BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_A06 (837 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. 27 0.21 DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. 27 0.21 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 24 2.0 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 23 3.5 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 23 3.5 >DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. Length = 135 Score = 27.1 bits (57), Expect = 0.21 Identities = 12/44 (27%), Positives = 25/44 (56%) Frame = +1 Query: 547 DQEELRQYNEHFLIPRDIFXE*GKFQKQKISECXPIFIESXLLK 678 + E+ ++YNE L +I E G F++ + E I+++ ++K Sbjct: 55 EDEKPQRYNECILKQFNIVDESGNFKENIVQELTSIYLDENVIK 98 >DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. Length = 135 Score = 27.1 bits (57), Expect = 0.21 Identities = 12/44 (27%), Positives = 25/44 (56%) Frame = +1 Query: 547 DQEELRQYNEHFLIPRDIFXE*GKFQKQKISECXPIFIESXLLK 678 + E+ ++YNE L +I E G F++ + E I+++ ++K Sbjct: 55 EDEKPQRYNECILKQFNIVDESGNFKENIVQELTSIYLDENVIK 98 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.8 bits (49), Expect = 2.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 473 NASSGLTPSQYILIWETVTDD 535 N SSGL P + + +W++ T D Sbjct: 209 NPSSGLQPGEGLPMWKSDTSD 229 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.0 bits (47), Expect = 3.5 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 254 KYRRPSDSSFENRRRAARSK 313 KYR S F +RR RSK Sbjct: 291 KYRETSKERFRDRRERERSK 310 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 23.0 bits (47), Expect = 3.5 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = +2 Query: 236 QCSSCAKYRRPSDSSFENRRRAARSKPKVCSQCHQS 343 QC C+K ++ +RR + +P C C ++ Sbjct: 121 QCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCERA 156 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 231,776 Number of Sequences: 438 Number of extensions: 5416 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26824317 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -