BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_A05 (864 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 26 0.33 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 2.3 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 2.3 AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 23 4.1 AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve co... 22 7.1 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 21 9.4 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 26.2 bits (55), Expect = 0.33 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 283 DYGLFQINXRYWCSKGASPGK 345 DY + YW KGA PGK Sbjct: 2538 DYFNANFSLNYWIEKGADPGK 2558 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.4 bits (48), Expect = 2.3 Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +1 Query: 172 LRKHGFEEN-LMRNWVCLVEHESSRDTSKTNTNRNGSKDYGLFQ 300 L K N +R ++C E E+ SK N G+K L++ Sbjct: 320 LEKSNLNHNEQLRKYLCKNEDETKNHYSKNTYNEQGNKLADLYK 363 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.4 bits (48), Expect = 2.3 Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +1 Query: 172 LRKHGFEEN-LMRNWVCLVEHESSRDTSKTNTNRNGSKDYGLFQ 300 L K N +R ++C E E+ SK N G+K L++ Sbjct: 212 LEKSNLNHNEQLRKYLCKNEDETKNHYSKNTYNEQGNKLADLYK 255 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +1 Query: 148 TRCGLVHELRKHGFEENLMRNWVCLVEHESSRDTS 252 TR L H H + W+ +V ES DTS Sbjct: 248 TRLFLTHRKPFHPASTQSLSRWIKMVLAESGVDTS 282 >AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve cord defective protein protein. Length = 168 Score = 21.8 bits (44), Expect = 7.1 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -2 Query: 227 STRHTQFLMRFSSKPCFLSSCTRPHLVNVLASEPTQ 120 S T L R + +LS+ R HL +++ PTQ Sbjct: 48 SKAQTYELERRFRQQRYLSAPEREHLASIIRLTPTQ 83 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 21.4 bits (43), Expect = 9.4 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = -1 Query: 420 VNFLSAFRCLSNVVSQEV 367 +NF++ FR ++N++ V Sbjct: 74 INFVATFRTIANIILMAV 91 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,634 Number of Sequences: 336 Number of extensions: 3354 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23789590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -