BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_A04 (868 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC13C5.03 |tht1||nuclear membrane protein involved in karyogam... 26 8.0 >SPAC13C5.03 |tht1||nuclear membrane protein involved in karyogamy |Schizosaccharomyces pombe|chr 1|||Manual Length = 543 Score = 25.8 bits (54), Expect = 8.0 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 7/71 (9%) Frame = +3 Query: 156 EPMVNLDMKMKE-LCIMKLLDHILQPTMFEDIKEIAKEY-NIEKSCDKYMN-----VDVV 314 +P+ +L +++KE L +K L Q E I + ++ N+ K K + +D+V Sbjct: 298 QPLYDLTIQLKEELQSLKRLSSEQQNLQHEQILQWKSDFLNVSKDHLKVLQQLRPLIDIV 357 Query: 315 KQFMEMYKMGM 347 ++FM +Y G+ Sbjct: 358 EKFMNVYFKGL 368 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,106,138 Number of Sequences: 5004 Number of extensions: 57435 Number of successful extensions: 150 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 150 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 432473040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -