhabditis elegans Ground-like (gr... 38 0.012 U23515-9|AAP82644.1| 360|Caenorhabditis elegans Hypothetical pr... 38 0.012 U23515-8|AAP82645.1| 362|Caenorhabditis elegans Hypothetical pr... 38 0.012 AC025721-11|AAK29900.1| 78|Caenorhabditis elegans Hypothetical... 37 0.015 U88314-13|ABR92611.1| 1346|Caenorhabditis elegans Formin homolog... 37 0.020 AB084086-1|BAC67013.1| 1346|Caenorhabditis elegans Formactin pro... 37 0.020 Z83219-3|CAD57687.1| 965|Caenorhabditis elegans Hypothetical pr... 36 0.027 Z81053-1|CAB02877.1| 385|Caenorhabditis elegans Hypothetical pr... 36 0.027 Z81034-4|CAB02729.1| 541|Caenorhabditis elegans Hypothetical pr... 36 0.027 U58755-7|AAB00696.1| 136|Caenorhabditis elegans Hypothetical pr... 36 0.027 U10438-9|AAU87834.1| 616|Caenorhabditis elegans Hypothetical pr... 36 0.027 AF106580-3|AAC78205.1| 881|Caenorhabditis elegans Temporarily a... 36 0.027 Z78013-8|CAN99686.1| 373|Caenorhabditis elegans Hypothetical pr... 36 0.047 AL117204-20|CAB55136.2| 699|Caenorhabditis elegans Hypothetical... 36 0.047 AJ243905-1|CAB64866.1| 699|Caenorhabditis elegans SF1 protein p... 36 0.047 Z93393-1|CAB07688.1| 497|Caenorhabditis elegans Hypothetical pr... 35 0.082 AF067612-1|AAD36954.1| 780|Caenorhabditis elegans Egg laying de... 35 0.082 AF000198-8|AAP68908.1| 435|Caenorhabditis elegans Collagen prot... 35 0.082 Z68008-5|CAD91696.1| 1160|Caenorhabditis elegans Hypothetical pr... 34 0.11 Z68008-4|CAA92000.4| 1137|Caenorhabditis elegans Hypothetical pr... 34 0.11 AL132860-21|CAB60518.2| 759|Caenorhabditis elegans Hypothetical... 34 0.14 AL117204-23|CAB55137.1| 285|Caenorhabditis elegans Hypothetical... 34 0.14 AF057032-1|AAC13567.1| 759|Caenorhabditis elegans DNA topoisome... 34 0.14 Z82095-2|CAB05027.2| 602|Caenorhabditis elegans Hypothetical pr... 33 0.19 Z81124-1|CAB03369.1| 312|Caenorhabditis elegans Hypothetical pr... 33 0.19 Z77655-1|CAB01137.1| 393|Caenorhabditis elegans Hypothetical pr... 33 0.19 U64609-7|AAB04604.3| 373|Caenorhabditis elegans Sperm-specific ... 33 0.19 AF000193-3|AAB52890.1| 259|Caenorhabditis elegans Hypothetical ... 33 0.19 Z81555-7|CAB04518.1| 561|Caenorhabditis elegans Hypothetical pr... 33 0.25 U53153-1|AAC69039.4| 715|Caenorhabditis elegans Hypothetical pr... 33 0.25 L25598-4|AAV58888.1| 737|Caenorhabditis elegans Calpain family ... 33 0.25 L25598-3|AAM15551.1| 759|Caenorhabditis elegans Calpain family ... 33 0.25 AF025467-2|AAN65301.1| 505|Caenorhabditis elegans Hypothetical ... 33 0.25 AF025467-1|AAB71039.2| 528|Caenorhabditis elegans Hypothetical ... 33 0.25 U40802-12|AAK19014.2| 265|Caenorhabditis elegans Sperm-specific... 33 0.33 U40802-3|AAM81105.1| 369|Caenorhabditis elegans Dense body prot... 33 0.33 U40802-2|AAM81104.1| 1010|Caenorhabditis elegans Dense body prot... 33 0.33 U40802-1|AAM81106.1| 999|Caenorhabditis elegans Dense body prot... 33 0.33 U23172-13|ABH03527.1| 282|Caenorhabditis elegans Hypothetical p... 33 0.33 U23172-12|ABH03526.1| 562|Caenorhabditis elegans Hypothetical p... 33 0.33 U00058-3|AAD31933.1| 162|Caenorhabditis elegans Ground-like (gr... 33 0.33 J04804-1|AAA28002.1| 1010|Caenorhabditis elegans protein ( C.ele... 33 0.33 AF067609-10|AAC17537.1| 163|Caenorhabditis elegans Ground-like ... 33 0.33 AC024790-13|AAL32247.1| 311|Caenorhabditis elegans Hypothetical... 33 0.33 U61288-1|AAB17543.1| 790|Caenorhabditis elegans CE protein. 32 0.44 AF039052-9|AAF98625.1| 302|Caenorhabditis elegans Hypothetical ... 32 0.44 Z69360-4|CAC42291.2| 732|Caenorhabditis elegans Hypothetical pr... 32 0.58 Z69360-3|CAA93286.2| 369|Caenorhabditis elegans Hypothetical pr... 32 0.58 Z69360-2|CAA93285.2| 780|Caenorhabditis elegans Hypothetical pr... 32 0.58 U55366-2|AAA97981.1| 156|Caenorhabditis elegans Hypothetical pr... 32 0.58 U41543-12|AAZ91345.1| 401|Caenorhabditis elegans Groundhog (hed... 32 0.58 U13875-4|AAK67215.1| 1510|Caenorhabditis elegans Set (trithorax/... 32 0.58 U13875-3|AAK67214.1| 1507|Caenorhabditis elegans Set (trithorax/... 32 0.58 AF043706-2|AAB97604.2| 730|Caenorhabditis elegans Hypothetical ... 32 0.58 Z69658-1|CAA93481.1| 418|Caenorhabditis elegans Hypothetical pr... 31 0.76 AC006638-2|AAK85481.1| 1256|Caenorhabditis elegans Cyclase assoc... 31 0.76 AC006638-1|AAK85482.1| 495|Caenorhabditis elegans Cyclase assoc... 31 0.76 U97015-9|AAB52349.1| 343|Caenorhabditis elegans Hypothetical pr... 31 1.0 U41557-2|AAA83301.1| 309|Caenorhabditis elegans Hypothetical pr... 31 1.0 AL110477-13|CAB54337.2| 789|Caenorhabditis elegans Hypothetical... 31 1.0 AF230279-1|AAG16654.1| 789|Caenorhabditis elegans SWI3-like pro... 31 1.0 AC006611-4|AAK85456.2| 328|Caenorhabditis elegans Hypothetical ... 31 1.0 Z92831-7|CAB07369.2| 2396|Caenorhabditis elegans Hypothetical pr... 31 1.3 Z81466-2|CAC42256.1| 954|Caenorhabditis elegans Hypothetical pr... 31 1.3 Z81466-1|CAB03869.1| 982|Caenorhabditis elegans Hypothetical pr... 31 1.3 Z81066-8|CAB02974.2| 2396|Caenorhabditis elegans Hypothetical pr... 31 1.3 AJ133374-1|CAB40208.1| 954|Caenorhabditis elegans lin-10 protei... 31 1.3 AF067219-3|AAC17027.1| 74|Caenorhabditis elegans Hypothetical ... 31 1.3 AF045646-2|AAK29827.1| 371|Caenorhabditis elegans Collagen prot... 31 1.3 AF016446-1|AAC24166.1| 66|Caenorhabditis elegans Hypothetical ... 31 1.3 Z70284-9|CAA94280.1| 290|Caenorhabditis elegans Hypothetical pr... 30 1.8 Z54238-1|CAA90992.2| 281|Caenorhabditis elegans Hypothetical pr... 30 1.8 U64609-1|AAB04598.1| 405|Caenorhabditis elegans Sperm-specific ... 30 1.8 L25598-5|AAM15550.1| 113|Caenorhabditis elegans Calpain family ... 30 1.8 L25598-2|AAV58887.1| 780|Caenorhabditis elegans Calpain family ... 30 1.8 AL032637-18|CAE17998.1| 193|Caenorhabditis elegans Hypothetical... 30 1.8 AF101312-1|AAC69221.3| 813|Caenorhabditis elegans Hypothetical ... 30 1.8 AC025716-21|AAT39978.1| 586|Caenorhabditis elegans Hypothetical... 30 1.8 AC025716-20|AAT39977.2| 946|Caenorhabditis elegans Hypothetical... 30 1.8 AC024847-11|AAO21416.1| 453|Caenorhabditis elegans Ground-like ... 30 1.8 AC024847-10|AAF60859.1| 393|Caenorhabditis elegans Ground-like ... 30 1.8 Z83227-3|CAB05726.2| 241|Caenorhabditis elegans Hypothetical pr... 30 2.3 Z81525-6|CAB82206.2| 346|Caenorhabditis elegans Hypothetical pr... 30 2.3 Z73102-2|CAB63428.1| 341|Caenorhabditis elegans Hypothetical pr... 30 2.3 Z73102-1|CAA97419.1| 298|Caenorhabditis elegans Hypothetical pr... 30 2.3 Z68106-4|CAA92128.1| 112|Caenorhabditis elegans Hypothetical pr... 30 2.3 AL110490-3|CAB54449.1| 892|Caenorhabditis elegans Hypothetical ... 30 2.3 AL110484-17|CAB54408.1| 586|Caenorhabditis elegans Hypothetical... 30 2.3 AF098500-3|ABD94103.1| 774|Caenorhabditis elegans Temporarily a... 30 2.3 AF098500-2|AAC67399.2| 996|Caenorhabditis elegans Temporarily a... 30 2.3 AC024809-7|AAF59540.1| 315|Caenorhabditis elegans Hypothetical ... 30 2.3 Z75543-7|CAA99868.2| 139|Caenorhabditis elegans Hypothetical pr... 29 3.1 Z70309-6|CAA94360.1| 324|Caenorhabditis elegans Hypothetical pr... 29 3.1 Z49130-7|CAA88972.2| 316|Caenorhabditis elegans Hypothetical pr... 29 3.1 U58748-9|AAB52969.3| 542|Caenorhabditis elegans Hypothetical pr... 29 3.1 U58748-8|AAM97986.1| 497|Caenorhabditis elegans Hypothetical pr... 29 3.1 U58748-7|AAM97987.1| 399|Caenorhabditis elegans Hypothetical pr... 29 3.1 U39666-1|AAA80412.2| 644|Caenorhabditis elegans Nematode astaci... 29 3.1 AL132898-14|CAC14406.1| 1641|Caenorhabditis elegans Hypothetical... 29 3.1 AL023858-2|CAE18058.1| 158|Caenorhabditis elegans Hypothetical ... 29 3.1 AF003390-3|AAB54272.1| 1308|Caenorhabditis elegans Hypothetical ... 29 3.1 AC006666-4|AAK21415.1| 109|Caenorhabditis elegans Hypothetical ... 29 3.1 Z93372-4|CAB07546.1| 301|Caenorhabditis elegans Hypothetical pr... 25 3.8 Z95559-4|CAB09004.1| 110|Caenorhabditis elegans Hypothetical pr... 29 4.1 Z82269-5|CAH60772.1| 618|Caenorhabditis elegans Hypothetical pr... 29 4.1 Z82269-4|CAB70200.2| 633|Caenorhabditis elegans Hypothetical pr... 29 4.1 Z82093-3|CAB05020.1| 222|Caenorhabditis elegans Hypothetical pr... 29 4.1 Z82083-3|CAB04971.1| 756|Caenorhabditis elegans Hypothetical pr... 29 4.1 Z82053-1|CAB04834.1| 233|Caenorhabditis elegans Hypothetical pr... 29 4.1 Z81560-2|CAB04547.1| 1021|Caenorhabditis elegans Hypothetical pr... 29 4.1 Z81470-7|CAB03885.1| 129|Caenorhabditis elegans Hypothetical pr... 29 4.1 Z74472-4|CAA98942.1| 301|Caenorhabditis elegans Hypothetical pr... 29 4.1 Z66511-5|CAA91317.1| 1095|Caenorhabditis elegans Hypothetical pr... 29 4.1 Z50875-1|CAA90776.1| 1872|Caenorhabditis elegans Hypothetical pr... 29 4.1 V00147-1|CAA23463.1| 296|Caenorhabditis elegans protein ( Caeno... 29 4.1 U88172-5|AAB42260.1| 483|Caenorhabditis elegans Hypothetical pr... 29 4.1 U80023-1|AAG24037.1| 180|Caenorhabditis elegans Hypothetical pr... 29 4.1 U58736-1|AAB00598.1| 302|Caenorhabditis elegans Dumpy : shorter... 29 4.1 U29380-1|AAA68740.1| 346|Caenorhabditis elegans Hypothetical pr... 29 4.1 U28731-8|AAA68300.2| 113|Caenorhabditis elegans Hypothetical pr... 29 4.1 J01047-1|AAA27988.1| 296|Caenorhabditis elegans protein ( C.ele... 29 4.1 D10877-1|BAA01645.1| 346|Caenorhabditis elegans hnRNP like prot... 29 4.1 AL132898-7|CAC14410.1| 413|Caenorhabditis elegans Hypothetical ... 29 4.1 AL132860-5|CAB60515.1| 798|Caenorhabditis elegans Hypothetical ... 29 4.1 AL021487-15|CAH60766.1| 618|Caenorhabditis elegans Hypothetical... 29 4.1 AL021487-14|CAA16360.3| 633|Caenorhabditis elegans Hypothetical... 29 4.1 AL021180-3|CAA15982.1| 1872|Caenorhabditis elegans Hypothetical ... 29 4.1 AF106574-2|AAM81088.1| 315|Caenorhabditis elegans Hypothetical ... 29 4.1 AF106574-1|AAY44015.1| 317|Caenorhabditis elegans Hypothetical ... 29 4.1 AF068713-14|AAK73895.1| 172|Caenorhabditis elegans Ground-like ... 29 4.1 AF038613-8|AAL02515.2| 309|Caenorhabditis elegans Human hnrnp a... 29 4.1 AF038613-7|ABB51185.1| 308|Caenorhabditis elegans Human hnrnp a... 29 4.1 AF038613-6|ABB51186.1| 347|Caenorhabditis elegans Human hnrnp a... 29 4.1 AF038613-5|AAB92051.1| 346|Caenorhabditis elegans Human hnrnp a... 29 4.1 AF016439-1|AAB65898.3| 721|Caenorhabditis elegans Hypothetical ... 29 4.1 AC024838-7|AAF60820.1| 381|Caenorhabditis elegans Hypothetical ... 29 4.1 AC024838-3|AAF60821.1| 381|Caenorhabditis elegans Hypothetical ... 29 4.1 Z67990-1|CAA91932.1| 316|Caenorhabditis elegans Hypothetical pr... 29 5.4 Z34533-1|CAA84302.3| 730|Caenorhabditis elegans Hypothetical pr... 29 5.4 U39848-6|AAL11100.1| 317|Caenorhabditis elegans Not-like (yeast... 29 5.4 U39848-5|AAL11099.1| 367|Caenorhabditis elegans Not-like (yeast... 29 5.4 U39848-4|AAA80691.1| 444|Caenorhabditis elegans Not-like (yeast... 29 5.4 U23139-1|AAK31493.2| 513|Caenorhabditis elegans Hypothetical pr... 29 5.4 L23648-5|AAN63385.1| 381|Caenorhabditis elegans Cyclin t protei... 29 5.4 L23648-4|AAA28033.2| 555|Caenorhabditis elegans Cyclin t protei... 29 5.4 AL032646-7|CAA21680.1| 485|Caenorhabditis elegans Hypothetical ... 29 5.4 AL023835-10|CAA19494.2| 691|Caenorhabditis elegans Hypothetical... 29 5.4 AF003130-14|AAB54129.1| 892|Caenorhabditis elegans Hypothetical... 29 5.4 Z81135-1|CAB03453.1| 627|Caenorhabditis elegans Hypothetical pr... 28 7.1 Z77660-3|CAB01171.1| 471|Caenorhabditis elegans Hypothetical pr... 28 7.1 Z74031-17|CAN86923.1| 380|Caenorhabditis elegans Hypothetical p... 28 7.1 Z74031-16|CAA98452.1| 378|Caenorhabditis elegans Hypothetical p... 28 7.1 Z72502-7|CAA96592.1| 140|Caenorhabditis elegans Hypothetical pr... 28 7.1 Z46937-1|CAA87056.2| 1036|Caenorhabditis elegans Hypothetical pr... 28 7.1 Z35719-1|CAA84800.1| 296|Caenorhabditis elegans Hypothetical pr... 28 7.1 U80439-8|AAB37646.3| 1724|Caenorhabditis elegans Hypothetical pr... 28 7.1 AY438643-1|AAR00670.1| 627|Caenorhabditis elegans abnormal DAue... 28 7.1 AL132904-4|CAC35836.2| 582|Caenorhabditis elegans Hypothetical ... 28 7.1 AF098501-3|AAM69106.1| 275|Caenorhabditis elegans Hypothetical ... 28 7.1 AF098501-2|AAM69105.1| 298|Caenorhabditis elegans Hypothetical ... 28 7.1 AF098501-1|AAC67404.2| 548|Caenorhabditis elegans Hypothetical ... 28 7.1 AF067607-3|AAF98607.1| 590|Caenorhabditis elegans Hypothetical ... 28 7.1 AF003151-19|AAK18922.1| 988|Caenorhabditis elegans Hypothetical... 28 7.1 AC024859-14|AAY43989.1| 643|Caenorhabditis elegans Hypothetical... 28 7.1 Z98866-8|CAB11562.2| 425|Caenorhabditis elegans Hypothetical pr... 28 9.4 Z92826-4|CAB07322.1| 309|Caenorhabditis elegans Hypothetical pr... 28 9.4 Z49131-6|CAA88979.1| 297|Caenorhabditis elegans Hypothetical pr... 28 9.4 Z29561-4|CAD91697.1| 498|Caenorhabditis elegans Hypothetical pr... 28 9.4 Z29561-3|CAD54153.1| 846|Caenorhabditis elegans Hypothetical pr... 28 9.4 Z29561-2|CAD54152.1| 882|Caenorhabditis elegans Hypothetical pr... 28 9.4 Z29561-1|CAA82667.2| 861|Caenorhabditis elegans Hypothetical pr... 28 9.4 U93842-1|AAB52421.1| 1409|Caenorhabditis elegans regulator of pr... 28 9.4 U73679-1|AAC67305.1| 861|Caenorhabditis elegans YNK1-a protein. 28 9.4 U49945-3|AAM51509.1| 1408|Caenorhabditis elegans Aboc, expulsion... 28 9.4 U49945-2|AAC47926.1| 1409|Caenorhabditis elegans Aboc, expulsion... 28 9.4 U41991-7|AAA83347.1| 255|Caenorhabditis elegans Hypothetical pr... 28 9.4 U27312-9|AAA68252.1| 239|Caenorhabditis elegans Hypothetical pr... 28 9.4 L10986-3|AAA28018.1| 650|Caenorhabditis elegans Abnormal cell m... 28 9.4 L10986-2|AAK84523.2| 667|Caenorhabditis elegans Abnormal cell m... 28 9.4 L10986-1|AAR25648.1| 779|Caenorhabditis elegans Abnormal cell m... 28 9.4 AF098992-4|AAK73869.2| 250|Caenorhabditis elegans Hypothetical ... 28 9.4 AF068713-16|AAD34663.1| 156|Caenorhabditis elegans Ground-like ... 28 9.4 AF038615-6|AAB94146.1| 157|Caenorhabditis elegans Ground-like (... 28 9.4 AC025716-19|AAK39602.2| 549|Caenorhabditis elegans Hypothetical... 28 9.4 AC025716-14|AAK39603.1| 227|Caenorhabditis elegans Hypothetical... 28 9.4 AC024824-3|AAK85501.1| 543|Caenorhabditis elegans Hypothetical ... 28 9.4 AC006696-4|AAF39985.1| 215|Caenorhabditis elegans Hypothetical ... 28 9.4 AC006651-6|AAF39868.1| 833|Caenorhabditis elegans Hypothetical ... 28 9.4 AC006633-3|AAK68375.1| 227|Caenorhabditis elegans Hypothetical ... 28 9.4 >AC024798-8|AAK29921.3| 1115|Caenorhabditis elegans Hypothetical protein Y48G9A.4 protein. Length = 1115 Score = 46.0 bits (104), Expect = 3e-05 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP GG PPPPPP Sbjct: 576 PPPPPPPPPMLGGPPPPPPPP 596 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P G PPPPPP Sbjct: 561 PPPPPPPLPQNLSGAPPPPPPP 582 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +3 Query: 369 PPPPPXPPP-PXXGGGXPPPPPP 434 P PPP PPP P G PPPPPP Sbjct: 559 PIPPPPPPPLPQNLSGAPPPPPP 581 Score = 35.5 bits (78), Expect = 0.047 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P G PPPPPP Sbjct: 562 PPPPPPLPQNLSGAPPPPPPPP 583 Score = 31.1 bits (67), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP PP PP Sbjct: 576 PPPPPPPPPMLGGPPPPPPP 595 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP PP PP Sbjct: 576 PPPPPPPPPMLGGPPPPPPPP 596 >U40187-5|AAS80343.1| 1437|Caenorhabditis elegans Cytokinesis defect protein 1, isoformb protein. Length = 1437 Score = 45.2 bits (102), Expect = 6e-05 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP GG PPPPPP Sbjct: 769 PPPPPPPPPGGFKGGPPPPPPP 790 Score = 41.1 bits (92), Expect = 0.001 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP GG PPPPPP Sbjct: 744 PPPPPGGLPPISGGPPPPPPPP 765 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPPP GG PPPPPP Sbjct: 758 PPPPPPPP---GGCPPPPPP 774 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PP GG PPPPP Sbjct: 728 PPPPPGGLPPITGGPPPPPPP 748 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P GG PPPPPP Sbjct: 743 PPPPPPGGLPPISGGPPPPPPP 764 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP GG PPPPPP Sbjct: 713 PPPPPGLPP--ITGGPPPPPPP 732 Score = 36.7 bits (81), Expect = 0.020 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 PP PPPP G PPPPPP Sbjct: 758 PPPPPPPPGGCPPPPPPPP 776 Score = 31.1 bits (67), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPP P PP PP Sbjct: 758 PPPPPPPPGGCPPPPPPPPP 777 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/59 (27%), Positives = 17/59 (28%) Frame = +2 Query: 206 PNPVNPXLGXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPPPXPXPPPPXXPXXXPPXPP 382 P + P G PPP PPP P PP PP PP Sbjct: 732 PGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGPPPPPPP 790 Score = 28.3 bits (60), Expect = 7.1 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +3 Query: 789 GGXRXXPPPPPPP 827 GG + PPPPPPP Sbjct: 778 GGFKGGPPPPPPP 790 >U40187-4|AAS80342.1| 1435|Caenorhabditis elegans Cytokinesis defect protein 1, isoforma protein. Length = 1435 Score = 45.2 bits (102), Expect = 6e-05 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP GG PPPPPP Sbjct: 769 PPPPPPPPPGGFKGGPPPPPPP 790 Score = 41.1 bits (92), Expect = 0.001 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP GG PPPPPP Sbjct: 744 PPPPPGGLPPISGGPPPPPPPP 765 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPPP GG PPPPPP Sbjct: 758 PPPPPPPP---GGCPPPPPP 774 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PP GG PPPPP Sbjct: 728 PPPPPGGLPPITGGPPPPPPP 748 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P GG PPPPPP Sbjct: 743 PPPPPPGGLPPISGGPPPPPPP 764 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP GG PPPPPP Sbjct: 713 PPPPPGLPP--ITGGPPPPPPP 732 Score = 36.7 bits (81), Expect = 0.020 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 PP PPPP G PPPPPP Sbjct: 758 PPPPPPPPGGCPPPPPPPP 776 Score = 31.1 bits (67), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPP P PP PP Sbjct: 758 PPPPPPPPGGCPPPPPPPPP 777 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/59 (27%), Positives = 17/59 (28%) Frame = +2 Query: 206 PNPVNPXLGXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPPPXPXPPPPXXPXXXPPXPP 382 P + P G PPP PPP P PP PP PP Sbjct: 732 PGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGPPPPPPP 790 Score = 28.3 bits (60), Expect = 7.1 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +3 Query: 789 GGXRXXPPPPPPP 827 GG + PPPPPPP Sbjct: 778 GGFKGGPPPPPPP 790 >AF062008-1|AAC17501.1| 1018|Caenorhabditis elegans unknown protein. Length = 1018 Score = 45.2 bits (102), Expect = 6e-05 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP GG PPPPPP Sbjct: 352 PPPPPPPPPGGFKGGPPPPPPP 373 Score = 41.1 bits (92), Expect = 0.001 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP GG PPPPPP Sbjct: 327 PPPPPGGLPPISGGPPPPPPPP 348 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPPP GG PPPPPP Sbjct: 341 PPPPPPPP---GGCPPPPPP 357 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PP GG PPPPP Sbjct: 311 PPPPPGGLPPITGGPPPPPPP 331 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P GG PPPPPP Sbjct: 326 PPPPPPGGLPPISGGPPPPPPP 347 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP GG PPPPPP Sbjct: 296 PPPPPGLPP--ITGGPPPPPPP 315 Score = 36.7 bits (81), Expect = 0.020 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 PP PPPP G PPPPPP Sbjct: 341 PPPPPPPPGGCPPPPPPPP 359 Score = 31.1 bits (67), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPP P PP PP Sbjct: 341 PPPPPPPPGGCPPPPPPPPP 360 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/59 (27%), Positives = 17/59 (28%) Frame = +2 Query: 206 PNPVNPXLGXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPPPXPXPPPPXXPXXXPPXPP 382 P + P G PPP PPP P PP PP PP Sbjct: 315 PGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGPPPPPPP 373 Score = 28.3 bits (60), Expect = 7.1 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +3 Query: 789 GGXRXXPPPPPPP 827 GG + PPPPPPP Sbjct: 361 GGFKGGPPPPPPP 373 >U58751-5|AAN84882.1| 781|Caenorhabditis elegans Wasp (actin cytoskeleton modulator)homolog protein 1, isoform b protein. Length = 781 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/25 (68%), Positives = 17/25 (68%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPXPPP---PXXGGGXPPPPPP 434 PPPPP PPP P G G PPPPPP Sbjct: 630 PPPPPPPPPMGLPAVGAGAPPPPPP 654 Score = 36.3 bits (80), Expect = 0.027 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPXPPP------PXXGGGXPPPPPP 434 PPPPP PPP P PPPPPP Sbjct: 609 PPPPPPPPPQSFGMAPISSAAPPPPPPP 636 Score = 30.3 bits (65), Expect = 1.8 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 372 PPPPXPPPPXXGGG 413 PPPP PPPP GG Sbjct: 649 PPPPPPPPPSGAGG 662 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 375 PPPXPPPPXXGGGXP 419 PPP PPPP G G P Sbjct: 649 PPPPPPPPPSGAGGP 663 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 369 PPPPPXPPPPXXGG 410 PPPPP PPP GG Sbjct: 649 PPPPPPPPPSGAGG 662 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 718 PXXXPPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 P PPPP P A P PPPPPP Sbjct: 605 PHAVPPPPPPPPPQSFGMAPISS--AAPPPPPPPPP 638 Score = 28.3 bits (60), Expect = 7.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 730 PPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 PPPP P A AP PPPPPP Sbjct: 630 PPPPPPPPPMGLPAVG-----AGAPPPPPPPP 656 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 3/24 (12%) Frame = +2 Query: 320 PPPXPXPPP---PXXPXXXPPXPP 382 PPP P PPP P PP PP Sbjct: 630 PPPPPPPPPMGLPAVGAGAPPPPP 653 >U58751-4|AAN84881.1| 607|Caenorhabditis elegans Wasp (actin cytoskeleton modulator)homolog protein 1, isoform a protein. Length = 607 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/25 (68%), Positives = 17/25 (68%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPXPPP---PXXGGGXPPPPPP 434 PPPPP PPP P G G PPPPPP Sbjct: 456 PPPPPPPPPMGLPAVGAGAPPPPPP 480 Score = 36.3 bits (80), Expect = 0.027 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPXPPP------PXXGGGXPPPPPP 434 PPPPP PPP P PPPPPP Sbjct: 435 PPPPPPPPPQSFGMAPISSAAPPPPPPP 462 Score = 30.3 bits (65), Expect = 1.8 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 372 PPPPXPPPPXXGGG 413 PPPP PPPP GG Sbjct: 475 PPPPPPPPPSGAGG 488 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 375 PPPXPPPPXXGGGXP 419 PPP PPPP G G P Sbjct: 475 PPPPPPPPPSGAGGP 489 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 369 PPPPPXPPPPXXGG 410 PPPPP PPP GG Sbjct: 475 PPPPPPPPPSGAGG 488 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 718 PXXXPPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 P PPPP P A P PPPPPP Sbjct: 431 PHAVPPPPPPPPPQSFGMAPISS--AAPPPPPPPPP 464 Score = 28.3 bits (60), Expect = 7.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 730 PPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 PPPP P A AP PPPPPP Sbjct: 456 PPPPPPPPPMGLPAVG-----AGAPPPPPPPP 482 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 3/24 (12%) Frame = +2 Query: 320 PPPXPXPPP---PXXPXXXPPXPP 382 PPP P PPP P PP PP Sbjct: 456 PPPPPPPPPMGLPAVGAGAPPPPP 479 >Z48367-5|CAE54886.1| 993|Caenorhabditis elegans Hypothetical protein C33B4.3b protein. Length = 993 Score = 40.3 bits (90), Expect = 0.002 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P PP G PPPPPP Sbjct: 794 PPPPPPLPPISSGAPPPPPPP 814 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP G PPPPPP Sbjct: 794 PPPPPPLPPISSGAPPPPPPPP 815 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 12/34 (35%) Frame = +3 Query: 369 PPPPPXPPP------------PXXGGGXPPPPPP 434 PPPPP PPP P PPPPPP Sbjct: 766 PPPPPPPPPHCEPTMVHVEFTPPSTSSVPPPPPP 799 Score = 27.5 bits (58), Expect(2) = 0.090 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P P PP PP PP Sbjct: 794 PPPPPPLPPISSGAPPPPPP 813 Score = 25.8 bits (54), Expect(2) = 0.090 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 320 PPPXPXPPPP 349 PPP P PPPP Sbjct: 765 PPPPPPPPPP 774 Score = 24.6 bits (51), Expect(2) = 3.5 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 608 PXPPPPXPXGG 640 P PPPP P GG Sbjct: 808 PPPPPPPPPGG 818 Score = 23.0 bits (47), Expect(2) = 3.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 605 PPXPPPPXP 631 PP PPPP P Sbjct: 766 PPPPPPPPP 774 >Z48367-4|CAA88324.1| 1110|Caenorhabditis elegans Hypothetical protein C33B4.3a protein. Length = 1110 Score = 40.3 bits (90), Expect = 0.002 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P PP G PPPPPP Sbjct: 794 PPPPPPLPPISSGAPPPPPPP 814 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP G PPPPPP Sbjct: 794 PPPPPPLPPISSGAPPPPPPPP 815 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 12/34 (35%) Frame = +3 Query: 369 PPPPPXPPP------------PXXGGGXPPPPPP 434 PPPPP PPP P PPPPPP Sbjct: 766 PPPPPPPPPHCEPTMVHVEFTPPSTSSVPPPPPP 799 Score = 27.5 bits (58), Expect(2) = 0.089 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P P PP PP PP Sbjct: 794 PPPPPPLPPISSGAPPPPPP 813 Score = 25.8 bits (54), Expect(2) = 0.089 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 320 PPPXPXPPPP 349 PPP P PPPP Sbjct: 765 PPPPPPPPPP 774 Score = 24.6 bits (51), Expect(2) = 3.4 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 608 PXPPPPXPXGG 640 P PPPP P GG Sbjct: 808 PPPPPPPPPGG 818 Score = 23.0 bits (47), Expect(2) = 3.4 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 605 PPXPPPPXP 631 PP PPPP P Sbjct: 766 PPPPPPPPP 774 >Z12018-1|CAD88219.2| 774|Caenorhabditis elegans Hypothetical protein ZK643.8 protein. Length = 774 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG PPP GGG GGGGG Sbjct: 43 GGGGGCAPPPAPCGGGCGGGGG 64 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG PPP GGG GGGGG Sbjct: 67 GGGGGCAPPPAPCGGGCGGGGG 88 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 84 GGGGGGC---GGGGGGCGGGGG 102 Score = 32.7 bits (71), Expect = 0.33 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGGG Sbjct: 87 GGGCGGGGGGCGGGGGCGGGGG 108 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 104 GGGGGGC---GGGGGGCGGGGG 122 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 111 GGGGGGC---GGGGGGCGGGGG 129 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 118 GGGGGGC---GGGGGGCGGGGG 136 Score = 32.3 bits (70), Expect = 0.44 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 26 GGGGGGGGCGGGCGGGCGGGGG 47 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 88 GGCGGGGGGCGGGGGCGGGGG 108 Score = 32.3 bits (70), Expect = 0.44 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGGG Sbjct: 94 GGGCGGGGGCGGGGGGCGGGGG 115 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 122 GGCGGGGGGCGGGGGGGCGGG 142 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GG G GGGGG Sbjct: 118 GGGGGGCGGGGGGCGGGGGGG 138 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGG 371 GGGG GGGG GGGG Sbjct: 177 GGGGYAVAPSGGGGCGGGG 195 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGG 371 GGGG GGGG GGGG Sbjct: 198 GGGGYAVAPSGGGGCGGGG 216 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG G GGG Sbjct: 145 GGCGGGSSGGCGGGGGGGCGGG 166 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGG Sbjct: 80 GGGCGGGGGGCGGGGGGCGGGG 101 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGG Sbjct: 86 GGGGCGGGGGGCGGGGGCGGGG 107 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 91 GGGGGGC---GGGGGCGGGGGG 109 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG G GGG Sbjct: 92 GGGGGCGGGGGCGGGGGGCGGG 113 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGG Sbjct: 93 GGGGCGGGGGCGGGGGGCGGGG 114 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG G GGG Sbjct: 99 GGGGCGGGGGGCGGGGGGCGGG 120 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGG Sbjct: 100 GGGCGGGGGGCGGGGGGCGGGG 121 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG G GGG Sbjct: 106 GGGGCGGGGGGCGGGGGGCGGG 127 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGG Sbjct: 107 GGGCGGGGGGCGGGGGGCGGGG 128 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG G GGG Sbjct: 113 GGGGCGGGGGGCGGGGGGCGGG 134 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGG Sbjct: 114 GGGCGGGGGGCGGGGGGCGGGG 135 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GG GG Sbjct: 120 GGGGCGGGGGGCGGGGGGGCGG 141 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG G GGG Sbjct: 121 GGGCGGGGGGCGGGGGGGCGGG 142 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 156 GGGGGGG---CGGGGGGGCGGG 174 Score = 29.1 bits (62), Expect = 4.1 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 302 PPPPPPPPPP 311 Score = 29.1 bits (62), Expect = 4.1 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 303 PPPPPPPPPP 312 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 27 GGGGGGGCGGGCGGGCGGGGG 47 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 80 GGGCGGGGGGCGGGGGGCGGG 100 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 81 GGCGGGGGGCGGGGGGCGGGG 101 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 93 GGGGCGGGGGCGGGGGGCGGG 113 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGGG Sbjct: 95 GGCGGGGGCGGGGGGCGGGGGG 116 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 95 GGCGGGGGCGGGGGGCGGGGG 115 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 100 GGGCGGGGGGCGGGGGGCGGG 120 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 101 GGCGGGGGGCGGGGGGCGGGG 121 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 107 GGGCGGGGGGCGGGGGGCGGG 127 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 108 GGCGGGGGGCGGGGGGCGGGG 128 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 114 GGGCGGGGGGCGGGGGGCGGG 134 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 115 GGCGGGGGGCGGGGGGCGGGG 135 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 146 GCGGGSSGGCGGGGGGGCGGG 166 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG GGGG GGGGG Sbjct: 148 GGGSSGGCGGGGGGGCGGGGG 168 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 154 GCGGGGGGGCGGGGGGGCGGG 174 Score = 28.7 bits (61), Expect = 5.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGG--GGXGGGGG 368 GGGGGG GG GG GGGG Sbjct: 157 GGGGGGCGGGGGGGCGGGSSGGGG 180 Score = 28.7 bits (61), Expect = 5.4 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGG 413 PPPPP P P GGG Sbjct: 308 PPPPPAPAPVSSGGG 322 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGG GGGGG Sbjct: 257 GGSSGGGYSTGGGGGYAGGGGG 278 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 84 GGGGGGCGG--GGGGCGGGGG 102 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = -1 Query: 381 GGXGGXXXGXXG-GGGXGXGGG 319 GG GG G G GGG G GGG Sbjct: 85 GGGGGCGGGGGGCGGGGGCGGG 106 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G G GG Sbjct: 125 GGGGGGCGGGGGGGCGGGSSGG 146 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G G GG Sbjct: 133 GGGGGGCGGGSSGGCGGGSSGG 154 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GG G GGGGG Sbjct: 141 GGSSGGCGGGSSGGCGGGGGGG 162 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GG G GGGGG Sbjct: 149 GGSSGGCGGGGGGGCGGGGGGG 170 Score = 27.9 bits (59), Expect = 9.4 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 320 PPPXPXPPPPXXP 358 PPP P PPPP P Sbjct: 302 PPPPPPPPPPPAP 314 >Z11126-8|CAD88221.2| 774|Caenorhabditis elegans Hypothetical protein ZK643.8 protein. Length = 774 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG PPP GGG GGGGG Sbjct: 43 GGGGGCAPPPAPCGGGCGGGGG 64 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG PPP GGG GGGGG Sbjct: 67 GGGGGCAPPPAPCGGGCGGGGG 88 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 84 GGGGGGC---GGGGGGCGGGGG 102 Score = 32.7 bits (71), Expect = 0.33 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGGG Sbjct: 87 GGGCGGGGGGCGGGGGCGGGGG 108 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 104 GGGGGGC---GGGGGGCGGGGG 122 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 111 GGGGGGC---GGGGGGCGGGGG 129 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 118 GGGGGGC---GGGGGGCGGGGG 136 Score = 32.3 bits (70), Expect = 0.44 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 26 GGGGGGGGCGGGCGGGCGGGGG 47 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 88 GGCGGGGGGCGGGGGCGGGGG 108 Score = 32.3 bits (70), Expect = 0.44 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGGG Sbjct: 94 GGGCGGGGGCGGGGGGCGGGGG 115 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 122 GGCGGGGGGCGGGGGGGCGGG 142 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GG G GGGGG Sbjct: 118 GGGGGGCGGGGGGCGGGGGGG 138 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGG 371 GGGG GGGG GGGG Sbjct: 177 GGGGYAVAPSGGGGCGGGG 195 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 427 GGGGXPPPXXGGGGXGGGG 371 GGGG GGGG GGGG Sbjct: 198 GGGGYAVAPSGGGGCGGGG 216 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG G GGG Sbjct: 145 GGCGGGSSGGCGGGGGGGCGGG 166 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGG Sbjct: 80 GGGCGGGGGGCGGGGGGCGGGG 101 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGG Sbjct: 86 GGGGCGGGGGGCGGGGGCGGGG 107 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 91 GGGGGGC---GGGGGCGGGGGG 109 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG G GGG Sbjct: 92 GGGGGCGGGGGCGGGGGGCGGG 113 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGG Sbjct: 93 GGGGCGGGGGCGGGGGGCGGGG 114 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG G GGG Sbjct: 99 GGGGCGGGGGGCGGGGGGCGGG 120 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGG Sbjct: 100 GGGCGGGGGGCGGGGGGCGGGG 121 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG G GGG Sbjct: 106 GGGGCGGGGGGCGGGGGGCGGG 127 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGG Sbjct: 107 GGGCGGGGGGCGGGGGGCGGGG 128 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG G GGG Sbjct: 113 GGGGCGGGGGGCGGGGGGCGGG 134 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGG Sbjct: 114 GGGCGGGGGGCGGGGGGCGGGG 135 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GG GG Sbjct: 120 GGGGCGGGGGGCGGGGGGGCGG 141 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG G GGG Sbjct: 121 GGGCGGGGGGCGGGGGGGCGGG 142 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 156 GGGGGGG---CGGGGGGGCGGG 174 Score = 29.1 bits (62), Expect = 4.1 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 302 PPPPPPPPPP 311 Score = 29.1 bits (62), Expect = 4.1 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 303 PPPPPPPPPP 312 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 27 GGGGGGGCGGGCGGGCGGGGG 47 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 80 GGGCGGGGGGCGGGGGGCGGG 100 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 81 GGCGGGGGGCGGGGGGCGGGG 101 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 93 GGGGCGGGGGCGGGGGGCGGG 113 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGGG Sbjct: 95 GGCGGGGGCGGGGGGCGGGGGG 116 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 95 GGCGGGGGCGGGGGGCGGGGG 115 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 100 GGGCGGGGGGCGGGGGGCGGG 120 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 101 GGCGGGGGGCGGGGGGCGGGG 121 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 107 GGGCGGGGGGCGGGGGGCGGG 127 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 108 GGCGGGGGGCGGGGGGCGGGG 128 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 114 GGGCGGGGGGCGGGGGGCGGG 134 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 115 GGCGGGGGGCGGGGGGCGGGG 135 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 146 GCGGGSSGGCGGGGGGGCGGG 166 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG GGGG GGGGG Sbjct: 148 GGGSSGGCGGGGGGGCGGGGG 168 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 154 GCGGGGGGGCGGGGGGGCGGG 174 Score = 28.7 bits (61), Expect = 5.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGG--GGXGGGGG 368 GGGGGG GG GG GGGG Sbjct: 157 GGGGGGCGGGGGGGCGGGSSGGGG 180 Score = 28.7 bits (61), Expect = 5.4 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGG 413 PPPPP P P GGG Sbjct: 308 PPPPPAPAPVSSGGG 322 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGG GGGGG Sbjct: 257 GGSSGGGYSTGGGGGYAGGGGG 278 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 84 GGGGGGCGG--GGGGCGGGGG 102 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = -1 Query: 381 GGXGGXXXGXXG-GGGXGXGGG 319 GG GG G G GGG G GGG Sbjct: 85 GGGGGCGGGGGGCGGGGGCGGG 106 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G G GG Sbjct: 125 GGGGGGCGGGGGGGCGGGSSGG 146 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G G GG Sbjct: 133 GGGGGGCGGGSSGGCGGGSSGG 154 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GG G GGGGG Sbjct: 141 GGSSGGCGGGSSGGCGGGGGGG 162 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GG G GGGGG Sbjct: 149 GGSSGGCGGGGGGGCGGGGGGG 170 Score = 27.9 bits (59), Expect = 9.4 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 320 PPPXPXPPPPXXP 358 PPP P PPPP P Sbjct: 302 PPPPPPPPPPPAP 314 >AF000298-11|AAM97960.1| 518|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 75, isoform b protein. Length = 518 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PP G G PPPPP Sbjct: 239 PPPPPKGSPPLAGSGSPPPPP 259 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPPPX--PPPPXXGGGXPPPPPP 434 PPPPP PPP G PPPPPP Sbjct: 280 PPPPPAGGSPPPPRAGSPPPPPPP 303 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/28 (60%), Positives = 17/28 (60%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPX--PPPPXXGGGXPPP----PPP 434 PPPPP PPPP GG PPP PPP Sbjct: 272 PPPPPTGSPPPPPAGGSPPPPRAGSPPP 299 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPX---PPPPXXGGGXPPP---PPP 434 PPPPP PPPP G PPP PPP Sbjct: 255 PPPPPAAGSPPPPRTGSPPPPPTGSPPP 282 Score = 32.7 bits (71), Expect = 0.33 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPP PP G G PPPPP Sbjct: 313 PPPQAGGSPPPAGTGSPPPPP 333 Score = 32.3 bits (70), Expect = 0.44 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPP PP G PPPPP Sbjct: 264 PPPPRTGSPPPPPTGSPPPPP 284 Score = 31.5 bits (68), Expect = 0.76 Identities = 18/62 (29%), Positives = 19/62 (30%), Gaps = 3/62 (4%) Frame = +2 Query: 206 PNPVNPXLGXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPPPXPX---PPPPXXPXXXPPX 376 P +P L PPP PPP P PPPP PP Sbjct: 242 PPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPPPRAGSPPPPP 301 Query: 377 PP 382 PP Sbjct: 302 PP 303 Score = 31.1 bits (67), Expect = 1.0 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 14/36 (38%) Frame = +3 Query: 369 PPPPPXP---------PPPXXGGGXPP-----PPPP 434 PPPPP P PPP GG PP PPPP Sbjct: 297 PPPPPPPRGSPPTGSLPPPQAGGSPPPAGTGSPPPP 332 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXP------PPPPP 434 PP PPPP G P PPPPP Sbjct: 232 PPAGSPPPPPPPKGSPPLAGSGSPPPPP 259 >AF000298-10|AAM97961.1| 539|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 75, isoform c protein. Length = 539 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PP G G PPPPP Sbjct: 260 PPPPPKGSPPLAGSGSPPPPP 280 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPPPX--PPPPXXGGGXPPPPPP 434 PPPPP PPP G PPPPPP Sbjct: 301 PPPPPAGGSPPPPRAGSPPPPPPP 324 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/28 (60%), Positives = 17/28 (60%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPX--PPPPXXGGGXPPP----PPP 434 PPPPP PPPP GG PPP PPP Sbjct: 293 PPPPPTGSPPPPPAGGSPPPPRAGSPPP 320 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPX---PPPPXXGGGXPPP---PPP 434 PPPPP PPPP G PPP PPP Sbjct: 276 PPPPPAAGSPPPPRTGSPPPPPTGSPPP 303 Score = 32.7 bits (71), Expect = 0.33 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPP PP G G PPPPP Sbjct: 334 PPPQAGGSPPPAGTGSPPPPP 354 Score = 32.3 bits (70), Expect = 0.44 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPP PP G PPPPP Sbjct: 285 PPPPRTGSPPPPPTGSPPPPP 305 Score = 31.5 bits (68), Expect = 0.76 Identities = 18/62 (29%), Positives = 19/62 (30%), Gaps = 3/62 (4%) Frame = +2 Query: 206 PNPVNPXLGXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPPPXPX---PPPPXXPXXXPPX 376 P +P L PPP PPP P PPPP PP Sbjct: 263 PPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPPPRAGSPPPPP 322 Query: 377 PP 382 PP Sbjct: 323 PP 324 Score = 31.1 bits (67), Expect = 1.0 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 14/36 (38%) Frame = +3 Query: 369 PPPPPXP---------PPPXXGGGXPP-----PPPP 434 PPPPP P PPP GG PP PPPP Sbjct: 318 PPPPPPPRGSPPTGSLPPPQAGGSPPPAGTGSPPPP 353 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXP------PPPPP 434 PP PPPP G P PPPPP Sbjct: 253 PPAGSPPPPPPPKGSPPLAGSGSPPPPP 280 >AF000298-8|AAC48255.2| 524|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 75, isoform a protein. Length = 524 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PP G G PPPPP Sbjct: 245 PPPPPKGSPPLAGSGSPPPPP 265 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPPPX--PPPPXXGGGXPPPPPP 434 PPPPP PPP G PPPPPP Sbjct: 286 PPPPPAGGSPPPPRAGSPPPPPPP 309 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/28 (60%), Positives = 17/28 (60%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPX--PPPPXXGGGXPPP----PPP 434 PPPPP PPPP GG PPP PPP Sbjct: 278 PPPPPTGSPPPPPAGGSPPPPRAGSPPP 305 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPX---PPPPXXGGGXPPP---PPP 434 PPPPP PPPP G PPP PPP Sbjct: 261 PPPPPAAGSPPPPRTGSPPPPPTGSPPP 288 Score = 32.7 bits (71), Expect = 0.33 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPP PP G G PPPPP Sbjct: 319 PPPQAGGSPPPAGTGSPPPPP 339 Score = 32.3 bits (70), Expect = 0.44 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPP PP G PPPPP Sbjct: 270 PPPPRTGSPPPPPTGSPPPPP 290 Score = 31.5 bits (68), Expect = 0.76 Identities = 18/62 (29%), Positives = 19/62 (30%), Gaps = 3/62 (4%) Frame = +2 Query: 206 PNPVNPXLGXKXKXPPPXXXXXXXXXXXXXXXXXXXXXPPPXPX---PPPPXXPXXXPPX 376 P +P L PPP PPP P PPPP PP Sbjct: 248 PPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPPPRAGSPPPPP 307 Query: 377 PP 382 PP Sbjct: 308 PP 309 Score = 31.1 bits (67), Expect = 1.0 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 14/36 (38%) Frame = +3 Query: 369 PPPPPXP---------PPPXXGGGXPP-----PPPP 434 PPPPP P PPP GG PP PPPP Sbjct: 303 PPPPPPPRGSPPTGSLPPPQAGGSPPPAGTGSPPPP 338 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXP------PPPPP 434 PP PPPP G P PPPPP Sbjct: 238 PPAGSPPPPPPPKGSPPLAGSGSPPPPP 265 >Z70312-3|CAA94385.1| 172|Caenorhabditis elegans Hypothetical protein ZC168.5 protein. Length = 172 Score = 39.5 bits (88), Expect = 0.003 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPPP GG PPPPP Sbjct: 39 PPPPPPPPCGGGYEAPPPPP 58 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPP G PPPPPP Sbjct: 39 PPPPPPPPCGGGYEAPPPPPP 59 >U41538-2|AAG00010.1| 997|Caenorhabditis elegans Hypothetical protein R04E5.8a protein. Length = 997 Score = 39.5 bits (88), Expect = 0.003 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P GG PPPPPP Sbjct: 122 PPPPPPPRKSRAGGSSPPPPPP 143 >Z68338-7|CAA92756.2| 866|Caenorhabditis elegans Hypothetical protein T24B8.4 protein. Length = 866 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/26 (61%), Positives = 16/26 (61%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPX----PPPPXXGGGXPPPPPP 434 PPPPP PPPP G PPPPPP Sbjct: 95 PPPPPMMGGIPPPPPMFGAPPPPPPP 120 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 3/24 (12%) Frame = +3 Query: 369 PPPPPX---PPPPXXGGGXPPPPP 431 PPP P PPPP GG PPPPP Sbjct: 76 PPPGPGGIPPPPPMFAGGIPPPPP 99 Score = 33.5 bits (73), Expect = 0.19 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 4/23 (17%) Frame = +3 Query: 375 PPPXP----PPPXXGGGXPPPPP 431 PPP P PPP GG PPPPP Sbjct: 66 PPPVPNGFIPPPPGPGGIPPPPP 88 Score = 31.1 bits (67), Expect = 1.0 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPX---PPPPXXGGGXPPPPPP 434 PPP P PPPP GG PPPPP Sbjct: 66 PPPVPNGFIPPPPGPGG--IPPPPP 88 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPP----PPXPPPPXXGGGXPPPPPP 434 PPP PP PPPP G P PP P Sbjct: 107 PPPMFGAPPPPPPPSGLGVAPQPPRP 132 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 2/23 (8%) Frame = +2 Query: 320 PPPXPXP--PPPXXPXXXPPXPP 382 PPP P PPP P PP PP Sbjct: 66 PPPVPNGFIPPPPGPGGIPPPPP 88 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 3/24 (12%) Frame = +2 Query: 320 PPPXPX---PPPPXXPXXXPPXPP 382 PPP P PPPP PP PP Sbjct: 76 PPPGPGGIPPPPPMFAGGIPPPPP 99 >AF003386-9|AAB54259.1| 1621|Caenorhabditis elegans Hypothetical protein F59E12.9 protein. Length = 1621 Score = 38.7 bits (86), Expect = 0.005 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP P PPPP Sbjct: 1338 PPPPPPPPPPPSDDLTPVPPPP 1359 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPP Sbjct: 1339 PPPPPPPPPPSDDLTPVPPPPP 1360 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP PPPPPP Sbjct: 1340 PPPPPPPPPSDDLTPVPPPPPP 1361 Score = 35.5 bits (78), Expect = 0.047 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP PPPPPP Sbjct: 1341 PPPPPPPPSDDLTPVPPPPPPP 1362 Score = 32.3 bits (70), Expect = 0.44 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P PPPPPP Sbjct: 1342 PPPPPPPSDDLTPVPPPPPPPP 1363 Score = 31.5 bits (68), Expect = 0.76 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +2 Query: 320 PPPXPXPPPP---XXPXXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 1339 PPPPPPPPPPSDDLTPVPPPPPPP 1362 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPP 425 PPP PPPP GG PPP Sbjct: 1599 PPPGPPPP--NGGPPPP 1613 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP Sbjct: 1338 PPPPPPPPPPPSDDLTPVPPP 1358 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPPPXPPPPXX-----GGGXPPPPPP 434 P PPP PPPP G P PPPP Sbjct: 1354 PVPPPPPPPPTMSKAPTGVPLPVPPPP 1380 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP PPP G P PPPP Sbjct: 1585 PPPLMGGPPPRLGMPPPGPPPP 1606 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P PPPPPP Sbjct: 1377 PPPPPLFSPSMI---LPPPPPP 1395 >Z46676-8|CAB60993.2| 388|Caenorhabditis elegans Hypothetical protein C08B11.5 protein. Length = 388 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPP PP P G G PPPPP Sbjct: 365 PPPPSRPPAPPSGHGMIPPPPP 386 Score = 36.7 bits (81), Expect = 0.020 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPP---PXPPPPXXGGGXPPPPPP 434 PP P P PPPP G PPPPPP Sbjct: 278 PPTPGMTPRPPPPPSSGMWPPPPPP 302 Score = 36.7 bits (81), Expect = 0.020 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P GG PPPPPP Sbjct: 318 PPPPPSRFGPPGMGGMPPPPPP 339 Score = 35.9 bits (79), Expect = 0.035 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PP GG PPPPPP Sbjct: 334 PPPPPPGMRYPGGMPPPPPP 353 Score = 35.5 bits (78), Expect = 0.047 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPXP---PPPXXGGGXPPPPPP 434 PPPPP P P P G PPPPPP Sbjct: 298 PPPPPPPGRTPGPPGMPGMPPPPPP 322 Score = 34.3 bits (75), Expect = 0.11 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P P G G PPPPP Sbjct: 348 PPPPPPRYPSAGPGMYPPPPP 368 Score = 33.5 bits (73), Expect = 0.19 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +3 Query: 372 PPPPXPP---PPXXGGGXPPPPP 431 PPPP P PP GG PPPPP Sbjct: 317 PPPPPPSRFGPPGMGGMPPPPPP 339 Score = 33.1 bits (72), Expect = 0.25 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 P PPPP G PPPPPP Sbjct: 285 PRPPPPPSSGMWPPPPPPP 303 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP P GG PPPPP Sbjct: 334 PPPPPPGMRYPGGMPPPPPP 353 Score = 31.5 bits (68), Expect = 0.76 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP P G PPPPP Sbjct: 348 PPPPPPRYPSAGPGMYPPPPP 368 Score = 31.1 bits (67), Expect = 1.0 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPP---PXPPP-PXXGGGXPPPPPP 434 PPPP P PPP P G P PPPP Sbjct: 265 PPPPSVTPMPPPMPPTPGMTPRPPPP 290 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PP P PP PP Sbjct: 302 PPPGRTPGPPGMPGMPPPPPP 322 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 PP PPPP PPP PP Sbjct: 261 PPVPPPPPSVTPMPPPMPP 279 >U40799-6|AAA81484.2| 210|Caenorhabditis elegans Ground-like (grd related) protein 4 protein. Length = 210 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 63 PPPPPPPPPPM----CPPPPPP 80 Score = 34.7 bits (76), Expect = 0.082 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PPPP P PP P Sbjct: 63 PPPPPPPPPPMCPPPPPPMP 82 Score = 33.9 bits (74), Expect = 0.14 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PP P PPPP P PP PP Sbjct: 59 PPMCPPPPPPPPPPMCPPPPP 79 Score = 33.5 bits (73), Expect = 0.19 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P P PP Sbjct: 40 PPPLPCPPPPICPPQFCPPPP 60 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Frame = +2 Query: 320 PPPX--PXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP PP Sbjct: 58 PPPMCPPPPPPPPPPMCPPPPPP 80 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PP PPPP PPPPPP Sbjct: 52 PPQFCPPPPMCPPPPPPPPPP 72 Score = 31.5 bits (68), Expect = 0.76 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPP P PPPP PPPP Sbjct: 40 PPPLPCPPPPICPPQFCPPPP 60 Score = 31.5 bits (68), Expect = 0.76 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPXPP---PPXXGGGXPPPPPP 434 PPPP PP PP PPPPPP Sbjct: 46 PPPPICPPQFCPPPPMCPPPPPPPP 70 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP P PPPP P PPP Sbjct: 27 PPPCPPPPPPMCAPPPLPCPPP 48 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP PPP P PPPP Sbjct: 28 PPCPPPPPPMCAPPPLPCPPPP 49 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP Sbjct: 27 PPPCPPPPPPMCAPPPLPCPP 47 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP PPPP P PP PP Sbjct: 52 PPQFCPPPPMCPPPPPPPPP 71 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +1 Query: 718 PXXXPPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 P PPP P P PPPPPP Sbjct: 35 PPMCAPPPLPCPPPPICPPQFCPPPPMCPPPPPPPP 70 >U24189-3|AAC47514.1| 398|Caenorhabditis elegans RRM-type RNA binding protein protein. Length = 398 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPP PP P G G PPPPP Sbjct: 375 PPPPSRPPAPPSGHGMIPPPPP 396 Score = 36.7 bits (81), Expect = 0.020 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPP---PXPPPPXXGGGXPPPPPP 434 PP P P PPPP G PPPPPP Sbjct: 288 PPTPGMTPRPPPPPSSGMWPPPPPP 312 Score = 36.7 bits (81), Expect = 0.020 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P GG PPPPPP Sbjct: 328 PPPPPSRFGPPGMGGMPPPPPP 349 Score = 35.9 bits (79), Expect = 0.035 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PP GG PPPPPP Sbjct: 344 PPPPPPGMRYPGGMPPPPPP 363 Score = 35.5 bits (78), Expect = 0.047 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPXP---PPPXXGGGXPPPPPP 434 PPPPP P P P G PPPPPP Sbjct: 308 PPPPPPPGRTPGPPGMPGMPPPPPP 332 Score = 34.3 bits (75), Expect = 0.11 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P P G G PPPPP Sbjct: 358 PPPPPPRYPSAGPGMYPPPPP 378 Score = 33.5 bits (73), Expect = 0.19 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +3 Query: 372 PPPPXPP---PPXXGGGXPPPPP 431 PPPP P PP GG PPPPP Sbjct: 327 PPPPPPSRFGPPGMGGMPPPPPP 349 Score = 33.1 bits (72), Expect = 0.25 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 P PPPP G PPPPPP Sbjct: 295 PRPPPPPSSGMWPPPPPPP 313 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP P GG PPPPP Sbjct: 344 PPPPPPGMRYPGGMPPPPPP 363 Score = 31.5 bits (68), Expect = 0.76 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP P G PPPPP Sbjct: 358 PPPPPPRYPSAGPGMYPPPPP 378 Score = 31.1 bits (67), Expect = 1.0 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPP---PXPPP-PXXGGGXPPPPPP 434 PPPP P PPP P G P PPPP Sbjct: 275 PPPPSVTPMPPPMPPTPGMTPRPPPP 300 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PP P PP PP Sbjct: 312 PPPGRTPGPPGMPGMPPPPPP 332 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 PP PPPP PPP PP Sbjct: 271 PPVPPPPPSVTPMPPPMPP 289 >AF535160-1|AAN33048.1| 468|Caenorhabditis elegans UNC-34 protein. Length = 468 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP G G PPPPPP Sbjct: 234 PPPPPLPP---VGAGAPPPPPP 252 Score = 37.5 bits (83), Expect = 0.012 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP P PP G PPPPPP Sbjct: 234 PPPPPLPPVGAGAPPPPPPP 253 Score = 35.9 bits (79), Expect = 0.035 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PP G PPPPPP Sbjct: 234 PPPPPLPPVGAGAPPPPPPPP 254 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 6/27 (22%) Frame = +3 Query: 369 PPPPPXPPPPXXG------GGXPPPPP 431 P PP PPPP G G PPPPP Sbjct: 212 PQAPPAPPPPIGGIAPVNAHGAPPPPP 238 Score = 29.1 bits (62), Expect = 4.1 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 247 PPPPPPPPPP 256 >AC025722-6|AAO12398.1| 310|Caenorhabditis elegans Uncoordinated protein 34, isoform b protein. Length = 310 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP G G PPPPPP Sbjct: 220 PPPPPLPP---VGAGAPPPPPP 238 Score = 37.5 bits (83), Expect = 0.012 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP P PP G PPPPPP Sbjct: 220 PPPPPLPPVGAGAPPPPPPP 239 Score = 35.9 bits (79), Expect = 0.035 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PP G PPPPPP Sbjct: 220 PPPPPLPPVGAGAPPPPPPPP 240 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 6/27 (22%) Frame = +3 Query: 369 PPPPPXPPPPXXG------GGXPPPPP 431 P PP PPPP G G PPPPP Sbjct: 198 PQAPPAPPPPIGGIAPVNAHGAPPPPP 224 Score = 29.1 bits (62), Expect = 4.1 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 233 PPPPPPPPPP 242 >AC025722-5|AAO12397.1| 454|Caenorhabditis elegans Uncoordinated protein 34, isoform a protein. Length = 454 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP G G PPPPPP Sbjct: 220 PPPPPLPP---VGAGAPPPPPP 238 Score = 37.5 bits (83), Expect = 0.012 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP P PP G PPPPPP Sbjct: 220 PPPPPLPPVGAGAPPPPPPP 239 Score = 35.9 bits (79), Expect = 0.035 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PP G PPPPPP Sbjct: 220 PPPPPLPPVGAGAPPPPPPPP 240 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 6/27 (22%) Frame = +3 Query: 369 PPPPPXPPPPXXG------GGXPPPPP 431 P PP PPPP G G PPPPP Sbjct: 198 PQAPPAPPPPIGGIAPVNAHGAPPPPP 224 Score = 29.1 bits (62), Expect = 4.1 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 233 PPPPPPPPPP 242 >U39852-7|AAK39260.1| 240|Caenorhabditis elegans Ground-like (grd related) protein 6 protein. Length = 240 Score = 37.9 bits (84), Expect = 0.009 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 66 PPPPICPPPPPPPMPCPPPPPP 87 Score = 33.5 bits (73), Expect = 0.19 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP PPPP P PP PP Sbjct: 66 PPPPICPPPPPPPMPCPPPPP 86 Score = 31.5 bits (68), Expect = 0.76 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 718 PXXXPPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 P PPPP P P PPPPPP Sbjct: 52 PVCPPPPPCPAQFCPPPPICPPPPPPPMPCPPPPPP 87 Score = 31.5 bits (68), Expect = 0.76 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPXP----PPPXXGGGXPPPPPP 434 PPPPP P PPP PPPPPP Sbjct: 55 PPPPPCPAQFCPPPPIC--PPPPPPP 78 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PP P PPPP P PP P Sbjct: 68 PPICPPPPPPPMPCPPPPPP 87 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP PPPP PP PP Sbjct: 67 PPPICPPPPPPPMPCPPPPPP 87 >Z78013-1|CAB01425.3| 1140|Caenorhabditis elegans Hypothetical protein F15B9.4 protein. Length = 1140 Score = 37.5 bits (83), Expect = 0.012 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P PP PPP G PPPPPP Sbjct: 536 PTPPPPPPVGMANGGPPPPPP 556 Score = 36.3 bits (80), Expect = 0.027 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 P PPP PP GG PPPPP Sbjct: 536 PTPPPPPPVGMANGGPPPPPP 556 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPPPXP--PPPXXGGGXPPPPPP 434 PPPPP P P G PPPPPP Sbjct: 520 PPPPPMPGMAPLSTGAPTPPPPPP 543 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P GG PPPP P Sbjct: 538 PPPPPPVGMANGGPPPPPPLP 558 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 PP PP P G P PPPP Sbjct: 488 PPPPPMPSINGHAPNPPPP 506 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP P PPPPP Sbjct: 488 PPPPPMPSINGHAPNPPPPPP 508 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP P P G PPPPP Sbjct: 488 PPPPPMPSINGHAPNPPPPP 507 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 9/31 (29%) Frame = +3 Query: 369 PPPPPXPPPPXXG---------GGXPPPPPP 434 PPPPP P G GG PPPPPP Sbjct: 552 PPPPPLPLDLLKGAVAGLKSVPGGPPPPPPP 582 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 3/23 (13%) Frame = +3 Query: 372 PPPPXPPP---PXXGGGXPPPPP 431 PPPP PP P PPPPP Sbjct: 470 PPPPGPPSSLLPLINTNAPPPPP 492 Score = 29.1 bits (62), Expect = 4.1 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 576 PPPPPPPPPP 585 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPP 422 PPPPP PPP G P Sbjct: 577 PPPPPPPPPSFMFNGKVP 594 >U50310-5|AAA92541.1| 318|Caenorhabditis elegans Ground-like (grd related) protein 9 protein. Length = 318 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 134 PPPPPSPPPP------PPPPPP 149 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP PP PP Sbjct: 134 PPPPPSPPPP-----PPPPPP 149 >U23515-9|AAP82644.1| 360|Caenorhabditis elegans Hypothetical protein R144.4a protein. Length = 360 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 2 PPPPPPPPPP------PPPPPP 17 Score = 37.1 bits (82), Expect = 0.015 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP P PPPP Sbjct: 155 PPPPPPPPPVSVPSSKPTPPPP 176 Score = 36.3 bits (80), Expect = 0.027 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPP 425 PPPPP PPPP PPP Sbjct: 6 PPPPPPPPPPPPAASAPPP 24 Score = 35.1 bits (77), Expect = 0.062 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPPPP PPPP PPP Sbjct: 5 PPPPPPPPPPPPPAASAPPP 24 Score = 33.9 bits (74), Expect = 0.14 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP PPP Sbjct: 4 PPPPPPPPPPPPPPAASAPPP 24 Score = 33.9 bits (74), Expect = 0.14 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP PPPPP Sbjct: 156 PPPPPPPPVSVPSSKPTPPPPP 177 Score = 31.5 bits (68), Expect = 0.76 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PPPP P P P Sbjct: 5 PPPPPPPPPPPPPAASAPPP 24 Score = 31.1 bits (67), Expect = 1.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP Sbjct: 3 PPPPPPPPPPPPPPPAASAPP 23 Score = 31.1 bits (67), Expect = 1.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP Sbjct: 4 PPPPPPPPPPPPPPAASAPPP 24 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP P P PP Sbjct: 155 PPPPPPPPPVSVPSSKPTPPP 175 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP PP PP Sbjct: 2 PPPPPPPPPP-----PPPPPP 17 >U23515-8|AAP82645.1| 362|Caenorhabditis elegans Hypothetical protein R144.4b protein. Length = 362 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 2 PPPPPPPPPP------PPPPPP 17 Score = 37.1 bits (82), Expect = 0.015 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP P PPPP Sbjct: 155 PPPPPPPPPVSVPSSKPTPPPP 176 Score = 36.3 bits (80), Expect = 0.027 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPP 425 PPPPP PPPP PPP Sbjct: 6 PPPPPPPPPPPPAASAPPP 24 Score = 35.1 bits (77), Expect = 0.062 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPPPP PPPP PPP Sbjct: 5 PPPPPPPPPPPPPAASAPPP 24 Score = 33.9 bits (74), Expect = 0.14 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP PPP Sbjct: 4 PPPPPPPPPPPPPPAASAPPP 24 Score = 33.9 bits (74), Expect = 0.14 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP PPPPP Sbjct: 156 PPPPPPPPVSVPSSKPTPPPPP 177 Score = 31.5 bits (68), Expect = 0.76 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PPPP P P P Sbjct: 5 PPPPPPPPPPPPPAASAPPP 24 Score = 31.1 bits (67), Expect = 1.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP Sbjct: 3 PPPPPPPPPPPPPPPAASAPP 23 Score = 31.1 bits (67), Expect = 1.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP P PP Sbjct: 4 PPPPPPPPPPPPPPAASAPPP 24 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP P P PP Sbjct: 155 PPPPPPPPPVSVPSSKPTPPP 175 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP PP PP Sbjct: 2 PPPPPPPPPP-----PPPPPP 17 >AC025721-11|AAK29900.1| 78|Caenorhabditis elegans Hypothetical protein Y48G8AL.12 protein. Length = 78 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 3/23 (13%) Frame = +3 Query: 369 PPPPPX---PPPPXXGGGXPPPP 428 PPPPP PP P GGG PPPP Sbjct: 34 PPPPPACAPPPAPACGGGAPPPP 56 >U88314-13|ABR92611.1| 1346|Caenorhabditis elegans Formin homology domain protein 1 protein. Length = 1346 Score = 36.7 bits (81), Expect = 0.020 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 2/23 (8%) Frame = +3 Query: 369 PPPPPX--PPPPXXGGGXPPPPP 431 PPPPP P PP GG PPPPP Sbjct: 772 PPPPPSAIPLPPRLQGGIPPPPP 794 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 13/35 (37%) Frame = +3 Query: 369 PPPPPXP-------------PPPXXGGGXPPPPPP 434 PPPPP P PPP G PPPPPP Sbjct: 770 PPPPPPPSAIPLPPRLQGGIPPPPPLGIIPPPPPP 804 >AB084086-1|BAC67013.1| 1346|Caenorhabditis elegans Formactin protein. Length = 1346 Score = 36.7 bits (81), Expect = 0.020 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 2/23 (8%) Frame = +3 Query: 369 PPPPPX--PPPPXXGGGXPPPPP 431 PPPPP P PP GG PPPPP Sbjct: 772 PPPPPSAIPLPPRLQGGIPPPPP 794 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 13/35 (37%) Frame = +3 Query: 369 PPPPPXP-------------PPPXXGGGXPPPPPP 434 PPPPP P PPP G PPPPPP Sbjct: 770 PPPPPPPSAIPLPPRLQGGIPPPPPLGIIPPPPPP 804 >Z83219-3|CAD57687.1| 965|Caenorhabditis elegans Hypothetical protein C31C9.6 protein. Length = 965 Score = 36.3 bits (80), Expect = 0.027 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP PPPPPP Sbjct: 490 PPPPPLPPIATPSSVPPPPPPP 511 Score = 35.9 bits (79), Expect = 0.035 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP PPPPPP Sbjct: 489 PPPPPPLPPIATPSSVPPPPPP 510 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PP P PP PP Sbjct: 489 PPPPPPLPPIATPSSVPPPPP 509 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 P P P P P PPPPP Sbjct: 474 PNPSPSPQPAEVSKSPPPPPP 494 >Z81053-1|CAB02877.1| 385|Caenorhabditis elegans Hypothetical protein E02A10.2 protein. Length = 385 Score = 36.3 bits (80), Expect = 0.027 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 26 GGGGGGCGGGCGGGGGCGGGGG 47 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG PPP GGG GGGGG Sbjct: 49 GGGCAPPPPPPACGGGCGGGGG 70 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG PPP GGG GGGGG Sbjct: 106 GGGCAPPPPPPACGGGCGGGGG 127 Score = 33.5 bits (73), Expect = 0.19 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 134 GGGGGGGCGGGGGGGCGGGGG 154 Score = 33.1 bits (72), Expect = 0.25 Identities = 16/26 (61%), Positives = 16/26 (61%), Gaps = 4/26 (15%) Frame = -3 Query: 433 GGGGGGX----PPPXXGGGGXGGGGG 368 GG GGG PPP GGG GGGGG Sbjct: 46 GGCGGGCAPPPPPPACGGGCGGGGGG 71 Score = 33.1 bits (72), Expect = 0.25 Identities = 16/26 (61%), Positives = 16/26 (61%), Gaps = 4/26 (15%) Frame = -3 Query: 433 GGGGGGX----PPPXXGGGGXGGGGG 368 GG GGG PPP GGG GGGGG Sbjct: 103 GGCGGGCAPPPPPPACGGGCGGGGGG 128 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 66 GGGGGGC---GGGGGGCGGGGG 84 Score = 32.7 bits (71), Expect = 0.33 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGGG Sbjct: 69 GGGCGGGGGGCGGGGGCGGGGG 90 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 86 GGGGGGC---GGGGGGCGGGGG 104 Score = 32.7 bits (71), Expect = 0.33 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 123 GGGGGGCGGGCGGGGGGGCGGG 144 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 143 GGGGGGC---GGGGGGCGGGGG 161 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 150 GGGGGGC---GGGGGGCGGGGG 168 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 157 GGGGGGC---GGGGGGCGGGGG 175 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 164 GGGGGGCG--GGGGGGCGGGGG 183 Score = 32.3 bits (70), Expect = 0.44 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGG Sbjct: 25 GGGGGGGCGGGCGGGGGCGGGG 46 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 27 GGGGGCGGGCGGGGGCGGGGG 47 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 70 GGCGGGGGGCGGGGGCGGGGG 90 Score = 32.3 bits (70), Expect = 0.44 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGGG Sbjct: 76 GGGCGGGGGCGGGGGGCGGGGG 97 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 124 GGGGGCGGGCGGGGGGGCGGG 144 Score = 32.3 bits (70), Expect = 0.44 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGGG Sbjct: 125 GGGGCGGGCGGGGGGGCGGGGG 146 Score = 32.3 bits (70), Expect = 0.44 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 134 GGGGGGGCGGGGGGGCGGGGGG 155 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 134 GGGGGGGCGGGGGGGCGGGGG 154 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 139 GGCGGGGGGGCGGGGGGCGGG 159 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 161 GGCGGGGGGCGGGGGGGCGGG 181 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GG G GGGG Sbjct: 142 GGGGGGGCGGGGGGCGGGGGG 162 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GGGGG Sbjct: 142 GGGGGGGCGGGGGGCGGGGGG 162 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GG G GGGGG Sbjct: 157 GGGGGGCGGGGGGCGGGGGGG 177 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 164 GGGGGGCGGGGGGGCGGGGG 183 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGG G Sbjct: 171 GGGGGGGCGGGGGGGCGGGCG 191 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGG Sbjct: 62 GGGCGGGGGGCGGGGGGCGGGG 83 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGG Sbjct: 68 GGGGCGGGGGGCGGGGGCGGGG 89 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 73 GGGGGGC---GGGGGCGGGGGG 91 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG G GGG Sbjct: 74 GGGGGCGGGGGCGGGGGGCGGG 95 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGG Sbjct: 75 GGGGCGGGGGCGGGGGGCGGGG 96 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG G GGG Sbjct: 81 GGGGCGGGGGGCGGGGGGCGGG 102 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGG Sbjct: 82 GGGCGGGGGGCGGGGGGCGGGG 103 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GG G GGGGG Sbjct: 119 GGGCGGGGGGCGGGCGGGGGGG 140 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GG GG Sbjct: 130 GGGCGGGGGGGCGGGGGGGCGG 151 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG G GGG Sbjct: 138 GGGCGGGGGGGCGGGGGGCGGG 159 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG G GGG Sbjct: 145 GGGGCGGGGGGCGGGGGGCGGG 166 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGG Sbjct: 146 GGGCGGGGGGCGGGGGGCGGGG 167 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG G GGG Sbjct: 152 GGGGCGGGGGGCGGGGGGCGGG 173 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGG Sbjct: 153 GGGCGGGGGGCGGGGGGCGGGG 174 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GG GG Sbjct: 159 GGGGCGGGGGGCGGGGGGGCGG 180 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG G GGG Sbjct: 160 GGGCGGGGGGCGGGGGGGCGGG 181 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GG GG Sbjct: 167 GGGCGGGGGGGCGGGGGGGCGG 188 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG G GGG Sbjct: 171 GGGGGGG---CGGGGGGGCGGG 189 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GG GG Sbjct: 23 GGGGGGGGGCGGGCGGGGGCGG 44 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG G GGG Sbjct: 24 GGGGGGGGCGGGCGGGGGCGGG 45 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 25 GGGGGGGCGGGCGGGGGCGGG 45 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 26 GGGGGGCGGGCGGGGGCGGGG 46 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 62 GGGCGGGGGGCGGGGGGCGGG 82 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 63 GGCGGGGGGCGGGGGGCGGGG 83 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 75 GGGGCGGGGGCGGGGGGCGGG 95 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGGG Sbjct: 77 GGCGGGGGCGGGGGGCGGGGGG 98 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 77 GGCGGGGGCGGGGGGCGGGGG 97 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 82 GGGCGGGGGGCGGGGGGCGGG 102 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 83 GGCGGGGGGCGGGGGGCGGGG 103 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 126 GGGCGGGCGGGGGGGCGGGGG 146 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 127 GGCGGGCGGGGGGGCGGGGGG 147 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 132 GCGGGGGGGCGGGGGGGCGGG 152 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 135 GGGGGGCGGGGGGGCGGGGGG 155 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 142 GGGGGGGCGGGGGGCGGGGGG 162 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 146 GGGCGGGGGGCGGGGGGCGGG 166 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 147 GGCGGGGGGCGGGGGGCGGGG 167 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 153 GGGCGGGGGGCGGGGGGCGGG 173 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 154 GGCGGGGGGCGGGGGGCGGGG 174 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 164 GGGGGGCGGGGGGGCGGGGGG 184 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 169 GCGGGGGGGCGGGGGGGCGGG 189 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = -1 Query: 381 GGXGGXXXGXXG-GGGXGXGGG 319 GG GG G G GGG G GGG Sbjct: 30 GGCGGGCGGGGGCGGGGGCGGG 51 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 66 GGGGGGCGG--GGGGCGGGGG 84 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = -1 Query: 381 GGXGGXXXGXXG-GGGXGXGGG 319 GG GG G G GGG G GGG Sbjct: 67 GGGGGCGGGGGGCGGGGGCGGG 88 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 86 GGGGGGCGG--GGGGCGGGGG 104 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = -1 Query: 381 GGXGGXXXGXXG-GGGXGXGGG 319 GG GG G G GGG G GGG Sbjct: 87 GGGGGCGGGGGGCGGGGGCGGG 108 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 GGG GG GGGG GGG Sbjct: 89 GGGCGGGGGGCGGGGGCGGG 108 >Z81034-4|CAB02729.1| 541|Caenorhabditis elegans Hypothetical protein C15C6.3 protein. Length = 541 Score = 36.3 bits (80), Expect = 0.027 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPP PPPPP Sbjct: 476 PPPPPPPPPENEPEEFPPPPP 496 Score = 35.1 bits (77), Expect = 0.062 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP PPPP PPPPP Sbjct: 476 PPPPPPPPPENEPEEFPPPPP 496 Score = 34.3 bits (75), Expect = 0.11 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPP P PP PP Sbjct: 476 PPPPPPPPPENEPEEFPPPPP 496 >U58755-7|AAB00696.1| 136|Caenorhabditis elegans Hypothetical protein C34D4.11 protein. Length = 136 Score = 36.3 bits (80), Expect = 0.027 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 95 GGGGGGGGGRGGGGGGRGGGGG 116 Score = 36.3 bits (80), Expect = 0.027 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 105 GGGGGGRGGGGGGGGGRGGGGG 126 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 88 GNGGGGRGGGGGGGGGRGGGGG 109 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGGG Sbjct: 112 GGGGGGGGGRGGGGGGRGGGG 132 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 96 GGGGGGGGRGGGGGGRGGGGGG 117 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGGGG Sbjct: 97 GGGGGGGRGGGGGGRGGGGGGG 118 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGGG Sbjct: 98 GGGGGGRGGGGGGRGGGGGGGG 119 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 87 GGNGGGGRGGGGGGGGGRGGG 107 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 106 GGGGGRGGGGGGGGGRGGGGG 126 Score = 31.5 bits (68), Expect = 0.76 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 G GGGG GGGG GGGG Sbjct: 83 GNGGGGNGGGGRGGGGGGGGG 103 Score = 31.1 bits (67), Expect = 1.0 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGG--GGXPPPXXGGGGXGGGGG 368 GGGG GG GGGG GGGGG Sbjct: 76 GGGGNWGGNGGGGNGGGGRGGGGG 99 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGGG Sbjct: 82 GGNGGGGNGGGGRGGGGGGGGG 103 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GG GG Sbjct: 85 GGGGNGGGGRGGGGGGGGGRGG 106 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG G GGG Sbjct: 86 GGGNGGGGRGGGGGGGGGRGGG 107 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGG Sbjct: 87 GGNGGGGRGGGGGGGGGRGGGG 108 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G GGGG GGGG Sbjct: 100 GGGGRGGGGGGRGGGGGGGGG 120 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGG Sbjct: 112 GGGGGGGGGRGGGGGGRGGGG 132 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 G GGG P GGGG G GGG Sbjct: 47 GWGGGGPGWGRGGGGSGWGGG 67 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 79 GNWGGNGGGGNGGGGRGGGGG 99 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 90 GGGGRGGGGGGGGGRGGGGG 109 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG G GGG Sbjct: 93 GRGGGGGGGGGRGGGGGGRGGG 114 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 95 GGGGGGGGGRGGGGGGRGGG 114 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGG G Sbjct: 101 GGGRGGGGGGRGGGGGGGGGRG 122 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GG GG Sbjct: 102 GGRGGGGGGRGGGGGGGGGRGG 123 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG G GGG Sbjct: 103 GRGGGGGGRGGGGGGGGGRGGG 124 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 105 GGGGGGRGGGGGGGGGRGGG 124 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG G GGG Sbjct: 110 GRGGGGGGGGGRGGGGGGRGGG 131 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 112 GGGGGGGGGRGGGGGGRGGG 131 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGG G Sbjct: 113 GGGGGGGGRGGGGGGRGGGGRG 134 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 95 GGGGGGGGGRGGGGGGRGGGG 115 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 96 GGGGGGGGRGGGGGGRGGGGG 116 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 97 GGGGGGGRGGGGGGRGGGGGG 117 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 105 GGGGGGRGGGGGGGGGRGGGG 125 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 112 GGGGGGGGGRGGGGGGRGGGG 132 Score = 28.3 bits (60), Expect = 7.1 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXG---GGGG 368 GG GG P GGGG G GGGG Sbjct: 37 GGRSGGWGRPGWGGGGPGWGRGGGG 61 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GG G GGGG Sbjct: 58 GGGGSGWGGGRGGGWGNNGGGG 79 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 G GGG GGGG GGGG Sbjct: 73 GNNGGGGNWGGNGGGGNGGGG 93 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = -1 Query: 381 GGXGGXXXGXXG-GGGXGXGGG 319 GG GG G G GGG G GGG Sbjct: 82 GGNGGGGNGGGGRGGGGGGGGG 103 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = -1 Query: 381 GGXGGXXXGXXG-GGGXGXGGG 319 GG GG G G GGG G GGG Sbjct: 99 GGGGGRGGGGGGRGGGGGGGGG 120 >U10438-9|AAU87834.1| 616|Caenorhabditis elegans Hypothetical protein B0280.13 protein. Length = 616 Score = 36.3 bits (80), Expect = 0.027 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP PPPPPP Sbjct: 497 PPPPPLPPIATPSSVPPPPPPP 518 Score = 35.9 bits (79), Expect = 0.035 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP PPPPPP Sbjct: 496 PPPPPPLPPIATPSSVPPPPPP 517 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPPPP PPPP PP Sbjct: 514 PPPPPPPPPPALEQEISGPP 533 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PP P PP PP Sbjct: 496 PPPPPPLPPIATPSSVPPPPP 516 Score = 29.1 bits (62), Expect = 4.1 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 512 PPPPPPPPPP 521 Score = 29.1 bits (62), Expect = 4.1 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 513 PPPPPPPPPP 522 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 3/24 (12%) Frame = +2 Query: 320 PPPXPXPP---PPXXPXXXPPXPP 382 PPP P PP P P PP PP Sbjct: 497 PPPPPLPPIATPSSVPPPPPPPPP 520 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 P P P P P PPPPP Sbjct: 481 PNPSPSPQPAEVSKSPPPPPP 501 >AF106580-3|AAC78205.1| 881|Caenorhabditis elegans Temporarily assigned gene nameprotein 268 protein. Length = 881 Score = 36.3 bits (80), Expect = 0.027 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PPPP PPPPP Sbjct: 84 PPPPPPPPPPTLKA--PPPPP 102 Score = 35.1 bits (77), Expect = 0.062 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = +3 Query: 372 PPPPXPPPPXXG--GGXPPPPPP 434 PPPP PPPP PPPPPP Sbjct: 67 PPPPPPPPPLISILQQAPPPPPP 89 Score = 34.7 bits (76), Expect = 0.082 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPPPXPPP--PXXGGGXPPPPPP 434 PPPPP PPP PPPPPP Sbjct: 67 PPPPPPPPPLISILQQAPPPPPPP 90 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PPPP PP PP Sbjct: 84 PPPPPPPPPP--TLKAPPPPP 102 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 PP PPPP PPPPP Sbjct: 84 PPPPPPPPPPTLKAPPPPP 102 >Z78013-8|CAN99686.1| 373|Caenorhabditis elegans Hypothetical protein F15B9.10 protein. Length = 373 Score = 35.5 bits (78), Expect = 0.047 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG PPP GGGG G GG Sbjct: 267 GGGGYPQPPPQQGGGGGGAGG 287 Score = 34.7 bits (76), Expect = 0.082 Identities = 15/22 (68%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -3 Query: 430 GGGGGXP-PPXXGGGGXGGGGG 368 GGGGG P PP GGG GG GG Sbjct: 266 GGGGGYPQPPPQQGGGGGGAGG 287 >AL117204-20|CAB55136.2| 699|Caenorhabditis elegans Hypothetical protein Y116A8C.32 protein. Length = 699 Score = 35.5 bits (78), Expect = 0.047 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 P P PPP GG PPPPPP Sbjct: 660 PMPVPPPGGLGGFMPPPPPP 679 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPXPPPPXXGG---GXPPPPPP 434 PPPPP PP P PPPPP Sbjct: 674 PPPPPPPPMPGDLSSLLAAAPPPPP 698 >AJ243905-1|CAB64866.1| 699|Caenorhabditis elegans SF1 protein protein. Length = 699 Score = 35.5 bits (78), Expect = 0.047 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 P P PPP GG PPPPPP Sbjct: 660 PMPVPPPGGLGGFMPPPPPP 679 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +3 Query: 369 PPPPPXPPPPXXGG---GXPPPPPP 434 PPPPP PP P PPPPP Sbjct: 674 PPPPPPPPMPGDLSSLLAAAPPPPP 698 >Z93393-1|CAB07688.1| 497|Caenorhabditis elegans Hypothetical protein Y48E1B.1 protein. Length = 497 Score = 34.7 bits (76), Expect = 0.082 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP PPPP PPPPPP Sbjct: 354 PPAPPPPPPP-----PPPPPPP 370 Score = 31.5 bits (68), Expect = 0.76 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PPPP P PP P Sbjct: 354 PPAPPPPPPPPPPPPPPQTP 373 Score = 29.5 bits (63), Expect = 3.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXP 370 PPP P PPPP P P Sbjct: 357 PPPPPPPPPPPPPPQTP 373 Score = 28.3 bits (60), Expect = 7.1 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PP P PPPP P P P Sbjct: 354 PPAPPPPPPPPPPPPPPQTP 373 >AF067612-1|AAD36954.1| 780|Caenorhabditis elegans Egg laying defective protein 4,isoform a protein. Length = 780 Score = 34.7 bits (76), Expect = 0.082 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 11 GGGGGGGASGGAGGGAPGGGGG 32 Score = 31.5 bits (68), Expect = 0.76 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGG Sbjct: 10 GGGGGGGGASGGAGGGAPGGGG 31 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG GGGGG Sbjct: 12 GGGGGGASGGAGGGAPGGGGGG 33 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 12 GGGGGGASGGAGGGAPGGGGG 32 >AF000198-8|AAP68908.1| 435|Caenorhabditis elegans Collagen protein 51 protein. Length = 435 Score = 34.7 bits (76), Expect = 0.082 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 103 GGGGGYAAGGGGGGGGGGGGG 123 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/24 (66%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGX--GGGGG 368 GGGGGG P GGGG GGGGG Sbjct: 320 GGGGGGDFPAGGGGGGYSTGGGGG 343 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 103 GGGGGYAAGGGGGGGGGGGGGG 124 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 103 GGGGGYAAGGGGGGGGGGGGG 123 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG GGGGG Sbjct: 363 GGGGGGGGAAAGGGYNAGGGGG 384 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGG Sbjct: 362 GGGGGGGGGAAAGGGYNAGGGG 383 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP PP GG P PP Sbjct: 256 PPGPPGPPGQDGSGGAAQPGPP 277 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GGGGG Sbjct: 364 GGGGGGGAAAGGGYNAGGGGGG 385 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 104 GGGGYAAGGGGGGGGGGGGGG 124 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GG GG GG Sbjct: 339 GGGGGRADSGGAAGGAGGAGG 359 >Z68008-5|CAD91696.1| 1160|Caenorhabditis elegans Hypothetical protein R08B4.1b protein. Length = 1160 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 788 GGGGGGNGGSGGGGGGGGGGSG 809 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGGG Sbjct: 787 GGGGGGGNGGSGGGGGGGGGG 807 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 787 GGGGGGGNGGSGGGGGGGGGG 807 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 787 GGGGGGGNGGSGGGGGGGGGG 807 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGG Sbjct: 809 GGSGGGGSNSNSGGGGGNGGGG 830 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 821 GGGGGNGGGGNGGGGNGNGGG 841 Score = 31.9 bits (69), Expect = 0.58 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GG GG Sbjct: 789 GGGGGNGGSGGGGGGGGGGSGG 810 Score = 31.5 bits (68), Expect = 0.76 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG G GGG Sbjct: 821 GGGGGNGGGGNGGGGNGNGGG 841 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGG----XGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 800 GGGGGGGGSGGSGGGGSNSNSGGGGG 825 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GG G Sbjct: 791 GGGNGGSGGGGGGGGGGSGGSG 812 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GG GGG G GG GGGG Sbjct: 795 GGSGGGGGGGGGGSGGSGGGG 815 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GG GG Sbjct: 798 GGGGGG------GGGGSGGSGG 813 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GG G GGG G Sbjct: 822 GGGGNGGGGNGGGGNGNGGGAG 843 >Z68008-4|CAA92000.4| 1137|Caenorhabditis elegans Hypothetical protein R08B4.1a protein. Length = 1137 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGGG Sbjct: 787 GGGGGGSNSNSGGGGGNGGGG 807 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGG Sbjct: 787 GGGGGGSNSNSGGGGGNGGGG 807 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 798 GGGGGNGGGGNGGGGNGNGGG 818 Score = 31.5 bits (68), Expect = 0.76 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG G GGG Sbjct: 798 GGGGGNGGGGNGGGGNGNGGG 818 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GGG G Sbjct: 788 GGGGGSNSNSGGGGGNGGGGNG 809 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GG G GGG G Sbjct: 799 GGGGNGGGGNGGGGNGNGGGAG 820 >AL132860-21|CAB60518.2| 759|Caenorhabditis elegans Hypothetical protein Y56A3A.27 protein. Length = 759 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG PP GGGG GG G Sbjct: 620 GPGGGGGPPRGPGGGGGGGPTG 641 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 GG GGG PP GGG GGG Sbjct: 619 GGPGGGGGPPRGPGGGGGGG 638 >AL117204-23|CAB55137.1| 285|Caenorhabditis elegans Hypothetical protein Y116A8C.35 protein. Length = 285 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 217 GGGGGGGGGGYGSGGGWGGGGG 238 Score = 32.7 bits (71), Expect = 0.33 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 218 GGGGGGGGGYGSGGGWGGGGGG 239 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGG Sbjct: 216 GGGGGGGGGGGYGSGGGWGGGG 237 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGG G Sbjct: 234 GGGGGGRDRDRGGWGGGGGGRG 255 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 218 GGGGGGGGGYGSGGGWGGGGG 238 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGX---GGGGG 368 GGGGGG GGGG GGGGG Sbjct: 248 GGGGGGRGYGGGGGGGGYGYGGGGG 272 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGG G Sbjct: 245 GGWGGGGGGRGYGGGGGGGGYG 266 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 250 GGGGRGYGGGGGGGGYGYGGG 270 Score = 28.3 bits (60), Expect = 7.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 213 GGSGGGGGGG-GGGGYGSGGG 232 >AF057032-1|AAC13567.1| 759|Caenorhabditis elegans DNA topoisomerase III protein. Length = 759 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG PP GGGG GG G Sbjct: 620 GPGGGGGPPRGPGGGGGGGPTG 641 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 GG GGG PP GGG GGG Sbjct: 619 GGPGGGGGPPRGPGGGGGGG 638 >Z82095-2|CAB05027.2| 602|Caenorhabditis elegans Hypothetical protein ZK849.4 protein. Length = 602 Score = 33.5 bits (73), Expect = 0.19 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP PP PPPPPP Sbjct: 484 PPSPPALPPALPNPNEPPPPPP 505 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PP PP PPPPPP Sbjct: 485 PSPPALPPALPNPNEPPPPPPP 506 >Z81124-1|CAB03369.1| 312|Caenorhabditis elegans Hypothetical protein T21B4.2 protein. Length = 312 Score = 33.5 bits (73), Expect = 0.19 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GGGGG Sbjct: 97 GAGGGGGGGYATGGGGGGGGGG 118 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGGG Sbjct: 96 GGAGGGGGGGYATGGGGGGGGG 117 >Z77655-1|CAB01137.1| 393|Caenorhabditis elegans Hypothetical protein C56A3.1 protein. Length = 393 Score = 33.5 bits (73), Expect = 0.19 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 109 GGGGGGGCGGGGGGGCGGGGG 129 Score = 32.7 bits (71), Expect = 0.33 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGGG Sbjct: 92 GGGCGGGGGGCGGGGGCGGGGG 113 Score = 32.7 bits (71), Expect = 0.33 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGGGG Sbjct: 110 GGGGGGCGGGGGGGCGGGGGGG 131 Score = 32.7 bits (71), Expect = 0.33 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGGG Sbjct: 113 GGGCGGGGGGGCGGGGGGGGGG 134 Score = 32.3 bits (70), Expect = 0.44 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGGG Sbjct: 86 GGGGCGGGGCGGGGGGCGGGGG 107 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 93 GGCGGGGGGCGGGGGCGGGGG 113 Score = 32.3 bits (70), Expect = 0.44 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 100 GGCGGGGGCGGGGGGGCGGGGG 121 Score = 32.3 bits (70), Expect = 0.44 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 109 GGGGGGGCGGGGGGGCGGGGGG 130 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 109 GGGGGGGCGGGGGGGCGGGGG 129 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 114 GGCGGGGGGGCGGGGGGGGGG 134 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GG G GGGGG Sbjct: 103 GGGGGCGGGGGGGCGGGGGGG 123 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 378 GXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 86 GGGGCGGGGCGGGGGGCGGG 105 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGGG Sbjct: 91 GGGGCGGGGGGCGGGGGCGGGG 112 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 96 GGGGGGC---GGGGGCGGGGGG 114 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GG GG Sbjct: 97 GGGGGCGGGGGCGGGGGGGCGG 118 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG G GGG Sbjct: 98 GGGGCGGGGGCGGGGGGGCGGG 119 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GG GG Sbjct: 105 GGGCGGGGGGGCGGGGGGGCGG 126 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGG Sbjct: 99 GGGCGGGGGCGGGGGGGCGGGG 120 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 99 GGGCGGGGGCGGGGGGGCGGG 119 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGG GGGGG Sbjct: 101 GCGGGGGCGGGGGGGCGGGGGG 122 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 101 GCGGGGGCGGGGGGGCGGGGG 121 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 107 GCGGGGGGGCGGGGGGGCGGG 127 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 110 GGGGGGCGGGGGGGCGGGGGG 130 Score = 28.3 bits (60), Expect = 7.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 88 GGCGGGGCGG-GGGGCGGGGG 107 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GG Sbjct: 118 GGGGGGCGGGGGGGGGGYASGG 139 >U64609-7|AAB04604.3| 373|Caenorhabditis elegans Sperm-specific family, class qprotein 4 protein. Length = 373 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/26 (61%), Positives = 16/26 (61%), Gaps = 4/26 (15%) Frame = -3 Query: 433 GGGGGGXPPP----XXGGGGXGGGGG 368 GGGGGG P GGGG GGGGG Sbjct: 338 GGGGGGIPGQSVYMGAGGGGGGGGGG 363 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = -3 Query: 433 GGG----GGGXPPPXXGGGGXGGGGG 368 GGG GG PPP G GGGGG Sbjct: 271 GGGPSAFGGAPPPPSGSAMGGGGGGG 296 Score = 24.2 bits (50), Expect(2) = 8.2 Identities = 11/20 (55%), Positives = 11/20 (55%), Gaps = 3/20 (15%) Frame = -3 Query: 427 GGGGXPPPXXG---GGGXGG 377 GGGG PPP G G GG Sbjct: 38 GGGGAPPPGVSCYLGAGAGG 57 Score = 22.2 bits (45), Expect(2) = 8.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -3 Query: 397 GGGGXGGGGG 368 GGG GGGGG Sbjct: 70 GGGPVGGGGG 79 >AF000193-3|AAB52890.1| 259|Caenorhabditis elegans Hypothetical protein T20B6.3 protein. Length = 259 Score = 33.5 bits (73), Expect = 0.19 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GGGG Sbjct: 154 GGGGGGGDFGGYGGGGMGGGG 174 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGG GG GGGG GGGG Sbjct: 172 GGGYGGGGDGGYGGGGFGGGG 192 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG P GGG G GGG Sbjct: 217 GGGDGGYGPSGGYGGGYGPGGG 238 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 G GGGG GGGG GGGG Sbjct: 108 GMGGGGYGGGGYGGGGDGGGG 128 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GG GGG GGGG GGGG Sbjct: 194 GGYGGGMGGGGYGGGGMGGGG 214 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 G GGGG GGGG GGGG Sbjct: 199 GMGGGGYGGGGMGGGGYGGGG 219 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GG GG Sbjct: 177 GGGDGGYGGGGFGGGGMGGYGG 198 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGG G GGGG GGGG Sbjct: 189 GGGGMGGYGGGMGGGGYGGGG 209 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 G GGGG GGGG GGGG Sbjct: 98 GYGGGGDFGGGMGGGGYGGGG 118 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GG GG Sbjct: 121 GGGDGGGGYGGYGGGGYGGMGG 142 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GG GG Sbjct: 113 GYGGGGYGGGGDGGGGYGGYGG 134 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGGG GG GG Sbjct: 164 GYGGGGMGGGGYGGGGDGGYGG 185 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P G G GGGGG Sbjct: 227 GGYGGGYGPGGGYGMGGGGGGG 248 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGG P G GG GGGGG Sbjct: 228 GYGGGYGPGGGYGMGGGGGGGG 249 Score = 28.7 bits (61), Expect = 5.4 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = -3 Query: 433 GGG--GGGXPPPXXGGGGXGGGG 371 GGG GGG GGGG GGGG Sbjct: 101 GGGDFGGGMGGGGYGGGGYGGGG 123 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GG G GGGGG Sbjct: 138 GGMGGGPGGYGMGGYGGGGGGG 159 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGG Sbjct: 153 GGGGGGGGDFGGYGGGGMGGGG 174 Score = 28.7 bits (61), Expect = 5.4 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = -3 Query: 433 GGGG--GGXPPPXXGGGGXGGGG 371 GGGG GG GGGG GGGG Sbjct: 157 GGGGDFGGYGGGGMGGGGYGGGG 179 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 GGG GG GGGG GGG Sbjct: 141 GGGPGGYGMGGYGGGGGGGG 160 Score = 28.3 bits (60), Expect = 7.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGG G Sbjct: 155 GGGGGGDFGGYGGGGMGGGGYG 176 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGX-GXGGG 319 GG GG G GGGG G GGG Sbjct: 122 GGDGGGGYGGYGGGGYGGMGGG 143 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGX-GXGGG 319 GG GG G GGGG G GGG Sbjct: 178 GGDGGYGGGGFGGGGMGGYGGG 199 >Z81555-7|CAB04518.1| 561|Caenorhabditis elegans Hypothetical protein F58E10.3a protein. Length = 561 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGGGG Sbjct: 30 GGGGGGYSGGRGGGYGGGGGGG 51 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 46 GGGGGGYGGGGYGGGGRGGGRG 67 Score = 31.9 bits (69), Expect = 0.58 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 13 GGSSGGGSRGGYGGGGRGGGGG 34 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGG GG GGGG GGGG Sbjct: 41 GGGYGGGGGGGYGGGGYGGGG 61 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 14 GSSGGGSRGGYGGGGRGGGGG 34 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 30 GGGGGGYSGGRGGGYGGGGGG 50 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 35 GYSGGRGGGYGGGGGGGYGGG 55 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGG GGG GGGGG Sbjct: 14 GSSGGGSRGGYGGGGRGGGGGG 35 >U53153-1|AAC69039.4| 715|Caenorhabditis elegans Hypothetical protein T19A5.3a protein. Length = 715 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG GGGGG Sbjct: 481 GGGGGGGGFGGGGGGFGGGGG 501 Score = 31.9 bits (69), Expect = 0.58 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 481 GGGGGGGGFGGGGGGFGGGGGG 502 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GG G GGGG GGGGG Sbjct: 473 GAGGFGSFGGGGGGGGFGGGGG 494 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGG G Sbjct: 483 GGGGGGFGGGGGGFGGGGGGFG 504 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG GGGG G GGG Sbjct: 481 GGGGGGGGFGGGGGGFGGGGG 501 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 482 GGGGGGGFGGGGGGFGGGGGG 502 >L25598-4|AAV58888.1| 737|Caenorhabditis elegans Calpain family protein 1, isoform b protein. Length = 737 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGGG Sbjct: 57 GGGGGGGGGFGGGNGGFGGGGG 78 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 53 GGGGGGG---GGGGGGFGGGNG 71 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG G GGG Sbjct: 55 GGGGGGGGGGGFGGGNGGFGGG 76 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGGG Sbjct: 56 GGGGGGGGGGFGGGNGGFGGGG 77 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G G GGGGG Sbjct: 74 GGGGGGNYGGGGGNQGGGGGGG 95 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 56 GGGGGGGGGGFGGGNGGFGGG 76 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 64 GGFGGGNGGFGGGGGGNYGGG 84 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 71 GGFGGGGGGNYGGGGGNQGGG 91 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG GGGGG Sbjct: 58 GGGGGGGGFGGGNGGFGGGGGG 79 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GG GG Sbjct: 54 GGGGGGGGGGGGFGGGNGGFGG 75 Score = 28.7 bits (61), Expect = 5.4 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = -3 Query: 433 GGGG---GGXPPPXXGGGGXGGGGG 368 G GG GG GGGG GGGGG Sbjct: 37 GAGGDILGGLASNFFGGGGGGGGGG 61 Score = 28.3 bits (60), Expect = 7.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGG Sbjct: 64 GGFGGGNGGFGGGGGGNYGGGG 85 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GG G G GG Sbjct: 52 GGGGGGGGGGGGGGFGGGNGG 72 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GG GG Sbjct: 52 GGGGGGGGGGGGGGFGGGNGG 72 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -1 Query: 372 GGXXXGXXGGGGXGXGGG 319 GG G GGGG G GGG Sbjct: 52 GGGGGGGGGGGGGGFGGG 69 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = -1 Query: 381 GGXGGXXXGXXGG-GGXGXGGG 319 GG GG G GG GG G GGG Sbjct: 57 GGGGGGGGGFGGGNGGFGGGGG 78 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGG GGGGG Sbjct: 67 GGGNGGFG--GGGGGNYGGGGG 86 >L25598-3|AAM15551.1| 759|Caenorhabditis elegans Calpain family protein 1, isoform d protein. Length = 759 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGGGG Sbjct: 57 GGGGGGGGGFGGGNGGFGGGGG 78 Score = 31.9 bits (69), Expect = 0.58 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 64 GGFGGGNGGFGGGGGGSGGGGG 85 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GGGGG Sbjct: 98 GGGGGGGNYGGGGGNQGGGGG 118 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 53 GGGGGGG---GGGGGGFGGGNG 71 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG G GGG Sbjct: 55 GGGGGGGGGGGFGGGNGGFGGG 76 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGGG Sbjct: 56 GGGGGGGGGGFGGGNGGFGGGG 77 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G GG GGG G Sbjct: 60 GGGGGGFGGGNGGFGGGGGGSG 81 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG G GGG Sbjct: 62 GGGGFGGGNGGFGGGGGGSGGG 83 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGGG GGGG Sbjct: 63 GGGFGGGNGGFGGGGGGSGGGG 84 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG GGGGG Sbjct: 98 GGGGGGGNYGGGGGNQGGGGGG 119 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG G G GGGGG Sbjct: 99 GGGGGGNYGGGGGNQGGGGGGG 120 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 56 GGGGGGGGGGFGGGNGGFGGG 76 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG GGG Sbjct: 64 GGFGGGNGGFGGGGGGSGGGG 84 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG GGGGG Sbjct: 58 GGGGGGGGFGGGNGGFGGGGGG 79 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GG GG Sbjct: 54 GGGGGGGGGGGGFGGGNGGFGG 75 Score = 28.7 bits (61), Expect = 5.4 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = -3 Query: 433 GGGG---GGXPPPXXGGGGXGGGGG 368 G GG GG GGGG GGGGG Sbjct: 37 GAGGDILGGLASNFFGGGGGGGGGG 61 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 63 GGGFGGGNGGFGGGGGGSGGG 83 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GG G G GG Sbjct: 52 GGGGGGGGGGGGGGFGGGNGG 72 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GG GG Sbjct: 52 GGGGGGGGGGGGGGFGGGNGG 72 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -1 Query: 372 GGXXXGXXGGGGXGXGGG 319 GG G GGGG G GGG Sbjct: 52 GGGGGGGGGGGGGGFGGG 69 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = -1 Query: 381 GGXGGXXXGXXGG-GGXGXGGG 319 GG GG G GG GG G GGG Sbjct: 57 GGGGGGGGGFGGGNGGFGGGGG 78 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGG GGGGG Sbjct: 67 GGGNGGFG--GGGGGSGGGGGG 86 >AF025467-2|AAN65301.1| 505|Caenorhabditis elegans Hypothetical protein R148.5b protein. Length = 505 Score = 33.1 bits (72), Expect = 0.25 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPP----PXPPPPXXGGGXPPP--PPP 434 PPPP P PPP G G PPP PPP Sbjct: 297 PPPPRGHFPPPPPHFMGRGMPPPFMPPP 324 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 4/25 (16%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXP----PPPPP 434 PPP PPPP G G P PPP P Sbjct: 317 PPPFMPPPPHFGMGPPRGFMPPPHP 341 >AF025467-1|AAB71039.2| 528|Caenorhabditis elegans Hypothetical protein R148.5a protein. Length = 528 Score = 33.1 bits (72), Expect = 0.25 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPP----PXPPPPXXGGGXPPP--PPP 434 PPPP P PPP G G PPP PPP Sbjct: 297 PPPPRGHFPPPPPHFMGRGMPPPFMPPP 324 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 4/25 (16%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXP----PPPPP 434 PPP PPPP G G P PPP P Sbjct: 317 PPPFMPPPPHFGMGPPRGFMPPPHP 341 >U40802-12|AAK19014.2| 265|Caenorhabditis elegans Sperm-specific family, class qprotein 3 protein. Length = 265 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXP--PPXXGGGGXGGGGG 368 GGGGGG P G GG GGGGG Sbjct: 232 GGGGGGIPGQSVYMGAGGGGGGGG 255 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = -3 Query: 433 GGG----GGGXPPPXXGGGGXGGGGG 368 GGG GG PPP G GGGGG Sbjct: 165 GGGPSAFGGAPPPPSGSAMGGGGGGG 190 >U40802-3|AAM81105.1| 369|Caenorhabditis elegans Dense body protein 1, isoform b protein. Length = 369 Score = 32.7 bits (71), Expect = 0.33 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP P PPPP Sbjct: 145 PAPPRPPPPVELSPPPRPPPP 165 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PP PPP PPPPP Sbjct: 145 PAPPRPPPPVELSPPPRPPPPP 166 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PP P PP PP Sbjct: 147 PPRPPPPVELSPPPRPPPPP 166 >U40802-2|AAM81104.1| 1010|Caenorhabditis elegans Dense body protein 1, isoform a protein. Length = 1010 Score = 32.7 bits (71), Expect = 0.33 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP P PPPP Sbjct: 786 PAPPRPPPPVELSPPPRPPPP 806 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PP PPP PPPPP Sbjct: 786 PAPPRPPPPVELSPPPRPPPPP 807 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PP P PP PP Sbjct: 788 PPRPPPPVELSPPPRPPPPP 807 >U40802-1|AAM81106.1| 999|Caenorhabditis elegans Dense body protein 1, isoform c protein. Length = 999 Score = 32.7 bits (71), Expect = 0.33 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP P PPPP Sbjct: 786 PAPPRPPPPVELSPPPRPPPP 806 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PP PPP PPPPP Sbjct: 786 PAPPRPPPPVELSPPPRPPPPP 807 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PP P PP PP Sbjct: 788 PPRPPPPVELSPPPRPPPPP 807 >U23172-13|ABH03527.1| 282|Caenorhabditis elegans Hypothetical protein F25B5.7c protein. Length = 282 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXGG-GGXGGGGG 368 G GG G PPP GG GG GG GG Sbjct: 194 GHGGMGGPPPGQGGPGGPGGPGG 216 >U23172-12|ABH03526.1| 562|Caenorhabditis elegans Hypothetical protein F25B5.7a protein. Length = 562 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXGG-GGXGGGGG 368 G GG G PPP GG GG GG GG Sbjct: 474 GHGGMGGPPPGQGGPGGPGGPGG 496 >U00058-3|AAD31933.1| 162|Caenorhabditis elegans Ground-like (grd related) protein22 protein. Length = 162 Score = 32.7 bits (71), Expect = 0.33 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P PPPP G PPPPPP Sbjct: 37 PACAPPPPPMCGCAPPPPPPP 57 Score = 31.9 bits (69), Expect = 0.58 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 369 PPPPPXPPPPXXGGG 413 PPPPP PPPP G G Sbjct: 51 PPPPPPPPPPMCGCG 65 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPX----PPPPXXGGGXPPPPPP 434 PPPPP PPPP PPPPPP Sbjct: 41 PPPPPMCGCAPPPP------PPPPPP 60 Score = 28.7 bits (61), Expect = 5.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P P PPP G PPPPP Sbjct: 34 PAAPACAPPPPPMCGCAPPPPP 55 >J04804-1|AAA28002.1| 1010|Caenorhabditis elegans protein ( C.elegans vinculin (deb-1) gene, complete cds. ). Length = 1010 Score = 32.7 bits (71), Expect = 0.33 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P PP PPPP P PPPP Sbjct: 786 PAPPRPPPPVELSPPPRPPPP 806 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PP PPP PPPPP Sbjct: 786 PAPPRPPPPVELSPPPRPPPPP 807 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PP P PP PP Sbjct: 788 PPRPPPPVELSPPPRPPPPP 807 >AF067609-10|AAC17537.1| 163|Caenorhabditis elegans Ground-like (grd related) protein20 protein. Length = 163 Score = 32.7 bits (71), Expect = 0.33 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GG G GGGGG Sbjct: 22 GGGGGGCGGGCGGGCGGGGGGG 43 Score = 32.3 bits (70), Expect = 0.44 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GGGGG Sbjct: 21 GGGGGGGCGGGCGGGCGGGGGG 42 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 21 GGGGGGGCGGGCGGGCGGGGG 41 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 22 GGGGGGCGGGCGGGCGGGGGG 42 >AC024790-13|AAL32247.1| 311|Caenorhabditis elegans Hypothetical protein Y47D7A.13 protein. Length = 311 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 3/23 (13%) Frame = -3 Query: 433 GGGGGGX---PPPXXGGGGXGGG 374 GGGGGG PPP GGG GGG Sbjct: 22 GGGGGGCCAPPPPPPCGGGCGGG 44 >U61288-1|AAB17543.1| 790|Caenorhabditis elegans CE protein. Length = 790 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 451 GGGGGNGGGGNGGGGNGNGGG 471 Score = 31.9 bits (69), Expect = 0.58 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 G GGGG GGGG GGGG Sbjct: 440 GSGGGGSNSNSGGGGGNGGGG 460 Score = 31.5 bits (68), Expect = 0.76 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG G GGG Sbjct: 451 GGGGGNGGGGNGGGGNGNGGG 471 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 G GGG GGGG GGGG Sbjct: 440 GSGGGGSNSNSGGGGGNGGGG 460 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GG G GGG G Sbjct: 452 GGGGNGGGGNGGGGNGNGGGAG 473 >AF039052-9|AAF98625.1| 302|Caenorhabditis elegans Hypothetical protein T22D1.2 protein. Length = 302 Score = 32.3 bits (70), Expect = 0.44 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 387 PPPPXXGGGXPPPPP 431 PPPP G G PPPPP Sbjct: 33 PPPPPKGTGTPPPPP 47 Score = 32.3 bits (70), Expect = 0.44 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 387 PPPPXXGGGXPPPPP 431 PPPP G G PPPPP Sbjct: 64 PPPPPKGTGTPPPPP 78 Score = 32.3 bits (70), Expect = 0.44 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 387 PPPPXXGGGXPPPPP 431 PPPP G G PPPPP Sbjct: 96 PPPPPKGTGTPPPPP 110 Score = 32.3 bits (70), Expect = 0.44 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 387 PPPPXXGGGXPPPPP 431 PPPP G G PPPPP Sbjct: 127 PPPPPKGTGSPPPPP 141 Score = 32.3 bits (70), Expect = 0.44 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 387 PPPPXXGGGXPPPPP 431 PPPP G G PPPPP Sbjct: 158 PPPPPKGTGSPPPPP 172 Score = 32.3 bits (70), Expect = 0.44 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 387 PPPPXXGGGXPPPPP 431 PPPP G G PPPPP Sbjct: 189 PPPPPKGTGTPPPPP 203 Score = 32.3 bits (70), Expect = 0.44 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 387 PPPPXXGGGXPPPPP 431 PPPP G G PPPPP Sbjct: 251 PPPPPKGTGSPPPPP 265 Score = 29.5 bits (63), Expect = 3.1 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 387 PPPPXXGGGXPPPP 428 PPPP G G PPPP Sbjct: 282 PPPPPKGTGTPPPP 295 Score = 29.1 bits (62), Expect = 4.1 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 387 PPPPXXGGGXPPPPP 431 PPPP G G P PPP Sbjct: 220 PPPPPKGTGSPTPPP 234 >Z69360-4|CAC42291.2| 732|Caenorhabditis elegans Hypothetical protein F25H8.5c protein. Length = 732 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P P P PPPP PP PPP Sbjct: 88 PQPTPGPPPPRNNCLPPPGPPP 109 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 P P P PPPP PP PP Sbjct: 88 PQPTPGPPPPRNNCLPPPGPP 108 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PPP PPPP P PPP Sbjct: 103 PPPGPPPPCQQYQQPQPPP 121 >Z69360-3|CAA93286.2| 369|Caenorhabditis elegans Hypothetical protein F25H8.5b protein. Length = 369 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P P P PPPP PP PPP Sbjct: 88 PQPTPGPPPPRNNCLPPPGPPP 109 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 P P P PPPP PP PP Sbjct: 88 PQPTPGPPPPRNNCLPPPGPP 108 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PPP PPPP P PPP Sbjct: 103 PPPGPPPPCQQYQQPQPPP 121 >Z69360-2|CAA93285.2| 780|Caenorhabditis elegans Hypothetical protein F25H8.5a protein. Length = 780 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P P P PPPP PP PPP Sbjct: 88 PQPTPGPPPPRNNCLPPPGPPP 109 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 P P P PPPP PP PP Sbjct: 88 PQPTPGPPPPRNNCLPPPGPP 108 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PPP PPPP P PPP Sbjct: 103 PPPGPPPPCQQYQQPQPPP 121 >U55366-2|AAA97981.1| 156|Caenorhabditis elegans Hypothetical protein F41F3.3 protein. Length = 156 Score = 31.9 bits (69), Expect = 0.58 Identities = 14/21 (66%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -3 Query: 433 GGGGGGXPPPXXG-GGGXGGG 374 GGGGG PPP GGG GGG Sbjct: 61 GGGGGCCPPPAPACGGGCGGG 81 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = -3 Query: 433 GGGGG---GXPPPXXGGGGXGGGGG 368 GGGGG PPP G GGGGG Sbjct: 22 GGGGGCGCAPPPPPPSPCGCGGGGG 46 >U41543-12|AAZ91345.1| 401|Caenorhabditis elegans Groundhog (hedgehog-like family)protein 7 protein. Length = 401 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP P P PPPPP Sbjct: 133 PPPPPPPHYPPPPPHYPPPPP 153 Score = 31.5 bits (68), Expect = 0.76 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 2/22 (9%) Frame = +3 Query: 375 PPPXPPPPXXGGGXP--PPPPP 434 PPP PPPP P PPPPP Sbjct: 132 PPPPPPPPHYPPPPPHYPPPPP 153 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP PPPP P Sbjct: 134 PPPPPPHYPPPPPHYPPPPPAP 155 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P P P P PP PP Sbjct: 133 PPPPPPPHYPPPPPHYPPPPP 153 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = +2 Query: 320 PPPXPXPP--PPXXPXXXPPXP 379 PPP P PP PP P PP P Sbjct: 132 PPPPPPPPHYPPPPPHYPPPPP 153 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P PPP P Sbjct: 50 PPPPPAPYPQQAVPAPAPPPAP 71 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPXP----PPPXXGGGXPPPPPP 434 PPP P P P P PPPPPP Sbjct: 112 PPPAPYPQHAVPAPAPYQQQPPPPPP 137 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 3/24 (12%) Frame = +2 Query: 320 PPPXPX---PPPPXXPXXXPPXPP 382 P P P PPPP P PP PP Sbjct: 123 PAPAPYQQQPPPPPPPPHYPPPPP 146 Score = 28.3 bits (60), Expect = 7.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 326 PXPXPPPPXXPXXXPPXPP 382 P P PPPP P P PP Sbjct: 132 PPPPPPPPHYPPPPPHYPP 150 >U13875-4|AAK67215.1| 1510|Caenorhabditis elegans Set (trithorax/polycomb) domaincontaining protein 2, isoform c protein. Length = 1510 Score = 31.9 bits (69), Expect = 0.58 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 381 PXPPPPXXGGGXPPPPPP 434 P PPPP PPPPPP Sbjct: 296 PIPPPPIKEESPPPPPPP 313 >U13875-3|AAK67214.1| 1507|Caenorhabditis elegans Set (trithorax/polycomb) domaincontaining protein 2, isoform a protein. Length = 1507 Score = 31.9 bits (69), Expect = 0.58 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 381 PXPPPPXXGGGXPPPPPP 434 P PPPP PPPPPP Sbjct: 296 PIPPPPIKEESPPPPPPP 313 >AF043706-2|AAB97604.2| 730|Caenorhabditis elegans Hypothetical protein ZC123.1 protein. Length = 730 Score = 31.9 bits (69), Expect = 0.58 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPPPXP--PPPXXGGGXPPPPPP 434 PP PP PPP PPPPPP Sbjct: 125 PPNPPRTCCPPPTPAAPPPPPPPP 148 Score = 31.5 bits (68), Expect = 0.76 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP P PPP PPPPPP Sbjct: 134 PPPTPAAPPP-----PPPPPPP 150 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 4/25 (16%) Frame = +3 Query: 372 PPPPXPP----PPXXGGGXPPPPPP 434 P PP PP PP PPPPPP Sbjct: 123 PAPPNPPRTCCPPPTPAAPPPPPPP 147 >Z69658-1|CAA93481.1| 418|Caenorhabditis elegans Hypothetical protein C36H8.1 protein. Length = 418 Score = 31.5 bits (68), Expect = 0.76 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPP PP P PPPP P Sbjct: 182 PPPQEPPKPVEQAAPPPPPAP 202 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 P PPP PP PPPPP Sbjct: 180 PRPPPQEPPKPVEQAAPPPPP 200 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPPPXPP--PPXXGGGXPPPPPP 434 PPPP PP PP PPPPP Sbjct: 177 PPPPRPPPQEPPKPVEQAAPPPPP 200 >AC006638-2|AAK85481.1| 1256|Caenorhabditis elegans Cyclase associated protein homologprotein 1, isoform a protein. Length = 1256 Score = 31.5 bits (68), Expect = 0.76 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPPPP PPP PPP Sbjct: 1012 PPPPPPPPPADFFANIAPPP 1031 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 P P P GG PPPPPP Sbjct: 1000 PSAPKAPAGPGGPPPPPPP 1018 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PPPP PPP Sbjct: 1012 PPPPPPPPPADFFANIAPPP 1031 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P P P P GG PPPPPP Sbjct: 1000 PSAPKAPAGP--GGPPPPPPPP 1019 >AC006638-1|AAK85482.1| 495|Caenorhabditis elegans Cyclase associated protein homologprotein 1, isoform b protein. Length = 495 Score = 31.5 bits (68), Expect = 0.76 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPPPP PPP PPP Sbjct: 251 PPPPPPPPPADFFANIAPPP 270 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 378 PPXPPPPXXGGGXPPPPPP 434 P P P GG PPPPPP Sbjct: 239 PSAPKAPAGPGGPPPPPPP 257 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 PPPP PPPP PPP Sbjct: 251 PPPPPPPPPADFFANIAPPP 270 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P P P P GG PPPPPP Sbjct: 239 PSAPKAPAGP--GGPPPPPPPP 258 >U97015-9|AAB52349.1| 343|Caenorhabditis elegans Hypothetical protein F48C1.8 protein. Length = 343 Score = 31.1 bits (67), Expect = 1.0 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGX--GGGGG 368 GGGGGG GGGG GGGGG Sbjct: 189 GGGGGGGGHHHHGGGGHYHGGGGG 212 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGG----GGG 368 GGGGGG GGGG GG GGG Sbjct: 178 GGGGGGGSHHHGGGGGGGGHHHHGGG 203 >U41557-2|AAA83301.1| 309|Caenorhabditis elegans Hypothetical protein C50F7.5 protein. Length = 309 Score = 31.1 bits (67), Expect = 1.0 Identities = 19/61 (31%), Positives = 20/61 (32%), Gaps = 2/61 (3%) Frame = +2 Query: 206 PNPVNPXLGXKXKXPPPXXXXXXXXXXXXXXXXXXXXXP-PPXPXPP-PPXXPXXXPPXP 379 P PV+P K PP P PP PP PP P PP P Sbjct: 212 PGPVDPSEDPKPSEPPSPGPVDPSDEPSPSDPPGPPGPPGPPTRRPPGPPGPPTRRPPGP 271 Query: 380 P 382 P Sbjct: 272 P 272 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 1/22 (4%) Frame = +3 Query: 369 PPPPPXPP-PPXXGGGXPPPPP 431 PP PP PP PP PP PP Sbjct: 243 PPGPPGPPGPPTRRPPGPPGPP 264 >AL110477-13|CAB54337.2| 789|Caenorhabditis elegans Hypothetical protein Y113G7B.23 protein. Length = 789 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P P P PP G G PPPP P Sbjct: 719 PYPGPPPPQQQRGYGYPPPPQP 740 >AF230279-1|AAG16654.1| 789|Caenorhabditis elegans SWI3-like protein protein. Length = 789 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P P P PP G G PPPP P Sbjct: 719 PYPGPPPPQQQRGYGYPPPPQP 740 >AC006611-4|AAK85456.2| 328|Caenorhabditis elegans Hypothetical protein C30F8.3 protein. Length = 328 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPP P P PPPPPP Sbjct: 58 PPPPAYPFAPQVFTQPPPPPPP 79 >Z92831-7|CAB07369.2| 2396|Caenorhabditis elegans Hypothetical protein F22G12.5 protein. Length = 2396 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PP PPPP G PPPP Sbjct: 1504 PPQMPPPPPASGKTIPPPP 1522 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPP 428 PP PPPP G PPPP Sbjct: 1504 PPQMPPPPPASGKTIPPPP 1522 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PP PPP G PPPP Sbjct: 1501 PSRPPQMPPPPPASGKTIPPPP 1522 >Z81466-2|CAC42256.1| 954|Caenorhabditis elegans Hypothetical protein C09H6.2b protein. Length = 954 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 412 PPPXXGGGGXGGGGG 368 PPP GGG GGGGG Sbjct: 29 PPPSKGGGAGGGGGG 43 >Z81466-1|CAB03869.1| 982|Caenorhabditis elegans Hypothetical protein C09H6.2a protein. Length = 982 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 412 PPPXXGGGGXGGGGG 368 PPP GGG GGGGG Sbjct: 29 PPPSKGGGAGGGGGG 43 >Z81066-8|CAB02974.2| 2396|Caenorhabditis elegans Hypothetical protein F22G12.5 protein. Length = 2396 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPP 431 PP PPPP G PPPP Sbjct: 1504 PPQMPPPPPASGKTIPPPP 1522 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPP 428 PP PPPP G PPPP Sbjct: 1504 PPQMPPPPPASGKTIPPPP 1522 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PP PPP G PPPP Sbjct: 1501 PSRPPQMPPPPPASGKTIPPPP 1522 >AJ133374-1|CAB40208.1| 954|Caenorhabditis elegans lin-10 protein protein. Length = 954 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 412 PPPXXGGGGXGGGGG 368 PPP GGG GGGGG Sbjct: 29 PPPSKGGGAGGGGGG 43 >AF067219-3|AAC17027.1| 74|Caenorhabditis elegans Hypothetical protein R12E2.6 protein. Length = 74 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 369 PPPPPXPPPPXXG----GGXPPPPPP 434 PPP PPP G GG PPPPP Sbjct: 28 PPPQCCGPPPACGNPCGGGFGPPPPP 53 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP P G PPPPP Sbjct: 49 PPPPPFGP---VGYALPPPPP 66 >AF045646-2|AAK29827.1| 371|Caenorhabditis elegans Collagen protein 103 protein. Length = 371 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGG GG GGGG GGGG Sbjct: 110 GGGHGGAVGGGYGGGGGGGGG 130 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GG G GGGGG Sbjct: 107 GGHGGGHGGAVGGGYGGGGGGG 128 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GGG GGGGG Sbjct: 106 GGGHGGGHGGAVGGGYGGGGGG 127 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 107 GGHGGGHGGAVGGGYGGGGGG 127 Score = 28.3 bits (60), Expect = 7.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 111 GGHGGAVGGGYGGGG-GGGGG 130 >AF016446-1|AAC24166.1| 66|Caenorhabditis elegans Hypothetical protein C02E7.7 protein. Length = 66 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG G PPP G GGGGG Sbjct: 24 GGGCGCAPPPPPPACGCGGGGG 45 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = -3 Query: 433 GGGGG---GXPPPXXGGGGXGGGGG 368 GGGGG PPP G GGGGG Sbjct: 22 GGGGGCGCAPPPPPPACGCGGGGGG 46 >Z70284-9|CAA94280.1| 290|Caenorhabditis elegans Hypothetical protein K07F5.11 protein. Length = 290 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXX--GGGGXGGGGG 368 GGGGGG P G GG GG GG Sbjct: 257 GGGGGGIPGQSMYMGAGGGGGAGG 280 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P G GGGGG Sbjct: 256 GGGGGGGIPGQSMYMGAGGGGG 277 Score = 28.3 bits (60), Expect = 7.1 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 4/24 (16%) Frame = -3 Query: 427 GGGGXPPPXX----GGGGXGGGGG 368 GG G PPP G G GGGGG Sbjct: 38 GGAGAPPPGTSVYMGAGAGGGGGG 61 >Z54238-1|CAA90992.2| 281|Caenorhabditis elegans Hypothetical protein T28C6.1 protein. Length = 281 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG P GGGG GGG G Sbjct: 238 GGRGGQQGPGGWGGGGRGGGWG 259 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GG G G GGG Sbjct: 50 GGTGGGRGGGRGGSGGGRGGG 70 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GG Sbjct: 146 GGWGGSQGGQNGGGGRGGSGG 166 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GG GG Sbjct: 146 GGWGGSQGGQNGGGGRGGSGG 166 >U64609-1|AAB04598.1| 405|Caenorhabditis elegans Sperm-specific family, class qprotein 2 protein. Length = 405 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXX--GGGGXGGGGG 368 GGGGGG P G GG GG GG Sbjct: 372 GGGGGGIPGQSMYMGAGGGGGAGG 395 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG P G GGGGG Sbjct: 371 GGGGGGGIPGQSMYMGAGGGGG 392 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = -3 Query: 430 GGGGGXPP---PXXGGGGXGGGGG 368 GGG PP G GG GGGGG Sbjct: 38 GGGAAPPPGTSVYMGAGGGGGGGG 61 >L25598-5|AAM15550.1| 113|Caenorhabditis elegans Calpain family protein 1, isoform c protein. Length = 113 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 53 GGGGGGG---GGGGGGFGGGNG 71 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG G GGG Sbjct: 55 GGGGGGGGGGGFGGGNGGFGGG 76 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 56 GGGGGGGGGGFGGGNGGFGGG 76 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GG GG Sbjct: 54 GGGGGGGGGGGGFGGGNGGFGG 75 Score = 28.7 bits (61), Expect = 5.4 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = -3 Query: 433 GGGG---GGXPPPXXGGGGXGGGGG 368 G GG GG GGGG GGGGG Sbjct: 37 GAGGDILGGLASNFFGGGGGGGGGG 61 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GG G G GG Sbjct: 52 GGGGGGGGGGGGGGFGGGNGG 72 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GG GG Sbjct: 52 GGGGGGGGGGGGGGFGGGNGG 72 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -1 Query: 372 GGXXXGXXGGGGXGXGGG 319 GG G GGGG G GGG Sbjct: 52 GGGGGGGGGGGGGGFGGG 69 >L25598-2|AAV58887.1| 780|Caenorhabditis elegans Calpain family protein 1, isoform a protein. Length = 780 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GGG G Sbjct: 53 GGGGGGG---GGGGGGFGGGNG 71 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG G GGG Sbjct: 55 GGGGGGGGGGGFGGGNGGFGGG 76 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 56 GGGGGGGGGGFGGGNGGFGGG 76 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGG GG GG Sbjct: 54 GGGGGGGGGGGGFGGGNGGFGG 75 Score = 28.7 bits (61), Expect = 5.4 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = -3 Query: 433 GGGG---GGXPPPXXGGGGXGGGGG 368 G GG GG GGGG GGGGG Sbjct: 37 GAGGDILGGLASNFFGGGGGGGGGG 61 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GG G G GG Sbjct: 52 GGGGGGGGGGGGGGFGGGNGG 72 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGG GG GG Sbjct: 52 GGGGGGGGGGGGGGFGGGNGG 72 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -1 Query: 372 GGXXXGXXGGGGXGXGGG 319 GG G GGGG G GGG Sbjct: 52 GGGGGGGGGGGGGGFGGG 69 >AL032637-18|CAE17998.1| 193|Caenorhabditis elegans Hypothetical protein Y43F8C.20 protein. Length = 193 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGGG GGGGG Sbjct: 158 GGNGGGG---RGGGGGRGGGGG 176 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GG G PP GGG GG GG Sbjct: 142 GGDGRGPPGSNGGGDWGGNGG 162 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 150 GSNGGGDWGGNGGGGRGGGGG 170 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GG G PP GGG GG G Sbjct: 140 GRGGDGRGPPGSNGGGDWGGNG 161 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG GGGG G GGG Sbjct: 41 GGGGGPGGWGNNGGGGWGRGGG 62 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 42 GGGGPGGWGNNGGGGWGRGGG 62 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 G GG GGGG GGGGG Sbjct: 150 GSNGGGDWGGNGGGGRGGGGG 170 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GG GG GG G GGGGG Sbjct: 158 GGNGGGGRGGGGGRGGGGGGG 178 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGG GGG G Sbjct: 159 GNGGGGRGGGGGRGGGGGGGAG 180 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GGGG Sbjct: 79 GGNGGGRGDWGGNGGGGRGGGG 100 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGGG G GGG Sbjct: 158 GGNGGGGRG--GGGGRGGGGG 176 >AF101312-1|AAC69221.3| 813|Caenorhabditis elegans Hypothetical protein F56E10.2 protein. Length = 813 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPP 422 PP PP PPPP G PP Sbjct: 328 PPAPPPPPPPIGGLTSPP 345 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPP 425 PP P PPPP GG PP Sbjct: 328 PPAPPPPPPPIGGLTSPP 345 Score = 28.3 bits (60), Expect = 7.1 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 P P P PP P PP PP Sbjct: 313 PSDPCPSPPLLPPVCPPAPP 332 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = +3 Query: 375 PPPXPP--PPXXGGGXPPPPPP 434 P P PP PP PPPPPP Sbjct: 316 PCPSPPLLPPVCPPAPPPPPPP 337 >AC025716-21|AAT39978.1| 586|Caenorhabditis elegans Hypothetical protein Y39G10AR.18b protein. Length = 586 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPP P P PPP PP Sbjct: 171 PPPPLVPAPARATASTPPPAPP 192 >AC025716-20|AAT39977.2| 946|Caenorhabditis elegans Hypothetical protein Y39G10AR.18a protein. Length = 946 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPP P P PPP PP Sbjct: 531 PPPPLVPAPARATASTPPPAPP 552 >AC024847-11|AAO21416.1| 453|Caenorhabditis elegans Ground-like (grd related) protein16, isoform b protein. Length = 453 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPPPP PP P GG P Sbjct: 63 PPPPPPPPAPIGGGAGYAAP 82 >AC024847-10|AAF60859.1| 393|Caenorhabditis elegans Ground-like (grd related) protein16, isoform a protein. Length = 393 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PPPPP PP P GG P Sbjct: 63 PPPPPPPPAPIGGGAGYAAP 82 >Z83227-3|CAB05726.2| 241|Caenorhabditis elegans Hypothetical protein F45B8.3 protein. Length = 241 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P P PPPP PPPPP Sbjct: 106 PAPCCPPPPAPAAPCCPPPPP 126 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P P PPPPPP Sbjct: 111 PPPPAPAAPC----CPPPPPP 127 >Z81525-6|CAB82206.2| 346|Caenorhabditis elegans Hypothetical protein F33A8.9 protein. Length = 346 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +3 Query: 369 PPPPPXPP-PPXXGGGXPPPPPP 434 PP PP PP PP GG P PP Sbjct: 236 PPGPPGPPGPPGNPGGIGPRGPP 258 >Z73102-2|CAB63428.1| 341|Caenorhabditis elegans Hypothetical protein B0035.1b protein. Length = 341 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PP P PPPP G PP P Sbjct: 127 PPMPSGPPPPSMAYGMPPMP 146 >Z73102-1|CAA97419.1| 298|Caenorhabditis elegans Hypothetical protein B0035.1a protein. Length = 298 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PP P PPPP G PP P Sbjct: 127 PPMPSGPPPPSMAYGMPPMP 146 >Z68106-4|CAA92128.1| 112|Caenorhabditis elegans Hypothetical protein F41E7.5 protein. Length = 112 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G P G GG GGG G Sbjct: 33 GGGGFGGGPGQFGRGGFGGGPG 54 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GG G P G GG GGG G Sbjct: 72 GNGGFGGGPSYGGRGGFGGGPG 93 >AL110490-3|CAB54449.1| 892|Caenorhabditis elegans Hypothetical protein Y48B6A.3 protein. Length = 892 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGG GG GGGG GGGG Sbjct: 828 GGGYGGGYGGGGGGGGGGGGG 848 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGG G GGGG GGGGG Sbjct: 828 GGGYGGGYGGGGGGGGGGGGG 848 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGG 322 GG GG G GGGG G GG Sbjct: 829 GGYGGGYGGGGGGGGGGGGG 848 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGG GGGG GGGGG Sbjct: 825 GYQGGGYGGGYGGGGGGGGGGG 846 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GG GGGG GGGGG Sbjct: 824 GGYQGGGYGGGYGGGGGGGGGG 845 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 G GG G GGGG G GGG Sbjct: 825 GYQGGGYGGGYGGGGGGGGGG 845 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 828 GGGYGGGYGGGGGGGGGGGGG 848 >AL110484-17|CAB54408.1| 586|Caenorhabditis elegans Hypothetical protein Y38E10A.17 protein. Length = 586 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGGGGG GGGG GG G Sbjct: 459 GGGGGGSGGYGAGGGGSGGYG 479 >AF098500-3|ABD94103.1| 774|Caenorhabditis elegans Temporarily assigned gene nameprotein 343, isoform b protein. Length = 774 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PP P PP PP Sbjct: 94 PPPKPTIRPPPIPASPPPRPP 114 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P PPPPPP Sbjct: 76 PPPPLPLSNPPAKPTPPPPPP 96 Score = 28.3 bits (60), Expect = 7.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP P PP PPPP P Sbjct: 77 PPPLPLSNPPAKPTPPPPPPKP 98 Score = 28.3 bits (60), Expect = 7.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP P PPPP PPP P Sbjct: 85 PPAKPTPPPPPPKPTIRPPPIP 106 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 4/23 (17%) Frame = +3 Query: 378 PPXPPPPXXGGGXP----PPPPP 434 PP PPPP P PPPPP Sbjct: 73 PPLPPPPLPLSNPPAKPTPPPPP 95 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP P P P PPPP Sbjct: 73 PPLPPPPLPLSNPPAKPTPPPP 94 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PP P PP P Sbjct: 77 PPPLPLSNPPAKPTPPPPPP 96 >AF098500-2|AAC67399.2| 996|Caenorhabditis elegans Temporarily assigned gene nameprotein 343, isoform a protein. Length = 996 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P PP P PP PP Sbjct: 316 PPPKPTIRPPPIPASPPPRPP 336 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPPP P PPPPPP Sbjct: 298 PPPPLPLSNPPAKPTPPPPPP 318 Score = 28.3 bits (60), Expect = 7.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP P PP PPPP P Sbjct: 299 PPPLPLSNPPAKPTPPPPPPKP 320 Score = 28.3 bits (60), Expect = 7.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP P PPPP PPP P Sbjct: 307 PPAKPTPPPPPPKPTIRPPPIP 328 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 4/23 (17%) Frame = +3 Query: 378 PPXPPPPXXGGGXP----PPPPP 434 PP PPPP P PPPPP Sbjct: 295 PPLPPPPLPLSNPPAKPTPPPPP 317 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP P P P PPPP Sbjct: 295 PPLPPPPLPLSNPPAKPTPPPP 316 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P PP P PP P Sbjct: 299 PPPLPLSNPPAKPTPPPPPP 318 >AC024809-7|AAF59540.1| 315|Caenorhabditis elegans Hypothetical protein Y53G8AR.9 protein. Length = 315 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGGG GGGG GG GG Sbjct: 189 GGGGGGM----GGGGGSGGSGG 206 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG G GG GGG G Sbjct: 189 GGGGGGMGGGGGSGGSGGGSG 209 >Z75543-7|CAA99868.2| 139|Caenorhabditis elegans Hypothetical protein K01D12.8 protein. Length = 139 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG GGG GG GG Sbjct: 68 GGSGGGKGGKGGSGGGGGGSGG 89 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GG GG G GG GGGGG Sbjct: 65 GGSGGSGGGKGGKGGSGGGGG 85 >Z70309-6|CAA94360.1| 324|Caenorhabditis elegans Hypothetical protein R102.6 protein. Length = 324 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPP-----PXPPPPXXGGGXPPPPPP 434 PPPP P PPPP PPPPP Sbjct: 243 PPPPSPVCMPPPPPPCPMPIPCPPPPP 269 >Z49130-7|CAA88972.2| 316|Caenorhabditis elegans Hypothetical protein T06D8.9 protein. Length = 316 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGG 371 GG GG P GGGG G GG Sbjct: 184 GGSGGPGGPGSGGGGGGPGG 203 >U58748-9|AAB52969.3| 542|Caenorhabditis elegans Hypothetical protein ZK180.5a protein. Length = 542 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P P PP G PPPPPP Sbjct: 51 PAAGYPRPPIGYGAPPPPPPP 71 >U58748-8|AAM97986.1| 497|Caenorhabditis elegans Hypothetical protein ZK180.5b protein. Length = 497 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P P PP G PPPPPP Sbjct: 51 PAAGYPRPPIGYGAPPPPPPP 71 >U58748-7|AAM97987.1| 399|Caenorhabditis elegans Hypothetical protein ZK180.5c protein. Length = 399 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 P P PP G PPPPPP Sbjct: 51 PAAGYPRPPIGYGAPPPPPPP 71 >U39666-1|AAA80412.2| 644|Caenorhabditis elegans Nematode astacin protease protein33 protein. Length = 644 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +3 Query: 372 PPPPXPPPPXXGG---GXPPPPPP 434 PPPP PP G PPPPPP Sbjct: 62 PPPPWRRPPWHRRPPWGLPPPPPP 85 >AL132898-14|CAC14406.1| 1641|Caenorhabditis elegans Hypothetical protein Y59A8B.1a protein. Length = 1641 Score = 29.5 bits (63), Expect = 3.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 387 PPPPXXGGGXPPPPPP 434 PPPP PPPPPP Sbjct: 784 PPPPRASEPPPPPPPP 799 >AL023858-2|CAE18058.1| 158|Caenorhabditis elegans Hypothetical protein ZK285.2 protein. Length = 158 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G G GG GG GG Sbjct: 88 GGGGAGGAGGAGGAGGAGGSGG 109 >AF003390-3|AAB54272.1| 1308|Caenorhabditis elegans Hypothetical protein R155.2 protein. Length = 1308 Score = 29.5 bits (63), Expect = 3.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXP 419 PPPP PP P GG P Sbjct: 830 PPPPKPPAPSPGGAAP 845 >AC006666-4|AAK21415.1| 109|Caenorhabditis elegans Hypothetical protein H31G24.1 protein. Length = 109 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PPP P P P Sbjct: 84 PPPPPPPPPQPAPAQAPAPKYP 105 >Z93372-4|CAB07546.1| 301|Caenorhabditis elegans Hypothetical protein BE10.4 protein. Length = 301 Score = 25.4 bits (53), Expect(2) = 3.8 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPP 425 PP P PPPP G P Sbjct: 72 PPLPPPPPPQPANGYQDP 89 Score = 22.2 bits (45), Expect(2) = 3.8 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 369 PPPPPXPPPP 398 P PP PPPP Sbjct: 69 PTGPPLPPPP 78 >Z95559-4|CAB09004.1| 110|Caenorhabditis elegans Hypothetical protein Y41E3.8 protein. Length = 110 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 G GGGG GGGG GGG Sbjct: 63 GAGGGGNAYRRNGGGGGGGG 82 >Z82269-5|CAH60772.1| 618|Caenorhabditis elegans Hypothetical protein Y45F10B.13b protein. Length = 618 Score = 29.1 bits (62), Expect = 4.1 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 250 PPPPPPPPPP 259 >Z82269-4|CAB70200.2| 633|Caenorhabditis elegans Hypothetical protein Y45F10B.13a protein. Length = 633 Score = 29.1 bits (62), Expect = 4.1 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 265 PPPPPPPPPP 274 >Z82093-3|CAB05020.1| 222|Caenorhabditis elegans Hypothetical protein ZK39.4 protein. Length = 222 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 GG GGG PP GG G G Sbjct: 34 GGNGGGRPPGGGANGGCGAG 53 Score = 28.3 bits (60), Expect = 7.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GGG GG PP GGG GG G Sbjct: 33 GGGNGGGRPP--GGGANGGCG 51 >Z82083-3|CAB04971.1| 756|Caenorhabditis elegans Hypothetical protein ZK1010.5 protein. Length = 756 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP P P PP PP Sbjct: 639 PPPPPSPSPEPEPEPKPPVTPP 660 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP P P P P PP P Sbjct: 639 PPPPPSPSPEPEPEPKPPVTP 659 >Z82053-1|CAB04834.1| 233|Caenorhabditis elegans Hypothetical protein T26E3.1 protein. Length = 233 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGG 374 G GGG PP G G GGG Sbjct: 37 GNGGGRPPGNGNGNGNGGG 55 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = -3 Query: 430 GGGGGXPPPXXGGG---GXGGGGG 368 G GGG P P GGG G G G G Sbjct: 28 GNGGGRPRPGNGGGRPPGNGNGNG 51 >Z81560-2|CAB04547.1| 1021|Caenorhabditis elegans Hypothetical protein K02E2.2 protein. Length = 1021 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 4/25 (16%) Frame = +3 Query: 372 PPP----PXPPPPXXGGGXPPPPPP 434 PPP P PPPP PPPPPP Sbjct: 777 PPPFFALPVPPPPPV---PPPPPPP 798 Score = 29.1 bits (62), Expect = 4.1 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 786 PPPPPVPPPP 795 Score = 27.9 bits (59), Expect = 9.4 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 320 PPPXPXPPPPXXP 358 PPP P PPPP P Sbjct: 786 PPPPPVPPPPPPP 798 >Z81470-7|CAB03885.1| 129|Caenorhabditis elegans Hypothetical protein C14A6.8 protein. Length = 129 Score = 29.1 bits (62), Expect = 4.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 387 PPPPXXGGGXPPPPPP 434 P P GG PPPPPP Sbjct: 28 PNAPAVGGNEPPPPPP 43 >Z74472-4|CAA98942.1| 301|Caenorhabditis elegans Hypothetical protein F23H12.4 protein. Length = 301 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP PP G P PP P Sbjct: 228 PPGPPGPPGAPGNDGPPGPPGP 249 >Z66511-5|CAA91317.1| 1095|Caenorhabditis elegans Hypothetical protein F07A11.4 protein. Length = 1095 Score = 29.1 bits (62), Expect = 4.1 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 360 PPPPPPPPPP 369 Score = 29.1 bits (62), Expect = 4.1 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 361 PPPPPPPPPP 370 >Z50875-1|CAA90776.1| 1872|Caenorhabditis elegans Hypothetical protein T08A11.1 protein. Length = 1872 Score = 29.1 bits (62), Expect = 4.1 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 818 PPPPPLPPPP 827 >V00147-1|CAA23463.1| 296|Caenorhabditis elegans protein ( Caenorhabditis elegansgene Col-1 coding for a collagen. ). Length = 296 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP PP G P PP P Sbjct: 223 PPGPPGPPGAPGNDGPPGPPGP 244 >U88172-5|AAB42260.1| 483|Caenorhabditis elegans Hypothetical protein ZK354.8 protein. Length = 483 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 2/24 (8%) Frame = +3 Query: 369 PPPP--PXPPPPXXGGGXPPPPPP 434 PPPP P PPP PP PP Sbjct: 100 PPPPVAPHQPPPQLATSAQPPQPP 123 Score = 28.3 bits (60), Expect = 7.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPP 425 PP P PPPP PPP Sbjct: 93 PPSDPPPPPPPVAPHQPPP 111 >U80023-1|AAG24037.1| 180|Caenorhabditis elegans Hypothetical protein F07C4.7 protein. Length = 180 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 140 GGRGGNGGGNNGGGRGGNGGG 160 >U58736-1|AAB00598.1| 302|Caenorhabditis elegans Dumpy : shorter than wild-typeprotein 3 protein. Length = 302 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 PP PP PP P G P PP Sbjct: 223 PPGPPGPPGPPGPQGPPGPP 242 >U29380-1|AAA68740.1| 346|Caenorhabditis elegans Hypothetical protein ZK546.7 protein. Length = 346 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPP 425 PPPPP PPP G PPP Sbjct: 150 PPPPPIPPP-----GPPPP 163 >U28731-8|AAA68300.2| 113|Caenorhabditis elegans Hypothetical protein F12A10.7 protein. Length = 113 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GG GGG P GG G G GGG Sbjct: 51 GGWGGGYPYGGYGGYGGGYGGG 72 >J01047-1|AAA27988.1| 296|Caenorhabditis elegans protein ( C.elegans (nematode)collagen 1 (col-1) gene, complete cds. ). Length = 296 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP PP G P PP P Sbjct: 223 PPGPPGPPGAPGNDGPPGPPGP 244 >D10877-1|BAA01645.1| 346|Caenorhabditis elegans hnRNP like protein protein. Length = 346 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXG--GGGG 368 G GG G P GGGG G GGGG Sbjct: 267 GQGGWGGPQQQQGGGGWGQQGGGG 290 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G P G G GG GG Sbjct: 225 GGGGWGGPAQRGGPGAYGGPGG 246 >AL132898-7|CAC14410.1| 413|Caenorhabditis elegans Hypothetical protein Y59A8B.10 protein. Length = 413 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGGG 368 GGGGG G G GGGGG Sbjct: 263 GGGGGGGGMNVGAAGFGGGGG 283 >AL132860-5|CAB60515.1| 798|Caenorhabditis elegans Hypothetical protein Y56A3A.6 protein. Length = 798 Score = 29.1 bits (62), Expect = 4.1 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP PPPP P P P Sbjct: 754 PPPPPPPPPLAAAPPQPKNP 773 Score = 28.3 bits (60), Expect = 7.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPP 428 PPPP PPPP PP P Sbjct: 754 PPPPPPPPPL--AAAPPQP 770 >AL021487-15|CAH60766.1| 618|Caenorhabditis elegans Hypothetical protein Y45F10B.13b protein. Length = 618 Score = 29.1 bits (62), Expect = 4.1 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 250 PPPPPPPPPP 259 >AL021487-14|CAA16360.3| 633|Caenorhabditis elegans Hypothetical protein Y45F10B.13a protein. Length = 633 Score = 29.1 bits (62), Expect = 4.1 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 265 PPPPPPPPPP 274 >AL021180-3|CAA15982.1| 1872|Caenorhabditis elegans Hypothetical protein T08A11.1 protein. Length = 1872 Score = 29.1 bits (62), Expect = 4.1 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP PPPP Sbjct: 818 PPPPPLPPPP 827 >AF106574-2|AAM81088.1| 315|Caenorhabditis elegans Hypothetical protein E02D9.1b protein. Length = 315 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 GG GGG P GGG GGG Sbjct: 7 GGRGGGFPARGGRGGGHGGG 26 >AF106574-1|AAY44015.1| 317|Caenorhabditis elegans Hypothetical protein E02D9.1c protein. Length = 317 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 GG GGG P GGG GGG Sbjct: 7 GGRGGGFPARGGRGGGHGGG 26 >AF068713-14|AAK73895.1| 172|Caenorhabditis elegans Ground-like (grd related) protein29 protein. Length = 172 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GG G GGGGG Sbjct: 33 GGGGCGGGGGCGGGCGYGGGGG 54 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 26 GGAGGCGGGGGCGGGGGCGGG 46 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG GG G GGG G GGG Sbjct: 32 GGGGGCGGGGGCGGGCGYGGG 52 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG G GGG Sbjct: 39 GGGGCGGGCGYGGGGGCGYGGG 60 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 381 GGXGGXXXGXXGGGGXGXGGG 319 GG G G GGGG G GGG Sbjct: 40 GGGCGGGCGYGGGGGCGYGGG 60 >AF038613-8|AAL02515.2| 309|Caenorhabditis elegans Human hnrnp a1 homolog protein1, isoform b protein. Length = 309 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXG--GGGG 368 G GG G P GGGG G GGGG Sbjct: 230 GQGGWGGPQQQQGGGGWGQQGGGG 253 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G P G G GG GG Sbjct: 187 GGGGWGGPAQRGGPGAYGGPGG 208 >AF038613-7|ABB51185.1| 308|Caenorhabditis elegans Human hnrnp a1 homolog protein1, isoform c protein. Length = 308 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXG--GGGG 368 G GG G P GGGG G GGGG Sbjct: 229 GQGGWGGPQQQQGGGGWGQQGGGG 252 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G P G G GG GG Sbjct: 187 GGGGWGGPAQRGGPGAYGGPGG 208 >AF038613-6|ABB51186.1| 347|Caenorhabditis elegans Human hnrnp a1 homolog protein1, isoform d protein. Length = 347 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXG--GGGG 368 G GG G P GGGG G GGGG Sbjct: 268 GQGGWGGPQQQQGGGGWGQQGGGG 291 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G P G G GG GG Sbjct: 225 GGGGWGGPAQRGGPGAYGGPGG 246 >AF038613-5|AAB92051.1| 346|Caenorhabditis elegans Human hnrnp a1 homolog protein1, isoform a protein. Length = 346 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXG--GGGG 368 G GG G P GGGG G GGGG Sbjct: 267 GQGGWGGPQQQQGGGGWGQQGGGG 290 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G P G G GG GG Sbjct: 225 GGGGWGGPAQRGGPGAYGGPGG 246 >AF016439-1|AAB65898.3| 721|Caenorhabditis elegans Hypothetical protein R02F11.2 protein. Length = 721 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXG 380 G GGG P P GGGG G Sbjct: 249 GNGGGRPRPGNGGGGGG 265 >AC024838-7|AAF60820.1| 381|Caenorhabditis elegans Hypothetical protein Y59E9AL.2 protein. Length = 381 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPP 425 PPPPP PPP G PPP Sbjct: 185 PPPPPIPPP-----GPPPP 198 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 P PPP PP P G PPPP Sbjct: 182 PKPPPPPPIPPPG---PPPP 198 >AC024838-3|AAF60821.1| 381|Caenorhabditis elegans Hypothetical protein Y59E9AL.3 protein. Length = 381 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPP 425 PPPPP PPP G PPP Sbjct: 185 PPPPPIPPP-----GPPPP 198 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 P PPP PP P G PPPP Sbjct: 182 PKPPPPPPIPPPG---PPPP 198 >Z67990-1|CAA91932.1| 316|Caenorhabditis elegans Hypothetical protein F02D10.1 protein. Length = 316 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 GG GGG GGGG GGG Sbjct: 85 GGAGGGGGYGAGGGGGGGGG 104 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGGG 371 GG GG GGGG GGGG Sbjct: 85 GGAGGGGGYGAGGGGGGGGG 104 Score = 28.3 bits (60), Expect = 7.1 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 3/24 (12%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXG---GGGG 368 GGGGG GGGG G GGGG Sbjct: 88 GGGGGYGAGGGGGGGGGEAAGGGG 111 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 G GGGG GGG GGGGG Sbjct: 86 GAGGGGG---YGAGGGGGGGGG 104 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGGG GGG Sbjct: 89 GGGGYGAGGGGGGGGGEAAGGG 110 >Z34533-1|CAA84302.3| 730|Caenorhabditis elegans Hypothetical protein B0285.1 protein. Length = 730 Score = 28.7 bits (61), Expect = 5.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPPPP PP P PPP Sbjct: 206 PPPPPLPPNSQFMTPPPRPPP 226 Score = 28.3 bits (60), Expect = 7.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP P PP PPP PP Sbjct: 206 PPPPPLPPNSQFMTPPPRPP 225 >U39848-6|AAL11100.1| 317|Caenorhabditis elegans Not-like (yeast ccr4/not complexcomponent) protein 2, isoform c protein. Length = 317 Score = 28.7 bits (61), Expect = 5.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGG--XPPPXXGGGGXGGGGG 368 GGGGGG PP G G GGGG Sbjct: 269 GGGGGGQITPPAPAGLNGVMGGGG 292 >U39848-5|AAL11099.1| 367|Caenorhabditis elegans Not-like (yeast ccr4/not complexcomponent) protein 2, isoform b protein. Length = 367 Score = 28.7 bits (61), Expect = 5.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGG--XPPPXXGGGGXGGGGG 368 GGGGGG PP G G GGGG Sbjct: 319 GGGGGGQITPPAPAGLNGVMGGGG 342 >U39848-4|AAA80691.1| 444|Caenorhabditis elegans Not-like (yeast ccr4/not complexcomponent) protein 2, isoform a protein. Length = 444 Score = 28.7 bits (61), Expect = 5.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGG--XPPPXXGGGGXGGGGG 368 GGGGGG PP G G GGGG Sbjct: 396 GGGGGGQITPPAPAGLNGVMGGGG 419 >U23139-1|AAK31493.2| 513|Caenorhabditis elegans Hypothetical protein F13H8.5 protein. Length = 513 Score = 28.7 bits (61), Expect = 5.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPPPP PP PPPP Sbjct: 216 PPPPPAPPAQTQAPLIRVPPPP 237 >L23648-5|AAN63385.1| 381|Caenorhabditis elegans Cyclin t protein 1.2, isoform b protein. Length = 381 Score = 28.7 bits (61), Expect = 5.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PP P PP PPPPPP Sbjct: 346 PPDEPSPPVSQILLPPPPPP 365 >L23648-4|AAA28033.2| 555|Caenorhabditis elegans Cyclin t protein 1.2, isoform a protein. Length = 555 Score = 28.7 bits (61), Expect = 5.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PP P PP PPPPPP Sbjct: 520 PPDEPSPPVSQILLPPPPPP 539 >AL032646-7|CAA21680.1| 485|Caenorhabditis elegans Hypothetical protein Y54E2A.8 protein. Length = 485 Score = 28.7 bits (61), Expect = 5.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PPP P P P PPPPP Sbjct: 153 PPPTPIPTPVPILEPPPPPPP 173 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 375 PPPXPPPPXXGGGXPPPPPP 434 PPP P P PPPPPP Sbjct: 153 PPPTPIPTPVPILEPPPPPP 172 Score = 25.4 bits (53), Expect(2) = 6.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 369 PPPPPXPPPP 398 PPPPP P PP Sbjct: 167 PPPPPPPVPP 176 Score = 21.4 bits (43), Expect(2) = 6.2 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +3 Query: 381 PXPPPPXXGGGXPPPPP 431 P PPPP PP P Sbjct: 197 PLPPPPAYTTPDVPPEP 213 >AL023835-10|CAA19494.2| 691|Caenorhabditis elegans Hypothetical protein Y37A1B.11 protein. Length = 691 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +1 Query: 718 PXXXPPPPXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 P P PP P P PPPPPP Sbjct: 542 PVREPTPPPPPREPTPREPTPEPEPVREPTPPPPPP 577 >AF003130-14|AAB54129.1| 892|Caenorhabditis elegans Hypothetical protein F55A12.1 protein. Length = 892 Score = 28.7 bits (61), Expect = 5.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPP 431 PP PP PP G PP PP Sbjct: 10 PPMPPMPPVTAPPGTMPPMPP 30 >Z81135-1|CAB03453.1| 627|Caenorhabditis elegans Hypothetical protein W01G7.1 protein. Length = 627 Score = 28.3 bits (60), Expect = 7.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP PPPP P P P Sbjct: 512 PPLPPLPPPPPPPKPKPAPVQP 533 Score = 28.3 bits (60), Expect = 7.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXP 379 PP P PPPP P P P Sbjct: 515 PPLPPPPPPPKPKPAPVQP 533 >Z77660-3|CAB01171.1| 471|Caenorhabditis elegans Hypothetical protein F38H4.3 protein. Length = 471 Score = 28.3 bits (60), Expect = 7.1 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +3 Query: 369 PPPPPXPPPPXXGG---GXPPPPP 431 PPP P PPP G G P PPP Sbjct: 333 PPPLPLSPPPNLYGQVAGSPIPPP 356 >Z74031-17|CAN86923.1| 380|Caenorhabditis elegans Hypothetical protein F32D8.7b protein. Length = 380 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPP PPPP PPPP P Sbjct: 242 PPPTTPPPP------PPPPAP 256 >Z74031-16|CAA98452.1| 378|Caenorhabditis elegans Hypothetical protein F32D8.7a protein. Length = 378 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPPP 434 PPP PPPP PPPP P Sbjct: 240 PPPTTPPPP------PPPPAP 254 >Z72502-7|CAA96592.1| 140|Caenorhabditis elegans Hypothetical protein C08B6.10 protein. Length = 140 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPP 425 PPPP PPPP G PPP Sbjct: 120 PPPPWGPPPP----GPPPP 134 >Z46937-1|CAA87056.2| 1036|Caenorhabditis elegans Hypothetical protein F43C1.1 protein. Length = 1036 Score = 28.3 bits (60), Expect = 7.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P PP PP P P PPPP Sbjct: 943 PSPPVPPPIPAIRHRTPSPPPP 964 >Z35719-1|CAA84800.1| 296|Caenorhabditis elegans Hypothetical protein F17C8.2 protein. Length = 296 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 2/23 (8%) Frame = +3 Query: 369 PPPPPXPP--PPXXGGGXPPPPP 431 PP PP PP P G PP PP Sbjct: 102 PPGPPGPPGEPGQPGSAGPPGPP 124 >U80439-8|AAB37646.3| 1724|Caenorhabditis elegans Hypothetical protein C01G8.9a protein. Length = 1724 Score = 28.3 bits (60), Expect = 7.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPPPPP 431 P P PP P GG PP PP Sbjct: 804 PGGPRPPYPYPGGPVPPGPP 823 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXPP 382 PPP PPPP P PP Sbjct: 227 PPPQQHPPPPQPQQIMSPMPP 247 >AY438643-1|AAR00670.1| 627|Caenorhabditis elegans abnormal DAuer Formation DAF-5,a Ski oncogene homolog involved in a neuronal TGF betapathway (71.0 kD) (daf-5) protein. Length = 627 Score = 28.3 bits (60), Expect = 7.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP PPPP P P P Sbjct: 512 PPLPPLPPPPPPPKPKPAPVQP 533 Score = 28.3 bits (60), Expect = 7.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXP 379 PP P PPPP P P P Sbjct: 515 PPLPPPPPPPKPKPAPVQP 533 >AL132904-4|CAC35836.2| 582|Caenorhabditis elegans Hypothetical protein Y111B2A.8 protein. Length = 582 Score = 28.3 bits (60), Expect = 7.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 372 PPPPXPPPPXXGGGXPP 422 PPPP P GGG PP Sbjct: 511 PPPPPPQSQQAGGGGPP 527 >AF098501-3|AAM69106.1| 275|Caenorhabditis elegans Hypothetical protein H28G03.2c protein. Length = 275 Score = 28.3 bits (60), Expect = 7.1 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPP---PPP 431 PPPP PPP G G P PPP Sbjct: 100 PPPPLGMPPPHIGLGAAPYAVPPP 123 >AF098501-2|AAM69105.1| 298|Caenorhabditis elegans Hypothetical protein H28G03.2b protein. Length = 298 Score = 28.3 bits (60), Expect = 7.1 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPP---PPP 431 PPPP PPP G G P PPP Sbjct: 123 PPPPLGMPPPHIGLGAAPYAVPPP 146 >AF098501-1|AAC67404.2| 548|Caenorhabditis elegans Hypothetical protein H28G03.2a protein. Length = 548 Score = 28.3 bits (60), Expect = 7.1 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPP---PPP 431 PPPP PPP G G P PPP Sbjct: 373 PPPPLGMPPPHIGLGAAPYAVPPP 396 >AF067607-3|AAF98607.1| 590|Caenorhabditis elegans Hypothetical protein C18H7.6 protein. Length = 590 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGG GG GG G GGGG Sbjct: 15 GGGAGGLGGGHGGGHGQAGGGG 36 >AF003151-19|AAK18922.1| 988|Caenorhabditis elegans Hypothetical protein D1007.7 protein. Length = 988 Score = 28.3 bits (60), Expect = 7.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 387 PPPPXXGGGXPPPPPP 434 PPPP G P PPPP Sbjct: 707 PPPPGIPGYPPAPPPP 722 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPP 428 P PP PPPP G PPPP Sbjct: 713 PGYPPAPPPPGVG---PPPP 729 >AC024859-14|AAY43989.1| 643|Caenorhabditis elegans Hypothetical protein Y71H2AM.19 protein. Length = 643 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGG G GGG GGGG Sbjct: 596 GGGGNGGGGGFGGGGQRSGGGG 617 Score = 27.9 bits (59), Expect = 9.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGX--GGGGG 368 GGG GG GGGG GGGGG Sbjct: 603 GGGFGGGGQRSGGGGGFQSGGGGG 626 >Z98866-8|CAB11562.2| 425|Caenorhabditis elegans Hypothetical protein Y49E10.10 protein. Length = 425 Score = 27.9 bits (59), Expect = 9.4 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 6/28 (21%) Frame = +3 Query: 369 PPPPPX--PPPPXXGGGXPP----PPPP 434 PPPP PPPP PP PPPP Sbjct: 175 PPPPTTKAPPPPTTKAPPPPTTKAPPPP 202 >Z92826-4|CAB07322.1| 309|Caenorhabditis elegans Hypothetical protein C18D11.4 protein. Length = 309 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGGG 368 GGGGG P GG GGGG Sbjct: 229 GGGGGRRGSPDRRGGFRSGGGG 250 >Z49131-6|CAA88979.1| 297|Caenorhabditis elegans Hypothetical protein ZC373.7 protein. Length = 297 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PP PP PP P G P P P Sbjct: 104 PPGPPGPPGPAGQPGTPGAPGP 125 >Z29561-4|CAD91697.1| 498|Caenorhabditis elegans Hypothetical protein R10E12.1d protein. Length = 498 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PP P P P PP Sbjct: 370 PPRPPPPRPAAPSVESPIPP 389 >Z29561-3|CAD54153.1| 846|Caenorhabditis elegans Hypothetical protein R10E12.1c protein. Length = 846 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PP P P P PP Sbjct: 754 PPRPPPPRPAAPSVESPIPP 773 >Z29561-2|CAD54152.1| 882|Caenorhabditis elegans Hypothetical protein R10E12.1b protein. Length = 882 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PP P P P PP Sbjct: 754 PPRPPPPRPAAPSVESPIPP 773 >Z29561-1|CAA82667.2| 861|Caenorhabditis elegans Hypothetical protein R10E12.1a protein. Length = 861 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PP P P P PP Sbjct: 733 PPRPPPPRPAAPSVESPIPP 752 >U93842-1|AAB52421.1| 1409|Caenorhabditis elegans regulator of presynaptic activity protein. Length = 1409 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP PP G PPP PP Sbjct: 981 PPPLGAPPKVPEGARAPPPLPP 1002 >U73679-1|AAC67305.1| 861|Caenorhabditis elegans YNK1-a protein. Length = 861 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 323 PPXPXPPPPXXPXXXPPXPP 382 PP P PP P P P PP Sbjct: 733 PPRPPPPRPAAPSVESPIPP 752 >U49945-3|AAM51509.1| 1408|Caenorhabditis elegans Aboc, expulsion defective protein3, isoform b protein. Length = 1408 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP PP G PPP PP Sbjct: 981 PPPLGAPPKVPEGARAPPPLPP 1002 >U49945-2|AAC47926.1| 1409|Caenorhabditis elegans Aboc, expulsion defective protein3, isoform a protein. Length = 1409 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 PPP PP G PPP PP Sbjct: 981 PPPLGAPPKVPEGARAPPPLPP 1002 >U41991-7|AAA83347.1| 255|Caenorhabditis elegans Hypothetical protein C42D4.3 protein. Length = 255 Score = 27.9 bits (59), Expect = 9.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 405 GGGXPPPPPP 434 GGG PPPPPP Sbjct: 32 GGGCPPPPPP 41 >U27312-9|AAA68252.1| 239|Caenorhabditis elegans Hypothetical protein F26A1.11 protein. Length = 239 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 5/27 (18%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPP-----PPPP 434 PP PP PP P PP PPPP Sbjct: 33 PPRPPRPPSPSRPQRPPPSRPQRPPPP 59 >L10986-3|AAA28018.1| 650|Caenorhabditis elegans Abnormal cell migration protein10, isoform b protein. Length = 650 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 2/23 (8%) Frame = +3 Query: 369 PPP--PPXPPPPXXGGGXPPPPP 431 PPP PP P P PPPPP Sbjct: 591 PPPVTPPKPCTPLTSKKAPPPPP 613 >L10986-2|AAK84523.2| 667|Caenorhabditis elegans Abnormal cell migration protein10, isoform a protein. Length = 667 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 2/23 (8%) Frame = +3 Query: 369 PPP--PPXPPPPXXGGGXPPPPP 431 PPP PP P P PPPPP Sbjct: 608 PPPVTPPKPCTPLTSKKAPPPPP 630 >L10986-1|AAR25648.1| 779|Caenorhabditis elegans Abnormal cell migration protein10, isoform c protein. Length = 779 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 2/23 (8%) Frame = +3 Query: 369 PPP--PPXPPPPXXGGGXPPPPP 431 PPP PP P P PPPPP Sbjct: 720 PPPVTPPKPCTPLTSKKAPPPPP 742 >AF098992-4|AAK73869.2| 250|Caenorhabditis elegans Hypothetical protein F53C3.6a protein. Length = 250 Score = 27.9 bits (59), Expect = 9.4 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 7/29 (24%) Frame = -3 Query: 433 GGGGGGXPPP-------XXGGGGXGGGGG 368 GGGGGG GGGG GGGGG Sbjct: 28 GGGGGGRGSSGARGGVGGRGGGGRGGGGG 56 >AF068713-16|AAD34663.1| 156|Caenorhabditis elegans Ground-like (grd related) protein31 protein. Length = 156 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGGG 371 GG G PPP GGG GG G Sbjct: 42 GGCGCAPPPPPCCGGGCGGCG 62 >AF038615-6|AAB94146.1| 157|Caenorhabditis elegans Ground-like (grd related) protein19 protein. Length = 157 Score = 27.9 bits (59), Expect = 9.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 3/24 (12%) Frame = -3 Query: 433 GGGGGG---XPPPXXGGGGXGGGG 371 GGGGGG PPP GG G GG Sbjct: 36 GGGGGGCCAPPPPPPVCGGCGCGG 59 >AC025716-19|AAK39602.2| 549|Caenorhabditis elegans Hypothetical protein Y39G10AR.17 protein. Length = 549 Score = 27.9 bits (59), Expect = 9.4 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 2/38 (5%) Frame = +1 Query: 718 PXXXPPP--PXPXXXXXXXXXXXXXXXAXAPXPPPPPP 825 P PPP P P AP PPPPPP Sbjct: 316 PPPIPPPIQPPPYSYYPVAPAAAPQVYHYAPPPPPPPP 353 >AC025716-14|AAK39603.1| 227|Caenorhabditis elegans Hypothetical protein Y39G10AR.16 protein. Length = 227 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +3 Query: 369 PPPPPXPPPPXXGGGXPPPPPP 434 P P P P P PPPP P Sbjct: 164 PAPAPAPAPAAVAPAPPPPPEP 185 >AC024824-3|AAK85501.1| 543|Caenorhabditis elegans Hypothetical protein Y55B1BR.1 protein. Length = 543 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 320 PPPXPXPPPPXXPXXXPPXP 379 PPP P P PP P P P Sbjct: 126 PPPRPPPVPPLSPPERPDIP 145 >AC006696-4|AAF39985.1| 215|Caenorhabditis elegans Hypothetical protein W08E12.6 protein. Length = 215 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 4/23 (17%) Frame = +3 Query: 369 PPPPPX----PPPPXXGGGXPPP 425 PPP P PPPP G PPP Sbjct: 48 PPPAPIFVAPPPPPCFGPACPPP 70 >AC006651-6|AAF39868.1| 833|Caenorhabditis elegans Hypothetical protein H06I04.3a protein. Length = 833 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 433 GGGGGGXPPPXXGGGGXGGG 374 GGGGGG GGGG GGG Sbjct: 815 GGGGGGR---GRGGGGRGGG 831 >AC006633-3|AAK68375.1| 227|Caenorhabditis elegans Hypothetical protein F35B3.4 protein. Length = 227 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 430 GGGGGXPPPXXGGGGXGGG 374 GGG PPP GG GGG Sbjct: 27 GGGCAPPPPPVCSGGCGGG 45 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,197,047 Number of Sequences: 27780 Number of extensions: 312217 Number of successful extensions: 14943 Number of sequences better than 10.0: 214 Number of HSP's better than 10.0 without gapping: 1399 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9977 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2050970610 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -