Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP03_F_A04
         (868 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC13C5.03 |tht1||nuclear membrane protein involved in karyogam...    26   8.0  

>SPAC13C5.03 |tht1||nuclear membrane protein involved in karyogamy
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 543

 Score = 25.8 bits (54), Expect = 8.0
 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 7/71 (9%)
 Frame = +3

Query: 156 EPMVNLDMKMKE-LCIMKLLDHILQPTMFEDIKEIAKEY-NIEKSCDKYMN-----VDVV 314
           +P+ +L +++KE L  +K L    Q    E I +   ++ N+ K   K +      +D+V
Sbjct: 298 QPLYDLTIQLKEELQSLKRLSSEQQNLQHEQILQWKSDFLNVSKDHLKVLQQLRPLIDIV 357

Query: 315 KQFMEMYKMGM 347
           ++FM +Y  G+
Sbjct: 358 EKFMNVYFKGL 368


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,106,138
Number of Sequences: 5004
Number of extensions: 57435
Number of successful extensions: 150
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 148
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 150
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 432473040
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)