BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_A03 (919 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 66 3e-11 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 55 8e-08 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 54 1e-07 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 54 1e-07 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 54 2e-07 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 53 2e-07 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 53 3e-07 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 51 9e-07 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 51 1e-06 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 50 3e-06 At1g61080.1 68414.m06877 proline-rich family protein 48 7e-06 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 48 1e-05 At5g38560.1 68418.m04662 protein kinase family protein contains ... 47 2e-05 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 47 2e-05 At4g01985.1 68417.m00265 expressed protein 47 2e-05 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 47 2e-05 At1g26150.1 68414.m03192 protein kinase family protein similar t... 47 2e-05 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 47 2e-05 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 47 2e-05 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 47 2e-05 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 47 2e-05 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 46 3e-05 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 46 3e-05 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 46 3e-05 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 46 3e-05 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 45 6e-05 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 45 6e-05 At1g75550.1 68414.m08780 glycine-rich protein 45 6e-05 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 45 8e-05 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 45 8e-05 At1g15830.1 68414.m01900 expressed protein 45 8e-05 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 44 1e-04 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 44 1e-04 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 44 1e-04 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 44 2e-04 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 43 2e-04 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 43 2e-04 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 43 3e-04 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 43 3e-04 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 43 3e-04 At1g23540.1 68414.m02960 protein kinase family protein contains ... 43 3e-04 At5g46730.1 68418.m05757 glycine-rich protein 42 4e-04 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 42 4e-04 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 42 4e-04 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 42 4e-04 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 42 4e-04 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 42 6e-04 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 42 8e-04 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 42 8e-04 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 42 8e-04 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 41 0.001 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 41 0.001 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 41 0.001 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 40 0.002 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 40 0.002 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 40 0.002 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 40 0.002 At3g24540.1 68416.m03082 protein kinase family protein contains ... 40 0.002 At2g30560.1 68415.m03722 glycine-rich protein 40 0.002 At1g27710.1 68414.m03387 glycine-rich protein 40 0.002 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 40 0.002 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 40 0.002 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 40 0.002 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 40 0.002 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 40 0.003 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 40 0.003 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 40 0.003 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 40 0.003 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 40 0.003 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 40 0.003 At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin fa... 40 0.003 At1g04800.1 68414.m00476 glycine-rich protein 40 0.003 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 39 0.004 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 39 0.004 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 39 0.004 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 39 0.004 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 39 0.004 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 39 0.004 At1g10620.1 68414.m01204 protein kinase family protein contains ... 39 0.004 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 39 0.005 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 39 0.005 At2g05510.1 68415.m00583 glycine-rich protein 38 0.007 At2g05440.2 68415.m00575 glycine-rich protein 38 0.007 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 38 0.007 At1g70250.1 68414.m08082 receptor serine/threonine kinase, putat... 38 0.007 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 38 0.009 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 38 0.009 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 38 0.012 At4g30460.1 68417.m04325 glycine-rich protein 38 0.012 At3g24550.1 68416.m03083 protein kinase family protein contains ... 38 0.012 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 38 0.012 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 38 0.012 At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar... 37 0.016 At1g70990.1 68414.m08190 proline-rich family protein 37 0.016 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 37 0.016 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 37 0.022 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 37 0.022 At5g07190.1 68418.m00819 embryo-specific protein 3, putative sim... 37 0.022 At4g18570.1 68417.m02749 proline-rich family protein common fami... 37 0.022 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 37 0.022 At1g04660.1 68414.m00463 glycine-rich protein 37 0.022 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 36 0.028 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 36 0.028 At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid t... 36 0.028 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 36 0.028 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 36 0.028 At2g05440.1 68415.m00574 glycine-rich protein 36 0.028 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 36 0.028 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 36 0.038 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 36 0.038 At4g29030.1 68417.m04151 glycine-rich protein glycine-rich prote... 36 0.038 At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi... 36 0.038 At4g08400.1 68417.m01388 proline-rich extensin-like family prote... 36 0.038 At3g05920.1 68416.m00668 heavy-metal-associated domain-containin... 36 0.038 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 36 0.038 At1g15840.1 68414.m01901 expressed protein 36 0.038 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 36 0.038 At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear... 36 0.050 At5g04970.1 68418.m00526 pectinesterase, putative contains simil... 36 0.050 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 36 0.050 At4g12490.1 68417.m01974 protease inhibitor/seed storage/lipid t... 36 0.050 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 36 0.050 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 36 0.050 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 36 0.050 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 35 0.066 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 35 0.066 At2g24980.1 68415.m02987 proline-rich extensin-like family prote... 35 0.066 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 35 0.066 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 35 0.066 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 35 0.066 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 35 0.066 At1g07135.1 68414.m00759 glycine-rich protein 35 0.066 At4g15460.1 68417.m02363 glycine-rich protein 35 0.087 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 35 0.087 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 35 0.087 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 35 0.087 At1g49270.1 68414.m05524 protein kinase family protein contains ... 35 0.087 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 35 0.087 At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi do... 35 0.087 At5g25550.1 68418.m03040 leucine-rich repeat family protein / ex... 34 0.11 At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; g... 34 0.11 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 34 0.11 At2g04190.1 68415.m00404 meprin and TRAF homology domain-contain... 34 0.11 At1g02710.1 68414.m00222 glycine-rich protein 34 0.11 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 33 0.13 At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; g... 34 0.15 At4g33660.1 68417.m04781 expressed protein 34 0.15 At4g08410.1 68417.m01390 proline-rich extensin-like family prote... 34 0.15 At3g54580.1 68416.m06039 proline-rich extensin-like family prote... 34 0.15 At3g10300.3 68416.m01236 calcium-binding EF hand family protein ... 34 0.15 At3g10300.2 68416.m01235 calcium-binding EF hand family protein ... 34 0.15 At3g10300.1 68416.m01234 calcium-binding EF hand family protein ... 34 0.15 At2g43680.2 68415.m05430 calmodulin-binding family protein simil... 34 0.15 At2g43680.1 68415.m05429 calmodulin-binding family protein simil... 34 0.15 At1g09460.1 68414.m01058 glucan endo-1,3-beta-glucosidase-relate... 34 0.15 At5g06640.1 68418.m00750 proline-rich extensin-like family prote... 33 0.20 At4g12500.1 68417.m01975 protease inhibitor/seed storage/lipid t... 33 0.20 At4g03120.1 68417.m00425 proline-rich family protein similar to ... 33 0.20 At3g50650.1 68416.m05540 scarecrow-like transcription factor 7 (... 33 0.20 At3g04640.1 68416.m00497 glycine-rich protein predicted proteins... 33 0.20 At2g18470.1 68415.m02151 protein kinase family protein contains ... 33 0.20 At1g62240.1 68414.m07021 expressed protein 33 0.20 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 33 0.20 At1g12810.1 68414.m01488 proline-rich family protein contains pr... 33 0.20 At1g11850.2 68414.m01364 expressed protein 33 0.20 At1g11130.1 68414.m01274 leucine-rich repeat family protein / pr... 33 0.20 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 33 0.26 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 33 0.26 At5g07530.1 68418.m00862 glycine-rich protein (GRP17) olesin; gl... 33 0.26 At4g34440.1 68417.m04894 protein kinase family protein contains ... 33 0.26 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 33 0.26 At4g09030.1 68417.m01490 arabinogalactan-protein (AGP10) identic... 33 0.26 At3g51290.1 68416.m05614 proline-rich family protein 33 0.26 At3g50180.1 68416.m05486 hypothetical protein 33 0.26 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 33 0.26 At2g43800.1 68415.m05445 formin homology 2 domain-containing pro... 33 0.26 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 33 0.26 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 33 0.26 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 33 0.26 At1g77030.1 68414.m08970 glycine-rich protein 33 0.26 At1g65440.1 68414.m07424 glycine-rich protein 33 0.26 At1g29380.1 68414.m03592 hypothetical protein 33 0.26 At5g49080.1 68418.m06074 proline-rich extensin-like family prote... 33 0.35 At5g35190.1 68418.m04170 proline-rich extensin-like family prote... 33 0.35 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 33 0.35 At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containi... 33 0.35 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 33 0.35 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 33 0.35 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 33 0.35 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 32 0.46 At5g52470.1 68418.m06510 fibrillarin 1 (FBR1) (FIB1) (SKIP7) ide... 32 0.46 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 32 0.46 At5g06630.1 68418.m00749 proline-rich extensin-like family prote... 32 0.46 At4g32640.1 68417.m04646 sec23/sec24 transport protein-related 32 0.46 At4g14750.1 68417.m02270 calmodulin-binding family protein conta... 32 0.46 At3g54590.1 68416.m06040 proline-rich extensin-like family prote... 32 0.46 At2g34870.1 68415.m04281 hydroxyproline-rich glycoprotein family... 32 0.46 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 32 0.46 At1g76930.2 68414.m08956 proline-rich extensin-like family prote... 32 0.46 At1g76930.1 68414.m08955 proline-rich extensin-like family prote... 32 0.46 At1g47660.1 68414.m05295 hypothetical protein 32 0.46 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 32 0.46 At1g21310.1 68414.m02662 proline-rich extensin-like family prote... 32 0.46 At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) 32 0.61 At5g22560.1 68418.m02635 hypothetical protein contains Pfam prof... 32 0.61 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 32 0.61 At4g39680.1 68417.m05614 SAP domain-containing protein contains ... 32 0.61 At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibri... 32 0.61 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 32 0.61 At3g16510.1 68416.m02107 C2 domain-containing protein contains s... 32 0.61 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 32 0.61 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 32 0.61 At2g28670.1 68415.m03485 disease resistance-responsive family pr... 32 0.61 At1g53625.1 68414.m06096 expressed protein 32 0.61 At1g31280.1 68414.m03828 PAZ domain-containing protein / piwi do... 32 0.61 At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp... 32 0.61 At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly id... 31 0.81 At5g61660.1 68418.m07736 glycine-rich protein 31 0.81 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 31 0.81 At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ... 31 0.81 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 31 0.81 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 31 0.81 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 31 0.81 At3g26400.1 68416.m03292 eukaryotic translation initiation facto... 31 0.81 At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) s... 31 0.81 At3g07195.1 68416.m00858 proline-rich family protein 31 0.81 At2g05530.1 68415.m00585 glycine-rich protein 31 0.81 At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical ... 31 0.81 At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family p... 31 0.81 At1g11850.1 68414.m01363 expressed protein 31 0.81 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 30 0.83 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 31 1.1 At5g13760.1 68418.m01604 expressed protein similar to unknown pr... 31 1.1 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 31 1.1 At3g49300.1 68416.m05388 proline-rich family protein contains pr... 31 1.1 At3g43583.1 68416.m04636 hypothetical protein 31 1.1 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 31 1.1 At2g21140.1 68415.m02508 hydroxyproline-rich glycoprotein family... 31 1.1 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 31 1.1 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 31 1.1 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 31 1.4 At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family prot... 31 1.4 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 31 1.4 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 31 1.4 At3g42130.1 68416.m04326 glycine-rich protein 31 1.4 At3g21215.1 68416.m02681 RNA-binding protein, putative contains ... 31 1.4 At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuc... 31 1.4 At1g63550.1 68414.m07184 hypothetical protein low similarity to ... 31 1.4 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 31 1.4 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 30 1.9 At4g21620.1 68417.m03134 glycine-rich protein 30 1.9 At3g57670.1 68416.m06425 zinc finger (C2H2 type) protein (WIP2) ... 30 1.9 At3g55790.1 68416.m06199 expressed protein predicted protein, Ar... 30 1.9 At3g45540.1 68416.m04918 zinc finger (C3HC4-type RING finger) fa... 30 1.9 At3g29390.1 68416.m03693 hydroxyproline-rich glycoprotein family... 30 1.9 At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar... 30 1.9 At3g02670.1 68416.m00258 proline-rich family protein contains pr... 30 1.9 At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical t... 30 1.9 At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical t... 30 1.9 At2g39750.1 68415.m04881 dehydration-responsive family protein s... 30 1.9 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 30 1.9 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 30 1.9 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 30 1.9 At5g55070.1 68418.m06864 2-oxoacid dehydrogenase family protein ... 30 2.5 At5g48360.1 68418.m05975 formin homology 2 domain-containing pro... 30 2.5 At4g14370.1 68417.m02214 disease resistance protein (TIR-NBS-LRR... 30 2.5 At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid t... 30 2.5 At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family... 30 2.5 At2g10940.2 68415.m01168 protease inhibitor/seed storage/lipid t... 30 2.5 At2g10940.1 68415.m01167 protease inhibitor/seed storage/lipid t... 30 2.5 At1g55540.1 68414.m06356 proline-rich family protein contains pr... 30 2.5 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 30 2.5 At5g58540.1 68418.m07330 protein kinase family protein contains ... 29 3.3 At5g21160.1 68418.m02528 La domain-containing protein / proline-... 29 3.3 At4g23882.1 68417.m03434 heavy-metal-associated domain-containin... 29 3.3 At4g22740.2 68417.m03281 glycine-rich protein 29 3.3 At4g22740.1 68417.m03280 glycine-rich protein 29 3.3 At4g21720.1 68417.m03145 expressed protein 29 3.3 At4g19920.1 68417.m02918 disease resistance protein (TIR class),... 29 3.3 At2g34670.1 68415.m04259 proline-rich family protein contains pr... 29 3.3 At2g11005.1 68415.m01177 glycine-rich protein 29 3.3 At1g63570.1 68414.m07186 receptor-like protein kinase-related co... 29 3.3 At1g48100.1 68414.m05368 glycoside hydrolase family 28 protein /... 29 3.3 At1g14710.2 68414.m01759 hydroxyproline-rich glycoprotein family... 29 3.3 At1g14710.1 68414.m01758 hydroxyproline-rich glycoprotein family... 29 3.3 At1g02460.1 68414.m00195 glycoside hydrolase family 28 protein /... 29 3.3 At5g26070.1 68418.m03102 hydroxyproline-rich glycoprotein family... 29 4.3 At5g07150.1 68418.m00815 leucine-rich repeat family protein cont... 29 4.3 At4g25790.1 68417.m03711 allergen V5/Tpx-1-related family protei... 29 4.3 At4g08230.1 68417.m01358 glycine-rich protein 29 4.3 At3g60900.1 68416.m06813 fasciclin-like arabinogalactan-protein ... 29 4.3 At3g13225.1 68416.m01660 WW domain-containing protein contains P... 29 4.3 At3g08640.1 68416.m01003 alphavirus core protein family contains... 29 4.3 At3g07540.1 68416.m00900 formin homology 2 domain-containing pro... 29 4.3 At2g23990.2 68415.m02866 plastocyanin-like domain-containing pro... 29 4.3 At2g23990.1 68415.m02865 plastocyanin-like domain-containing pro... 29 4.3 At2g23770.1 68415.m02839 protein kinase family protein / peptido... 29 4.3 At1g79480.1 68414.m09263 hypothetical protein low similarity to ... 29 4.3 At1g51090.1 68414.m05744 heavy-metal-associated domain-containin... 29 4.3 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 29 4.3 At1g32360.1 68414.m03989 zinc finger (CCCH-type) family protein ... 29 4.3 At1g30780.1 68414.m03763 F-box family protein 29 4.3 At1g20990.1 68414.m02627 DC1 domain-containing protein contains ... 29 4.3 At5g66400.1 68418.m08374 dehydrin (RAB18) nearly identical to SP... 29 5.7 At4g23140.2 68417.m03338 receptor-like protein kinase 5 (RLK5) i... 29 5.7 At4g23140.1 68417.m03337 receptor-like protein kinase 5 (RLK5) i... 29 5.7 At4g16240.1 68417.m02464 hypothetical protein 29 5.7 At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / he... 29 5.7 At3g62680.1 68416.m07041 proline-rich family protein contains pr... 29 5.7 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 29 5.7 At3g28790.1 68416.m03593 expressed protein 29 5.7 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 29 5.7 At3g18810.1 68416.m02389 protein kinase family protein contains ... 29 5.7 At3g18360.1 68416.m02335 VQ motif-containing protein contains PF... 29 5.7 At2g23130.2 68415.m02759 arabinogalactan-protein (AGP17) identic... 29 5.7 At2g23130.1 68415.m02760 arabinogalactan-protein (AGP17) identic... 29 5.7 At1g54970.1 68414.m06278 proline-rich family protein similar to ... 29 5.7 At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F... 29 5.7 At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F... 29 5.7 At1g30795.1 68414.m03765 hydroxyproline-rich glycoprotein family... 29 5.7 At1g26110.1 68414.m03186 expressed protein 29 5.7 At1g15130.1 68414.m01807 hydroxyproline-rich glycoprotein family... 29 5.7 At5g14420.4 68418.m01687 copine-related low similarity to SP|Q99... 28 7.5 At5g14420.3 68418.m01686 copine-related low similarity to SP|Q99... 28 7.5 At5g14420.2 68418.m01685 copine-related low similarity to SP|Q99... 28 7.5 At5g14420.1 68418.m01684 copine-related low similarity to SP|Q99... 28 7.5 At4g32375.1 68417.m04610 glycoside hydrolase family 28 protein /... 28 7.5 At4g25620.1 68417.m03690 hydroxyproline-rich glycoprotein family... 28 7.5 At3g49840.1 68416.m05449 proline-rich family protein contains pr... 28 7.5 At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, ... 28 7.5 At3g47400.1 68416.m05154 pectinesterase family protein similar t... 28 7.5 At3g26990.1 68416.m03377 expressed protein contains Pfam domain,... 28 7.5 At3g23270.1 68416.m02933 regulator of chromosome condensation (R... 28 7.5 At3g11402.1 68416.m01388 DC1 domain-containing protein contains ... 28 7.5 At3g08630.1 68416.m01002 expressed protein 28 7.5 At2g45470.1 68415.m05655 fasciclin-like arabinogalactan-protein ... 28 7.5 At2g43970.2 68415.m05468 La domain-containing protein contains P... 28 7.5 At2g43970.1 68415.m05467 La domain-containing protein contains P... 28 7.5 At1g30970.1 68414.m03792 zinc finger (C2H2 type) family protein ... 28 7.5 At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative si... 28 7.5 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 28 8.4 At5g64430.1 68418.m08093 octicosapeptide/Phox/Bem1p (PB1) domain... 28 10.0 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 28 10.0 At5g56890.1 68418.m07099 protein kinase family protein contains ... 28 10.0 At5g56140.1 68418.m07003 KH domain-containing protein 28 10.0 At5g02530.1 68418.m00187 RNA and export factor-binding protein, ... 28 10.0 At4g03390.1 68417.m00461 leucine-rich repeat transmembrane prote... 28 10.0 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 28 10.0 At3g15400.1 68416.m01954 anther development protein, putative si... 28 10.0 At3g02540.2 68416.m00243 ubiquitin family protein contains Pfam ... 28 10.0 At3g02540.1 68416.m00242 ubiquitin family protein contains Pfam ... 28 10.0 At3g01560.1 68416.m00086 proline-rich family protein contains pr... 28 10.0 At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ b... 28 10.0 At2g30505.1 68415.m03716 Expressed protein 28 10.0 At1g63600.1 68414.m07189 protein kinase-related low similarity t... 28 10.0 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 28 10.0 At1g36675.1 68414.m04563 glycine-rich protein 28 10.0 At1g35830.1 68414.m04452 VQ motif-containing protein contains PF... 28 10.0 At1g24490.1 68414.m03084 60 kDa inner membrane family protein si... 28 10.0 At1g17790.1 68414.m02202 DNA-binding bromodomain-containing prot... 28 10.0 At1g04930.1 68414.m00490 hydroxyproline-rich glycoprotein family... 28 10.0 At1g01320.1 68414.m00048 tetratricopeptide repeat (TPR)-containi... 28 10.0 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 66.1 bits (154), Expect = 3e-11 Identities = 44/161 (27%), Positives = 49/161 (30%), Gaps = 4/161 (2%) Frame = +2 Query: 377 PXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXP 556 P P P P+ PPP PP P SPPP P PPPP P P Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPP---PVYSP 482 Query: 557 PQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXX 736 P PPP P + P P + P PS Sbjct: 483 PPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPP 542 Query: 737 XXXXP----PXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 P P PP P P P + P S PP +P P Sbjct: 543 HSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPP 583 Score = 63.7 bits (148), Expect = 2e-10 Identities = 45/164 (27%), Positives = 48/164 (29%), Gaps = 6/164 (3%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXP---SPPPXXPXXPPPPFXTP 544 PP P P P+ PPP PP P P SPPP P PPPP +P Sbjct: 438 PPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSP 497 Query: 545 XXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXX 724 P P PPP P + P P P P Sbjct: 498 ----PPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPP 553 Query: 725 XXXXXXXXPPXPP---PPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 P PP PP PPP P PP P P Sbjct: 554 PPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTP 597 Score = 53.6 bits (123), Expect = 2e-07 Identities = 45/160 (28%), Positives = 51/160 (31%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPX 547 + P P P L P P +PP P SPPP P PPPP + Sbjct: 395 RPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPP--PPPPVYS-- 450 Query: 548 XXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXX 727 PP P PPP P + P P P PS Sbjct: 451 --PPPPPPPPPPPPVYSPPPP---------PPPPPPPPPVYSPPPPS-----PPPPPPPV 494 Query: 728 XXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP PPPP PPP P + P PP +P P Sbjct: 495 YSPPPPPPPPPPPPVYSPPPPPVYSSP-----PPPPSPAP 529 Score = 46.8 bits (106), Expect = 2e-05 Identities = 39/143 (27%), Positives = 41/143 (28%), Gaps = 2/143 (1%) Frame = +2 Query: 425 PPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPP--PFXTPXXXPPQXPTXPPPXPXFX 598 PP G P P PPP P PPP F TP P PPP P + Sbjct: 379 PPVNCGSFSCGRSVSPRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPP-PVYS 437 Query: 599 LPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXX 778 P P P P + PP PPP Sbjct: 438 PPPPPPPP-----PPVYSPPPPPPPPPPPPVY----------SPPPPPPPPPPPPPVYSP 482 Query: 779 PPPXPXXAXPXSXSXXPPGAPXP 847 PPP P P S PP P P Sbjct: 483 PPPSPPPPPPPVYSPPPPPPPPP 505 Score = 46.8 bits (106), Expect = 2e-05 Identities = 31/83 (37%), Positives = 34/83 (40%), Gaps = 3/83 (3%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXX 550 +PP P P P PPP +PP P SPPP P PPPP P Sbjct: 536 RPPPPP-PHSPPPPQFSPPPPEPYY--YSSPPPPHSSPPPHSPPP--PHSPPPPIY-PYL 589 Query: 551 XPPQXPT---XPPPXPXFXLPRP 610 PP PT PPP P + P P Sbjct: 590 SPPPPPTPVSSPPPTPVYSPPPP 612 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/72 (33%), Positives = 26/72 (36%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 P P P P PPP +PP P + P P P PPPP P Sbjct: 566 PHSSPPPHSPPPPHSPPPPIYPYL----SPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPP 621 Query: 554 PPQXPTXPPPXP 589 PP PPP P Sbjct: 622 PPCIEYSPPPPP 633 Score = 44.0 bits (99), Expect = 1e-04 Identities = 35/143 (24%), Positives = 36/143 (25%), Gaps = 6/143 (4%) Frame = +3 Query: 423 PPPXXXXPXGGXPPXPPXXXXXXXXXXXXXXXXXXXXXXXXXXXRPXTPLXPPXXPXXXX 602 PPP P PP PP P P P P Sbjct: 476 PPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCT 535 Query: 603 ----PXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPP- 767 P P S P P PPP +P PP P PPP Sbjct: 536 RPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPP 595 Query: 768 -PXXXPPPXXXRPPXPLXPXXHP 833 P PPP P P P P Sbjct: 596 TPVSSPPPTPVYSPPPPPPCIEP 618 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/57 (36%), Positives = 23/57 (40%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P F PP +P PP P PPP PPP PP P P P + P Sbjct: 412 PPAPIFST--PPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSP 466 Score = 42.3 bits (95), Expect = 4e-04 Identities = 39/178 (21%), Positives = 43/178 (24%), Gaps = 6/178 (3%) Frame = +3 Query: 402 PFWGGXXPPPXXXXPXGGXPPXPPXXXXXXXXXXXXXXXXXXXXXXXXXXXRPXTPLX-- 575 P + PPP P PP PP P P Sbjct: 493 PVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSP 552 Query: 576 PPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPPXXPXXX 755 PP P P S P + + PPP P +PP P Sbjct: 553 PPPEPYYYSSPPPPHS----SPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYS 608 Query: 756 XPPPP----XXXPPPXXXRPPXPLXPXXHPGRHXPXNTIXXXXXXXXXXXXXPPQKXP 917 PPPP PPP P P P H P PP P Sbjct: 609 PPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPP 666 Score = 42.3 bits (95), Expect = 4e-04 Identities = 22/69 (31%), Positives = 29/69 (42%), Gaps = 3/69 (4%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP---FXTPXXXP 556 P P P++ PPP PP P ++ P PPP PPPP + +P P Sbjct: 629 PPPPPPVVHYSSPPPPPVYYSSP--PPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSP 686 Query: 557 PQXPTXPPP 583 + PPP Sbjct: 687 VHYSSPPPP 695 Score = 41.5 bits (93), Expect = 8e-04 Identities = 26/82 (31%), Positives = 28/82 (34%), Gaps = 3/82 (3%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXX---PXXPPPPFXTP 544 PP P P PPP +PP P PPP P PPPP P Sbjct: 523 PPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPP 582 Query: 545 XXXPPQXPTXPPPXPXFXLPRP 610 PP P PP P + P Sbjct: 583 ---PPIYPYLSPPPPPTPVSSP 601 Score = 41.5 bits (93), Expect = 8e-04 Identities = 27/85 (31%), Positives = 30/85 (35%), Gaps = 6/85 (7%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXG----APPXPXXRATXPSPPPXXPXXPPP-PFX 538 P P P P PPP +PP P P PPP PPP P Sbjct: 548 PQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVY 607 Query: 539 TPXXXPP-QXPTXPPPXPXFXLPRP 610 +P PP P PPP + P P Sbjct: 608 SPPPPPPCIEPPPPPPCIEYSPPPP 632 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 4/52 (7%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPP----XXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P P P PP P+P PP P PPP PPP PP P P Sbjct: 394 PRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPP 445 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPT-PTPPXX--PXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P P PPP P TPP P PPPP PPP PP P P Sbjct: 401 PLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPP 455 Score = 40.7 bits (91), Expect = 0.001 Identities = 27/85 (31%), Positives = 28/85 (32%), Gaps = 7/85 (8%) Frame = +2 Query: 377 PXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPP-----XXPXXPPPPFXT 541 P P P P PPP PP P PP P PPP T Sbjct: 537 PPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPT 596 Query: 542 PXXXPPQXP--TXPPPXPXFXLPRP 610 P PP P + PPP P P P Sbjct: 597 PVSSPPPTPVYSPPPPPPCIEPPPP 621 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/74 (31%), Positives = 27/74 (36%), Gaps = 2/74 (2%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP--FXTPX 547 P P P P + PPP PP P + P PPP PPPP + + Sbjct: 605 PVYSPPPPPPCIEPPPPPPCIEYSP---PPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSP 661 Query: 548 XXPPQXPTXPPPXP 589 PP PP P Sbjct: 662 PPPPPVHYSSPPPP 675 Score = 39.1 bits (87), Expect = 0.004 Identities = 25/82 (30%), Positives = 29/82 (35%), Gaps = 3/82 (3%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXX--PXXPPPP-FXTP 544 PP P P PPP PP P + P PPP PPPP + + Sbjct: 593 PPPTPVSSPPPTPVYSPPPPPPCIEPP--PPPPCIEYSPPPPPPVVHYSSPPPPPVYYSS 650 Query: 545 XXXPPQXPTXPPPXPXFXLPRP 610 PP + PPP P P Sbjct: 651 PPPPPVYYSSPPPPPPVHYSSP 672 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/45 (40%), Positives = 20/45 (44%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P PPP +P PP P PPP PPP PP P+ P Sbjct: 429 PSPPPPVYSPPPPPPP----PPPVYSPPPPPPPPPPPPVYSPPPP 469 Score = 38.3 bits (85), Expect = 0.007 Identities = 23/75 (30%), Positives = 27/75 (36%), Gaps = 3/75 (4%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXX---PXXPPPPFXTP 544 P P P P + PPP +PP P + P PPP P PPP + Sbjct: 614 PCIEPPPPPPCIEYSPPPPPPVVHYS--SPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSS 671 Query: 545 XXXPPQXPTXPPPXP 589 P PPP P Sbjct: 672 PPPPEVHYHSPPPSP 686 Score = 36.7 bits (81), Expect = 0.022 Identities = 31/132 (23%), Positives = 32/132 (24%), Gaps = 2/132 (1%) Frame = +3 Query: 423 PPPXXXXPXGGXPPXPPXXXXXXXXXXXXXXXXXXXXXXXXXXXRPXTPLXPPXXPXXXX 602 PPP P PP PP P PP P Sbjct: 490 PPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQ 549 Query: 603 PXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPX--X 776 P S P P P P +P PP P PP P Sbjct: 550 FSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSP 609 Query: 777 XPPPXXXRPPXP 812 PPP PP P Sbjct: 610 PPPPPCIEPPPP 621 Score = 36.7 bits (81), Expect = 0.022 Identities = 23/77 (29%), Positives = 26/77 (33%), Gaps = 2/77 (2%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPP--PXXPXXPPPPFXTPXXXPP 559 P P P+ PPP PP P ++ P PP P PP P PP Sbjct: 661 PPPPPPVHYSSPPPPEVHYH---SPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPP 717 Query: 560 QXPTXPPPXPXFXLPRP 610 PPP P P Sbjct: 718 MVHHSPPPPVIHQSPPP 734 Score = 36.7 bits (81), Expect = 0.022 Identities = 22/74 (29%), Positives = 26/74 (35%), Gaps = 1/74 (1%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQX-P 568 P P + PPP PP + P P P PPPP PP Sbjct: 672 PPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPP-PAPVVHHSPPPPMVHHSPPPPVIHQ 730 Query: 569 TXPPPXPXFXLPRP 610 + PPP P + P P Sbjct: 731 SPPPPSPEYEGPLP 744 Score = 34.7 bits (76), Expect = 0.087 Identities = 30/139 (21%), Positives = 33/139 (23%), Gaps = 8/139 (5%) Frame = +3 Query: 423 PPPXXXXPXGGXPPXPPXXXXXXXXXXXXXXXXXXXXXXXXXXXRPXTPLXPPXXPXXXX 602 PPP P PP PP P P+ P P Sbjct: 460 PPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYS 519 Query: 603 PXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXP--------PPXPTPTPPXXPXXXX 758 P P P F P P PP + PP P Sbjct: 520 SPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPH 579 Query: 759 PPPPXXXPPPXXXRPPXPL 815 PPP P PP P+ Sbjct: 580 SPPPPIYPYLSPPPPPTPV 598 Score = 33.5 bits (73), Expect = 0.20 Identities = 22/71 (30%), Positives = 25/71 (35%), Gaps = 5/71 (7%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P+ PPP PP P + P PPP PPP PP P+ Sbjct: 642 PPPPVYYSSPPPPPVYYS---SPPPPPPVHYSSP-PPPEVHYHSPPPSPVHYSSPPPPPS 697 Query: 572 -----XPPPXP 589 PPP P Sbjct: 698 APCEESPPPAP 708 Score = 31.5 bits (68), Expect = 0.81 Identities = 37/181 (20%), Positives = 43/181 (23%), Gaps = 9/181 (4%) Frame = +3 Query: 402 PFWGGXXPPPXXXXPXGGXPPX--PPXXXXXXXXXXXXXXXXXXXXXXXXXXXRPXTP-L 572 P++ PPP P PP PP P P + Sbjct: 557 PYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCI 616 Query: 573 XPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXP----TPTPPX 740 PP P P P P + PPP P +P PP Sbjct: 617 EPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPE 676 Query: 741 XPXXXXPPPP--XXXPPPXXXRPPXPLXPXXHPGRHXPXNTIXXXXXXXXXXXXXPPQKX 914 PP P PPP P P H P + PP Sbjct: 677 VHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPPMVHHSPPPPVIHQSPPPPS 736 Query: 915 P 917 P Sbjct: 737 P 737 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = +3 Query: 696 CPXXPPPXPTP--TPPXXPXXXXPPPPX--XXPPPXXXRPPXPLXP 821 C PPP P +PP PPPP PPP PL P Sbjct: 700 CEESPPPAPVVHHSPPPPMVHHSPPPPVIHQSPPPPSPEYEGPLPP 745 Score = 30.7 bits (66), Expect = 1.4 Identities = 22/76 (28%), Positives = 24/76 (31%), Gaps = 3/76 (3%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PPP PP + PSP PPPP PP P Sbjct: 651 PPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSS-PPPPPSAPCEESPPPAPV 709 Query: 572 ---XPPPXPXFXLPRP 610 PPP P P Sbjct: 710 VHHSPPPPMVHHSPPP 725 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/65 (26%), Positives = 21/65 (32%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 P P P++ PPP +PP P + P P P PP Sbjct: 699 PCEESPPPAPVVHHSPPPPMVHH-----SPPPPVIHQSPPPPSPEYEGPLPPVIGVSYAS 753 Query: 554 PPQXP 568 PP P Sbjct: 754 PPPPP 758 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 54.8 bits (126), Expect = 8e-08 Identities = 40/153 (26%), Positives = 47/153 (30%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P P + PPP +PP P + P PPP PPPP+ Sbjct: 460 PPPSPSPPPPYVYSSPPPPYVY-----SSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPP 514 Query: 554 PPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXX 733 PP + PPP P P P P P + Sbjct: 515 PPYVYSSPPPPP----PSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPP 570 Query: 734 XXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPP 832 PP P PPP P P + S PP Sbjct: 571 SPVYYPPVTNSP---PPPSPVYYPPVTYSPPPP 600 Score = 46.0 bits (104), Expect = 4e-05 Identities = 25/82 (30%), Positives = 31/82 (37%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTP 544 K P R P P PPP +PP P ++ P PP PPPP+ Sbjct: 448 KMSPSVRAYPPPPPPSPSPPPPYVY-----SSPPPPYVYSSPPPPPYVYSSPPPPPYVYS 502 Query: 545 XXXPPQXPTXPPPXPXFXLPRP 610 PP + PPP + P P Sbjct: 503 SPPPPYVYSSPPPPYVYSSPPP 524 Score = 46.0 bits (104), Expect = 4e-05 Identities = 27/85 (31%), Positives = 32/85 (37%), Gaps = 8/85 (9%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXX---RATXPSPPPXXPXX-----PPP 529 PP P P+ PP +PP P PSPPP P P P Sbjct: 568 PPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSP 627 Query: 530 PFXTPXXXPPQXPTXPPPXPXFXLP 604 P +P PP P+ PPP P + P Sbjct: 628 PPPSPVYYPPVTPSPPPPSPVYYPP 652 Score = 44.0 bits (99), Expect = 1e-04 Identities = 26/82 (31%), Positives = 31/82 (37%), Gaps = 8/82 (9%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXR---ATXPSPPPXXPXX-----PPP 529 PP P P+ PP +PP P PSPPP P P P Sbjct: 583 PPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSP 642 Query: 530 PFXTPXXXPPQXPTXPPPXPXF 595 P +P PP P+ PPP P + Sbjct: 643 PPPSPVYYPPVTPSPPPPSPVY 664 Score = 40.3 bits (90), Expect = 0.002 Identities = 38/161 (23%), Positives = 44/161 (27%), Gaps = 8/161 (4%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXX-PPPPFX-TPX 547 PP P + PPP P PSPPP PPPP+ + Sbjct: 425 PPPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSP 484 Query: 548 XXPPQXPTXPPPXP-XFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXX 724 PP + PPP P + P P P P Sbjct: 485 PPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVY 544 Query: 725 XXXXXXXXPP-----XPPPPXXXPPPXPXXAXPXSXSXXPP 832 PP PP PPP P P + S PP Sbjct: 545 YAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPP 585 Score = 36.7 bits (81), Expect = 0.022 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P PPP P PP P PPP PP PP P P +P Sbjct: 621 PPVTPSPPPPSPVYYPPVTP--SPPPPSPVYYPPVTPSPPPP-SPVYYP 666 Score = 36.3 bits (80), Expect = 0.028 Identities = 37/168 (22%), Positives = 44/168 (26%), Gaps = 5/168 (2%) Frame = +2 Query: 359 TXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXG---APPXPXXRATXPSPPPXXPXXPPP 529 T K P R P + PPP +PP P PS P PPP Sbjct: 387 TFKMSPEVRTLPPPIYVYSSPPPPPSSKMSPTVRAYSPPPPPSSKMSPSVRAYSP--PPP 444 Query: 530 PFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFL--XX 703 P+ P PPP P P + P P ++ Sbjct: 445 PYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSP 504 Query: 704 XXXXXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PPPP PPP P + P P P Sbjct: 505 PPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSP 552 Score = 36.3 bits (80), Expect = 0.028 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P PPP P PP P PPP PP PP P P +P Sbjct: 606 PQVTPSPPPPSPLYYPPVTP--SPPPPSPVYYPPVTPSPPPP-SPVYYP 651 Score = 34.7 bits (76), Expect = 0.087 Identities = 23/85 (27%), Positives = 29/85 (34%), Gaps = 8/85 (9%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXX---RATXPSPPPXXPXX-----PPP 529 PP P + PP +PP P PSPPP P P P Sbjct: 598 PPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSP 657 Query: 530 PFXTPXXXPPQXPTXPPPXPXFXLP 604 P +P P + + PPP + P Sbjct: 658 PPPSPVYYPSETQSPPPPTEYYYSP 682 Score = 34.7 bits (76), Expect = 0.087 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P PPP P PP P PPP P PP P P + P Sbjct: 636 PPVTPSPPPPSPVYYPPVTP--SPPPPSPVYYPSETQSPPPPTEYYYSPSQSPP 687 Score = 33.5 bits (73), Expect = 0.20 Identities = 25/84 (29%), Positives = 28/84 (33%), Gaps = 7/84 (8%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXP--SPPPXXPXXP-PPPFXTP 544 PP P P+ PP +PP P P SPPP PP TP Sbjct: 643 PPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPPTEYYYSPSQSPPPTKACKEGHPPQATP 702 Query: 545 XXXPP----QXPTXPPPXPXFXLP 604 PP + PPP P P Sbjct: 703 SYEPPPEYSYSSSPPPPSPTSYFP 726 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 4/42 (9%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P PPP P+P PP PPPP PPP P P Sbjct: 457 PPPPPPSPSPPPPY--VYSSPPPPYVYSSPPPPPYVYSSPPP 496 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/51 (37%), Positives = 21/51 (41%), Gaps = 6/51 (11%) Frame = +3 Query: 699 PXXPPPXPTPTPPXX-----PXXXXPPPPXXXP-PPXXXRPPXPLXPXXHP 833 P PPP P +PP P PPPP PP PP P P +P Sbjct: 527 PSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPP-SPVYYP 576 Score = 31.5 bits (68), Expect = 0.81 Identities = 21/73 (28%), Positives = 22/73 (30%), Gaps = 2/73 (2%) Frame = +2 Query: 377 PXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXXX 553 P P P PPP P P PP P PPP + Sbjct: 657 PPPPSPVYYPSETQSPPPPTEYYYSPSQSPPPTKACKEGHPPQATPSYEPPPEYSYSSSP 716 Query: 554 PPQXPTXP-PPXP 589 PP PT PP P Sbjct: 717 PPPSPTSYFPPMP 729 Score = 31.1 bits (67), Expect = 1.1 Identities = 30/138 (21%), Positives = 30/138 (21%), Gaps = 1/138 (0%) Frame = +3 Query: 423 PPPXXXXPXGGXPPXPPXXXXXXXXXXXXXXXXXXXXXXXXXXXRPXTPLXPPXXPXXXX 602 PPP P P PP P PP Sbjct: 525 PPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPP 584 Query: 603 PXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXP 782 P P S P P P PP PP P P P P Sbjct: 585 PSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPP 644 Query: 783 PPXXXRPP-XPLXPXXHP 833 P PP P P P Sbjct: 645 PSPVYYPPVTPSPPPPSP 662 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/59 (28%), Positives = 20/59 (33%), Gaps = 2/59 (3%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXP--XXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P + P P P P+P P PPP P PP HP + P Sbjct: 644 PPSPVYYPPVTPSPPPPSPVYYPSETQSPPPPTEYYYSPSQSPPPTKACKEGHPPQATP 702 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPP-----XXXPPPXXXRPPXP 812 P P P PPP +PP PPPP PPP P P Sbjct: 457 PPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPP 506 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/45 (31%), Positives = 17/45 (37%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P + + P PPP +P PPP PPP P P Sbjct: 434 PSVRAYSPP-PPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPP 477 Score = 29.5 bits (63), Expect = 3.3 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 6/55 (10%) Frame = +3 Query: 687 PXFCPXXPPPXP----TPTPPXXPXXXXPPPPX--XXPPPXXXRPPXPLXPXXHP 833 P + PPP P +P PP PPP PPP P P P P Sbjct: 477 PPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPP 531 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = +3 Query: 678 PXLPXFCPXXPPPX--PTPTPPXXPXXXXPPPPX---XXPPPXXXRPPXP 812 P P PPP +P PP PPPP PPP P P Sbjct: 466 PPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPP 515 Score = 28.3 bits (60), Expect = 7.5 Identities = 18/62 (29%), Positives = 20/62 (32%), Gaps = 6/62 (9%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXP------PPPFXTPXXXPPQXPTXPPP 583 PPP P P + P PPP P PPP + P PPP Sbjct: 384 PPPTFKMSPEVRTLPPPIYVYSSPPPPPSSKMSPTVRAYSPPPPPSSKMSPSVRAYSPPP 443 Query: 584 XP 589 P Sbjct: 444 PP 445 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 54.4 bits (125), Expect = 1e-07 Identities = 44/158 (27%), Positives = 50/158 (31%), Gaps = 2/158 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P P P P +PP P + PSP P P PPPP TP Sbjct: 95 PPVSPPPPTPTPSVPSPTPPV-------SPPPPTPTPSVPSPTP--PVSPPPPTPTPSVP 145 Query: 554 PPQXP-TXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXX 730 P P + PPP P +P P + P PS Sbjct: 146 SPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPS-------VPSPPDV 198 Query: 731 XXXXXXPPXPPPPXXXP-PPXPXXAXPXSXSXXPPGAP 841 P P PP P PP P P + PP P Sbjct: 199 TPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPP 236 Score = 46.0 bits (104), Expect = 4e-05 Identities = 38/141 (26%), Positives = 41/141 (29%), Gaps = 8/141 (5%) Frame = +2 Query: 449 GXGAPPXPXXRATXPSPPPXXP-----XXPPPPFXTPXXXPPQXPTXPP---PXPXFXLP 604 G PP P + P P P P PPPP TP P P PP P P P Sbjct: 70 GGYTPPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSP 129 Query: 605 RPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXPP 784 P P P+ P PPPP PP Sbjct: 130 TPPVSPPPPTPTPSVPSPTPPVSPPPPT----PTPSVPSPTPPVPTDPMPSPPPPVSPPP 185 Query: 785 PXPXXAXPXSXSXXPPGAPXP 847 P P + P S P P P Sbjct: 186 PTPTPSVP-SPPDVTPTPPTP 205 Score = 45.2 bits (102), Expect = 6e-05 Identities = 29/94 (30%), Positives = 30/94 (31%), Gaps = 2/94 (2%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTP- 734 P TP P P P P S P +P P PP PTPTP Sbjct: 85 PPTPSVPSPTPPVSPPPPTPTPSVP-SPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPS 143 Query: 735 -PXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P PPPP P PP P P P Sbjct: 144 VPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSP 177 Score = 44.8 bits (101), Expect = 8e-05 Identities = 42/159 (26%), Positives = 49/159 (30%), Gaps = 1/159 (0%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P P + PP +PP P + PSP P P PPPP TP Sbjct: 79 PPVSPPPPTPSVPSPTPPV---------SPPPPTPTPSVPSPTP--PVSPPPPTPTPSVP 127 Query: 554 PPQXP-TXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXX 730 P P + PPP P +P P P P+ Sbjct: 128 SPTPPVSPPPPTPTPSVPSPTPPVSP----------------PPPTPTPSVPSPTPPVPT 171 Query: 731 XXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP PP P P P P + PP P Sbjct: 172 DPMPSPPPPVSPP--PPTPTPSVPSPPDVTPTPPTPSVP 208 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P P+PTPP PPP PPP P P P P Sbjct: 156 PTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTP 200 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXP-PPXXXRPPXPLXPXXHP 833 P P P P P+PTPP P P P P PP PP P P Sbjct: 77 PVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSP 129 Score = 36.7 bits (81), Expect = 0.022 Identities = 25/75 (33%), Positives = 25/75 (33%), Gaps = 6/75 (8%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRAT-----XPSPPPXXPXXP-PPPF 535 PP P P P PP P P T PSPP P P PP Sbjct: 179 PPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPSV 238 Query: 536 XTPXXXPPQXPTXPP 580 TP PP P PP Sbjct: 239 PTPSGSPPYVP--PP 251 Score = 35.9 bits (79), Expect = 0.038 Identities = 23/83 (27%), Positives = 25/83 (30%), Gaps = 3/83 (3%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXX---PXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P +P P PP PTPTP P PPP P P P P P P Sbjct: 106 PSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSP 165 Query: 849 XNTIXXXXXXXXXXXXXPPQKXP 917 + PP P Sbjct: 166 TPPVPTDPMPSPPPPVSPPPPTP 188 Score = 35.5 bits (78), Expect = 0.050 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P P PP PTP+ P PPPP P P P P+ P Sbjct: 75 PAPVPPVSPPPPTPSVPSPTPPVSPPPP--TPTPSVPSPTPPVSP 117 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +3 Query: 693 FCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP-XXXRPPXPLXPXXHP 833 + P P P +P PP P P PP PPP P P P P Sbjct: 72 YTPPAPVPPVSP-PPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP 118 Score = 30.7 bits (66), Expect = 1.4 Identities = 31/130 (23%), Positives = 31/130 (23%), Gaps = 8/130 (6%) Frame = +3 Query: 423 PPPXXXXPXGGXPPXPPXXXXXXXXXXXXXXXXXXXXXXXXXXXRPXTPLXP-PXXPXXX 599 P P P P PP P P P P P Sbjct: 122 PTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPV 181 Query: 600 XPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXP------PPXPTPTPPXXPXXXXP 761 P P S P P P P PP TPTPP P P Sbjct: 182 SPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPSVPTP 241 Query: 762 P-PPXXXPPP 788 P PPP Sbjct: 242 SGSPPYVPPP 251 Score = 29.5 bits (63), Expect = 3.3 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 6/54 (11%) Frame = +3 Query: 678 PXLPXFCPXXP-PPXPTPTPPXX----PXXXXP-PPPXXXPPPXXXRPPXPLXP 821 P P P P PP TPTPP P P PP P P P P P Sbjct: 183 PPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPP 236 Score = 28.3 bits (60), Expect = 7.5 Identities = 21/85 (24%), Positives = 22/85 (25%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPP 737 P P P P P P P P P P P P+PP Sbjct: 153 PPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPS-VPSPP 211 Query: 738 XXPXXXXPPPPXXXPPPXXXRPPXP 812 P P PP PP P Sbjct: 212 DV-TPTPPTPSVPSPPDVTPTPPTP 235 Score = 27.9 bits (59), Expect = 10.0 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPP-PXXXPPPXXXRPPXP 812 P P PTP+ P P PP P P P P P Sbjct: 211 PDVTPTPPTPSVPSPPDVTPTPPTPPSVPTPSGSPPYVP 249 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 54.0 bits (124), Expect = 1e-07 Identities = 48/175 (27%), Positives = 55/175 (31%), Gaps = 8/175 (4%) Frame = +2 Query: 359 TXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXP--SPPPXXPXXPPPP 532 T + PP P P + PPP +PP P P SPPP PPPP Sbjct: 637 TSPQSPPVHSPPPPPPVHSP-PPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPP 695 Query: 533 FXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXX 712 +P PP P PP P P P + P P F Sbjct: 696 VHSP---PP--PVHSPPPPVHSPPPPVHSPP----PPVHSPPPPVQSPPPPPVFSPPPPA 746 Query: 713 XXXXXXXXXXXXPP-----XPPPPXXXPPPXPXXAXPXSXSXXPP-GAPXPXKHN 859 PP PPPP PPP P S PP +P P H+ Sbjct: 747 PIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHS 801 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/82 (34%), Positives = 34/82 (41%), Gaps = 3/82 (3%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXP---SPPPXXPXXPPPPFXTP 544 P P P P+ PPP +PP P + P SPPP PPPP +P Sbjct: 738 PVFSPPPPAPIYS-PPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPV-HSPPPPVHSP 795 Query: 545 XXXPPQXPTXPPPXPXFXLPRP 610 PP + PPP P + P P Sbjct: 796 ---PPPVHSPPPPSPIYSPPPP 814 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/57 (38%), Positives = 24/57 (42%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P F P PPP P +PP P PPP PPP PP P+ P P Sbjct: 735 PPPPVFSP--PPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPP 789 Score = 45.6 bits (103), Expect = 5e-05 Identities = 20/47 (42%), Positives = 22/47 (46%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PPP P +PP P PPPP PPP PP P+ P H P Sbjct: 648 PPPPPVHSPP--PPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSP 692 Score = 44.8 bits (101), Expect = 8e-05 Identities = 28/100 (28%), Positives = 31/100 (31%), Gaps = 3/100 (3%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTP- 734 P P+ P P P P V P P + P PP P P Sbjct: 706 PPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSP--PPPAPIYSPPPPPVHSPPPPV 763 Query: 735 --PXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P PPPP PPP PP P+ P P Sbjct: 764 HSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 803 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/60 (38%), Positives = 25/60 (41%), Gaps = 3/60 (5%) Frame = +3 Query: 678 PXLPXFCPXXP---PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P F P P PP P +PP P PPPP PPP PP P+ P P Sbjct: 656 PPPPVFSPPPPMHSPPPPVYSPPP-PVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 714 Score = 44.0 bits (99), Expect = 1e-04 Identities = 27/97 (27%), Positives = 28/97 (28%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPP 737 P P+ P P P P V P PPP PP Sbjct: 685 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPP 744 Query: 738 XXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P PPPP PPP PP P P H P Sbjct: 745 PAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSP 781 Score = 43.2 bits (97), Expect = 2e-04 Identities = 25/77 (32%), Positives = 28/77 (36%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P + PPP +PP P P P P PPP +P Sbjct: 754 PPVHSPP--PPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP-PSPIYS 810 Query: 554 PPQXPTXPPPXPXFXLP 604 PP PPP P LP Sbjct: 811 PPPPVFSPPPKPVTPLP 827 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/47 (40%), Positives = 21/47 (44%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PPP P +PP P PPPP PPP PP P+ P P Sbjct: 684 PPPPPVHSPP--PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 728 Score = 41.9 bits (94), Expect = 6e-04 Identities = 19/50 (38%), Positives = 21/50 (42%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P PP P +PP P PPPP PPP PP P+ P P Sbjct: 673 PVYSPPPPVHSPPPPPVHS-PPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 721 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/42 (42%), Positives = 20/42 (47%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 PPP P +PP P PPPP PPP PP P+ P Sbjct: 766 PPPPPVHSPP--PPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 805 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P +PP P PPPP PPP PP P+ P P Sbjct: 639 PQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPP 685 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/50 (38%), Positives = 22/50 (44%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P PP P +PP PPPP PPP +P PL P P + P Sbjct: 791 PVHSPPPPVHSPPPPSPIYSPPPPVFSPPP---KPVTPLPPATSPMANAP 837 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P PP P +PP P PPPP PPP PP P Sbjct: 770 PVHSPPPPVHSPP--PPVHSPPPPVHSPPPPVHSPPPP 805 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/58 (34%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXX----PXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P PPP +P PP P PPP PPP PP P+ P P Sbjct: 643 PVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPP 700 Score = 38.7 bits (86), Expect = 0.005 Identities = 24/82 (29%), Positives = 29/82 (35%), Gaps = 3/82 (3%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSP---PPXXPXXPPPPFXTP 544 PP + P P+ P P P P + P P PP PPPP +P Sbjct: 729 PPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSP 788 Query: 545 XXXPPQXPTXPPPXPXFXLPRP 610 PP + PPP P P Sbjct: 789 ---PPPVHSPPPPVHSPPPPSP 807 Score = 38.3 bits (85), Expect = 0.007 Identities = 27/83 (32%), Positives = 31/83 (37%), Gaps = 4/83 (4%) Frame = +2 Query: 374 PPXRPX--PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXP--SPPPXXPXXPPPPFXT 541 PP P P P + PP +PP P P SPPP PPPP + Sbjct: 743 PPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPV-HSPPPPVHS 801 Query: 542 PXXXPPQXPTXPPPXPXFXLPRP 610 P PP PPP P+P Sbjct: 802 PP--PPSPIYSPPPPVFSPPPKP 822 Score = 37.9 bits (84), Expect = 0.009 Identities = 30/106 (28%), Positives = 33/106 (31%), Gaps = 6/106 (5%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXP---PPXPTP 728 P P+ P P P P P P P P PP P Sbjct: 727 PPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVH 786 Query: 729 TPPXXPXXXXPPPPXXXPPP--XXXRPPXPL-XPXXHPGRHXPXNT 857 +PP P PPPP PPP PP P+ P P P T Sbjct: 787 SPP--PPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPPAT 830 Score = 37.5 bits (83), Expect = 0.012 Identities = 36/151 (23%), Positives = 41/151 (27%), Gaps = 5/151 (3%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX-PPQXPTXPPPXPXFX 598 PP +P P + P PP P PPP F P P P PP P Sbjct: 626 PPSPSTEETKTTSPQSPPVHSPPPPPPVHSP--PPPVFSPPPPMHSPPPPVYSPPPPVHS 683 Query: 599 LPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXX 778 P P + P S P PPP Sbjct: 684 PPPPPVHSPPPPVHSPPPPVHSP-PPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSP 742 Query: 779 PPPXPXXAXPXSXSXXPP----GAPXPXKHN 859 PPP P + P PP P P H+ Sbjct: 743 PPPAPIYSPPPPPVHSPPPPVHSPPPPPVHS 773 Score = 36.3 bits (80), Expect = 0.028 Identities = 35/164 (21%), Positives = 39/164 (23%), Gaps = 2/164 (1%) Frame = +2 Query: 347 KKXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGX--GAPPXPXXRATXPSPPPXXPXX 520 K + K +PP + P PP A P R PSP Sbjct: 577 KPEESPKPQPPKQEQPPKTEAPKMGSPPLESPVPNDPYDASPIKKRRPQPPSPSTEETKT 636 Query: 521 PPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLX 700 P PP P PP P F P P P P Sbjct: 637 TSPQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPP----PPVYSPPPPVHSPPPPPVHSP 692 Query: 701 XXXXXXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPP 832 P PPP PP P + P PP Sbjct: 693 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPP 736 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/57 (28%), Positives = 18/57 (31%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P P PP P +P P P P P P + P P P P Sbjct: 516 PPKPEESPKPEPPKPEESPKPQPPKQETPKPEESPKPQPPKQETP-KPEESPKPQPP 571 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 4/53 (7%) Frame = +3 Query: 708 PPPXPTPTP--PXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP--GRHXPXN 854 P P PTPTP P PP P P P P P H P N Sbjct: 407 PSPKPTPTPKAPEPKKEINPPNLEEPSKPKPEESPKPQQPSPKPETPSHEPSN 459 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 53.6 bits (123), Expect = 2e-07 Identities = 41/158 (25%), Positives = 44/158 (27%), Gaps = 2/158 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 P P P P+ PPP +PP P P P P PPP P Sbjct: 523 PVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP---PVHS 579 Query: 554 PPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXX 733 PP PPP P P P P P Sbjct: 580 PPPPVYSPPPPPVHSPPPPVHSPP----PPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPP 635 Query: 734 XXXXXPP--XPPPPXXXPPPXPXXAXPXSXSXXPPGAP 841 PP PPPP PPP P + P PP P Sbjct: 636 VHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLP 673 Score = 49.2 bits (112), Expect = 4e-06 Identities = 21/57 (36%), Positives = 24/57 (42%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P + P PPP +P PP PPPP PPP PP P+ P P Sbjct: 511 PPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 567 Score = 48.8 bits (111), Expect = 5e-06 Identities = 22/57 (38%), Positives = 25/57 (43%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P + P PPP P +PP P PPPP PPP PP P+ P P Sbjct: 520 PPPPVYSP--PPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 574 Score = 48.0 bits (109), Expect = 9e-06 Identities = 43/164 (26%), Positives = 49/164 (29%), Gaps = 3/164 (1%) Frame = +2 Query: 350 KXXTXKKKP-PXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP 526 K K+ P P P P+ PPP +PP P + P PP P PP Sbjct: 468 KPQPPKESPQPNDPYDQSPVKFRRSPPPPPVH-----SPPPPSPIHSPPPPPVYSPPPPP 522 Query: 527 PPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXX 706 P + P PP + PPP P P P P P Sbjct: 523 PVYSPP--PPPPVYSPPPPPPVHSPPPPVHSP-----PPPVHSPPPPVHSPPPPVHSPPP 575 Query: 707 XXXXXXXXXXXXXXPP--XPPPPXXXPPPXPXXAXPXSXSXXPP 832 PP PPPP PPP P S PP Sbjct: 576 PVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPP 619 Score = 46.0 bits (104), Expect = 4e-05 Identities = 36/143 (25%), Positives = 39/143 (27%), Gaps = 6/143 (4%) Frame = +3 Query: 423 PPPXXXXPXGGXPPXPPXXXXXXXXXXXXXXXXXXXXXXXXXXXRPXTPLXPPXXPXXXX 602 PPP P PP PP P P+ P P Sbjct: 511 PPPPVYSP----PPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSP 566 Query: 603 PXPXGXXGXGVSXXXXXXXXXXG---RXPXLPXFCPXXP---PPXPTPTPPXXPXXXXPP 764 P P V P P P P PP P +PP P PP Sbjct: 567 PPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPP 626 Query: 765 PPXXXPPPXXXRPPXPLXPXXHP 833 PP PPP PP P+ P Sbjct: 627 PPVFSPPPPVHSPPPPVYSPPPP 649 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/50 (40%), Positives = 22/50 (44%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P PP P +PP P PPPP PPP PP P+ P H P Sbjct: 548 PVHSPPPPVHSPP--PPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSP 595 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/58 (37%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPL-XPXXHPGRHXP 848 P P + P PPP +P PP PPPP PPP PP P+ P P + P Sbjct: 609 PPPPVYSPPPPPPVHSPPPPVFS----PPPPVHSPPPPVYSPPPPVYSPPPPPVKSPP 662 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/73 (31%), Positives = 25/73 (34%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXPXNTIXXXXXX 878 P PP P +PP P PPPP PPP PP P P H P + Sbjct: 555 PVHSPPPPVHSPP--PPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPP 612 Query: 879 XXXXXXXPPQKXP 917 PP P Sbjct: 613 VYSPPPPPPVHSP 625 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/75 (30%), Positives = 28/75 (37%), Gaps = 3/75 (4%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXP---SPPPXXPXXPPPPFXTP 544 P P P P+ PPP +PP P P PPP PPPP +P Sbjct: 612 PVYSPPPPPPVHS--PPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSP 669 Query: 545 XXXPPQXPTXPPPXP 589 PP+ + P P Sbjct: 670 PLLPPKMSSPPTQTP 684 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/61 (37%), Positives = 24/61 (39%), Gaps = 4/61 (6%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXX----PPPXXXRPPXPLXPXXHPGRHX 845 P P P PPP P +PP P PPPP PPP PP P P H Sbjct: 494 PPPPVHSP--PPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHS 551 Query: 846 P 848 P Sbjct: 552 P 552 Score = 40.3 bits (90), Expect = 0.002 Identities = 31/123 (25%), Positives = 33/123 (26%), Gaps = 3/123 (2%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXP---PPXPTP 728 P PP P P P P P P P PP P Sbjct: 512 PPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVH 571 Query: 729 TPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXPXNTIXXXXXXXXXXXXXPPQ 908 +PP P PPPP PPP P P P H P + PP Sbjct: 572 SPP--PPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPV 629 Query: 909 KXP 917 P Sbjct: 630 FSP 632 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPX---XXPPPXXXRPPXPLXPXXHPGRHXP 848 PPP P +PP P PPPP PPP P P P H P Sbjct: 510 PPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSP 559 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/63 (33%), Positives = 23/63 (36%), Gaps = 3/63 (4%) Frame = +3 Query: 678 PXLPXFCPXXP---PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P F P P PP P +PP PPP PPP PP P P Sbjct: 625 PPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTP 684 Query: 849 XNT 857 N+ Sbjct: 685 VNS 687 Score = 38.3 bits (85), Expect = 0.007 Identities = 27/86 (31%), Positives = 32/86 (37%), Gaps = 9/86 (10%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP----PPFXT 541 PP P P+ PPP +PP P ++ P P P PP PP T Sbjct: 626 PPPVFSPPPPVHS--PPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPPTQT 683 Query: 542 PXXXPP-----QXPTXPPPXPXFXLP 604 P PP Q PPP F +P Sbjct: 684 PVNSPPPRTPSQTVEAPPPSEEFIIP 709 Score = 37.9 bits (84), Expect = 0.009 Identities = 22/62 (35%), Positives = 25/62 (40%), Gaps = 5/62 (8%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXX---PXXXXPPPPXXXPPPXXX--RPPXPLXPXXHPGRH 842 P P + P PPP +P PP P PPPP PPP PP P+ P Sbjct: 580 PPPPVYSPP-PPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHS 638 Query: 843 XP 848 P Sbjct: 639 PP 640 Score = 37.5 bits (83), Expect = 0.012 Identities = 22/63 (34%), Positives = 25/63 (39%), Gaps = 2/63 (3%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPP--PXXXRPPXPLXPXXHPGRHXPX 851 P P + P PPP +P PP P PPPP PP P P P P P Sbjct: 639 PPPPVYSP--PPPVYSPPPP--PVKSPPPPPVYSPPLLPPKMSSPPTQTPVNSPPPRTPS 694 Query: 852 NTI 860 T+ Sbjct: 695 QTV 697 Score = 37.1 bits (82), Expect = 0.016 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 6/53 (11%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPP---XXXPPPXXXRPPXP---LXPXXHPGRHXP 848 PPP P +PP PPPP PPP PP P P P H P Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSP 545 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 758 PPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXKHN 859 PPPP PPP P P P P H+ Sbjct: 511 PPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHS 544 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 53.2 bits (122), Expect = 2e-07 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P CP PPP P P PP P PP P PPP PP L P P Sbjct: 58 PADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPP 106 Score = 46.8 bits (106), Expect = 2e-05 Identities = 25/74 (33%), Positives = 27/74 (36%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 P P P PPP PP P + PSPPP P PPPP P Sbjct: 48 PSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPP--PQLPPPPQLPPPAP 105 Query: 554 PPQXPTXPPPXPXF 595 P P+ P P F Sbjct: 106 PKPQPSPPTPDLPF 119 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P CP PPP P P PP PPPP PPP PP P P P Sbjct: 64 PPPPPPCP--PPPSPPPCPPPPSPPPSPPPPQLPPPPQLP-PPAPPKPQPSP 112 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/79 (35%), Positives = 29/79 (36%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P PPP PP P + P PPP P PPP P Sbjct: 46 PPPSPSPEPEPEPADCPPPPPP-------PPCPPPPSPPPCPPPPSPPPSPPPPQLPP-- 96 Query: 554 PPQXPTXPPPXPXFXLPRP 610 PPQ P PP P P P Sbjct: 97 PPQLPPPAPPKPQPSPPTP 115 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PPP P+P P P PPPP PP PP P P P P Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPP 92 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXP-PPXXXRPPXPLXPXXHPGRHXP 848 P P P PP P PPPP P PP PP P P P P Sbjct: 54 PEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLP 101 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/50 (44%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPP--PXXXPPPXXXRPPXPLXP 821 P P CP PPP P P+PP P PPP P PP PP P P Sbjct: 73 PPSPPPCP--PPPSPPPSPP--PPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P P P P P P PPPP PP PP P P P P Sbjct: 47 PPSPSPEPEPEPADCP-PPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLP 95 Score = 35.9 bits (79), Expect = 0.038 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP P PP PPP P + P PP P P Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPP 103 Score = 32.7 bits (71), Expect = 0.35 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP PPPP PP P P PP P P Sbjct: 77 PPCPPPPSP-PPSPPPPQLPPPPQLPPPAPPKP 108 Score = 32.3 bits (70), Expect = 0.46 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP PPPP PPP P PP P Sbjct: 86 PPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 Score = 27.9 bits (59), Expect = 10.0 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGA 838 PP PPP PPP P P + P A Sbjct: 91 PPQLPPPPQLPPPAPPKPQPSPPTPDLPFA 120 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 52.8 bits (121), Expect = 3e-07 Identities = 48/183 (26%), Positives = 54/183 (29%), Gaps = 17/183 (9%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP----F 535 K PP P P PL PPP PP P ++ P P P PPPP Sbjct: 570 KTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFG 629 Query: 536 XTPXXXPPQXPTXPPPXPXFXLPR---------PXXGXGXGGLXXXXXXXXXXRXXPXP- 685 T Q P PPP P +P P G + P P Sbjct: 630 STGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPK 689 Query: 686 ---SXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXKH 856 S PP PPPP P P P S + PP P + Sbjct: 690 ANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAP-PPPPLSKTPVPPPPPGLGRG 748 Query: 857 NSS 865 SS Sbjct: 749 TSS 751 Score = 49.6 bits (113), Expect = 3e-06 Identities = 39/136 (28%), Positives = 43/136 (31%), Gaps = 7/136 (5%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPPPPFX-TPXXXPPQXPTXPPPXPXFXL------PRPXXG 619 PP T PPP P PPP F T P Q P PPP P F +P Sbjct: 471 PPSSGDHVTLLPPPPPPP--PPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPP 528 Query: 620 XGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXPPPXPXX 799 L + P P PP PPPP PPP P Sbjct: 529 PPPPPLFTSTTSFSPSQPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPP---PPPLPSR 585 Query: 800 AXPXSXSXXPPGAPXP 847 + P + PP P P Sbjct: 586 SIPPPLAQPPPPRPPP 601 Score = 48.8 bits (111), Expect = 5e-06 Identities = 44/166 (26%), Positives = 47/166 (28%), Gaps = 2/166 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP--FXTPX 547 PP P P PL PP P +T P P PPPP F + Sbjct: 482 PPPPPPPPPPLFTSTTS--FSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTT 539 Query: 548 XXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXX 727 P P PPP P F P P P Sbjct: 540 SFSPSQPPPPPPLPSFSNRDP-----------LTTLHQPINKTPPPPPPPPPPLPSRSIP 588 Query: 728 XXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXKHNSS 865 PP PPPP PPP P S S PP P P S+ Sbjct: 589 PPLAQPPPPRPPPP---PPPPPSSRSIPSPSAPPPPPPPPPSFGST 631 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 PP P P PP P PPP PPP PP P Sbjct: 572 PPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPP 605 Score = 39.1 bits (87), Expect = 0.004 Identities = 28/92 (30%), Positives = 30/92 (32%), Gaps = 5/92 (5%) Frame = +2 Query: 371 KPPXRPX--PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPP---XXPXXPPPPF 535 KPP P P LG PPP PP P + P PPP PPP Sbjct: 697 KPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPPL 756 Query: 536 XTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXG 631 + PPP P R G G G Sbjct: 757 GA------KGSNAPPPPPPAGRGRASLGLGRG 782 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P PPP P P+ P PPPP PPP PP P Sbjct: 574 PPPPPPPPLPSRSIPPPLAQPPPPRPPPPP----PPPP 607 Score = 38.3 bits (85), Expect = 0.007 Identities = 31/132 (23%), Positives = 33/132 (25%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P PPP G+ R PS PP P PP + Sbjct: 643 PPPPPPTRIPAAKCAPPPPPPPPTSHSGS-----IRVGPPSTPPPPPPPPPKANISNAPK 697 Query: 554 PPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXX 733 PP P PP P P P P L Sbjct: 698 PPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPPLG 757 Query: 734 XXXXXPPXPPPP 769 P PPPP Sbjct: 758 AKGSNAPPPPPP 769 Score = 36.7 bits (81), Expect = 0.022 Identities = 37/167 (22%), Positives = 42/167 (25%), Gaps = 2/167 (1%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSP--PPXXPXXPPPPFXTP 544 +PP P P P P PP P PS PP PPP P Sbjct: 545 QPP--PPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPP 602 Query: 545 XXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXX 724 PP + P P P P G G P Sbjct: 603 PPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPP 662 Query: 725 XXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXKHNSS 865 PP PPP P + P AP P +S+ Sbjct: 663 PPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPPLPPSST 709 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 PP P P PP PPPP PPP + P P P Sbjct: 698 PPAPPPLPPSSTRLGAPPPP---PPPPLSKTPAPPPP 731 Score = 35.9 bits (79), Expect = 0.038 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 PPP P P PP P P P PPP PP P Sbjct: 595 PPPRPPPPPPPPPSSRSIPSPSAPPPPP---PPPP 626 Score = 35.5 bits (78), Expect = 0.050 Identities = 27/99 (27%), Positives = 28/99 (28%), Gaps = 6/99 (6%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPP 737 P P PP P P P P P P PPP P+ Sbjct: 573 PPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPS-PSAPPPPPPPPPSFGST 631 Query: 738 XXPXXXXPPPPXXXPPP------XXXRPPXPLXPXXHPG 836 PPPP PPP PP P P H G Sbjct: 632 GNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSG 670 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXP-PPXXXR---PPXPLXP 821 P PP P P PP P PP P PP R PP P P Sbjct: 676 PPSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPP 720 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +3 Query: 699 PXXPPPXP---TPTPPXXPXXXXPPPPXXXPPPXXXR 800 P PPP P TP PP P P PP PPP R Sbjct: 714 PPPPPPPPLSKTPAPPPPPLSKTPVPP---PPPGLGR 747 Score = 32.3 bits (70), Expect = 0.46 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 6/58 (10%) Frame = +3 Query: 678 PXLPXFCPXXP------PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P LP F P P TP PP P PP P PP +PP P P P Sbjct: 550 PPLPSFSNRDPLTTLHQPINKTPPPPPPPP---PPLPSRSIPPPLAQPPPPRPPPPPP 604 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 684 LPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP 788 LP P PPP T T P PPPP PPP Sbjct: 481 LPPPPPPPPPPLFTSTTSFSPSQPPPPPP---PPP 512 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Frame = +3 Query: 693 FCPXXPPPXPTPTPPXXPXXXXPP--PPXXXPPPXXXRPPXPLXPXXHP 833 F P PPP P P P P PP PPP P P Sbjct: 499 FSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSPSQPP 547 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P LP P P P PP PPPP P PP P Sbjct: 702 PPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTP---VPPPPP 743 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXP---PPPXXXPPPXXXRPPXPLXPXXHP 833 PPP P PT P PPP PPP P P P Sbjct: 659 PPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPP 703 Score = 29.5 bits (63), Expect = 3.3 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 8/49 (16%) Frame = +3 Query: 699 PXXPPPXPT--------PTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P PPP P P PP P P PP PPP P P P Sbjct: 698 PPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPP---PPPLSKTPVPPPPP 743 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = +3 Query: 699 PXXPPPXPTP---TPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P PPP PT + P PPPP P P P P P Sbjct: 658 PPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPPLP 705 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 693 FCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP 788 F P PPP P P P P PPP Sbjct: 520 FSPSQPPPPPPPPPLFTSTTSFSPSQPPPPPP 551 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 51.2 bits (117), Expect = 9e-07 Identities = 29/79 (36%), Positives = 31/79 (39%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P P PPP PP P PSPPP P PPP+ P Sbjct: 376 PPSPPPPPPP----PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP--SPPPYVYPPPP 429 Query: 554 PPQXPTXPPPXPXFXLPRP 610 PP PPP P + P P Sbjct: 430 PPYV-YPPPPSPPYVYPPP 447 Score = 48.8 bits (111), Expect = 5e-06 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P PPP P P PP P PPPP PPP P P P P Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 48.8 bits (111), Expect = 5e-06 Identities = 27/80 (33%), Positives = 28/80 (35%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXX-PXXPPPPFXTPXX 550 PP P P P PPP PP P P PPP P P PP+ P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPP 447 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P P P P LP P Sbjct: 448 PPSPQPYMYPSPPCNDLPTP 467 Score = 48.4 bits (110), Expect = 7e-06 Identities = 29/81 (35%), Positives = 32/81 (39%), Gaps = 2/81 (2%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPF-XTPXX 550 PP P P P PPP +PP P PSPPP PPPP+ P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP-----PPSPPPYVYPPPPPPYVYPPPP 438 Query: 551 XPPQXPTXPPPXP-XFXLPRP 610 PP PPP P + P P Sbjct: 439 SPPYVYPPPPPSPQPYMYPSP 459 Score = 48.0 bits (109), Expect = 9e-06 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P PPP P P PP P PPPP PPP P P P P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/47 (42%), Positives = 21/47 (44%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PPP P P PP P PPPP PPP P P P P + P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPP 427 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/52 (42%), Positives = 23/52 (44%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P P PPP P P PP PPPP PPP PP P P +P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPP--PYVYP 435 Score = 46.4 bits (105), Expect = 3e-05 Identities = 19/44 (43%), Positives = 21/44 (47%) Frame = +2 Query: 458 APPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXP 589 +PP P P PPP P PPPP P P P+ PPP P Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 46.0 bits (104), Expect = 4e-05 Identities = 23/58 (39%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Frame = +3 Query: 669 GRXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPP---XXXPPPXXXRPPXPLXPXXHP 833 G P P P PPP P P PP P PPPP PPP PP + P P Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPP 430 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = +2 Query: 494 SPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 SPP P PPPP P PP P PPP P + P P Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSP 413 Score = 45.6 bits (103), Expect = 5e-05 Identities = 26/74 (35%), Positives = 27/74 (36%), Gaps = 3/74 (4%) Frame = +2 Query: 377 PXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP--XXPPPPFXTPXX 550 P P P P PPP PP P + P PPP P PPPP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYP 435 Query: 551 XPPQXP-TXPPPXP 589 PP P PPP P Sbjct: 436 PPPSPPYVYPPPPP 449 Score = 42.3 bits (95), Expect = 4e-04 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 6/58 (10%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXP------PPXXXRPPXPLXPXXHP 833 P P P PPP P P PP PPPP P PP PP P P +P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYP 445 Score = 41.5 bits (93), Expect = 8e-04 Identities = 20/54 (37%), Positives = 22/54 (40%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P C P+P PP P PPPP PPP PP P P +P P Sbjct: 366 PIDCASFGCSPPSPPPPPPPPPPPPPPPPPPPPPP---PPPPPPPYVYPSPPPP 416 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/64 (35%), Positives = 26/64 (40%), Gaps = 3/64 (4%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPP---PXXXRPPXPLXPXXHPGRHXP 848 P P P PPP P+P P P PPPP PP P PP P P + P Sbjct: 404 PPPPYVYPSPPPPPPSPPPYVYP---PPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPP 460 Query: 849 XNTI 860 N + Sbjct: 461 CNDL 464 Score = 35.1 bits (77), Expect = 0.066 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXKHNS 862 PP PPPP PPP P P PP P P + S Sbjct: 376 PPSPPPPPP-PPPPPPPPPPPPPPPPPPPPPPPYVYPS 412 Score = 32.7 bits (71), Expect = 0.35 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAP 841 PP PPPP P P P P PP P Sbjct: 401 PPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 3/36 (8%) Frame = +2 Query: 749 PPXPPPPXXXPP---PXPXXAXPXSXSXXPPGAPXP 847 PP PPPP PP P P P P P P Sbjct: 396 PPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 50.8 bits (116), Expect = 1e-06 Identities = 35/130 (26%), Positives = 40/130 (30%), Gaps = 1/130 (0%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPP-PPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGL 637 PP P + P PP P PP PP P P+ PT PP P P P + Sbjct: 31 PPKP---SPHPVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTV 87 Query: 638 XXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSX 817 P P + PP PP P PPP P P + Sbjct: 88 KPPPPPY----VKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTV 143 Query: 818 SXXPPGAPXP 847 PP P Sbjct: 144 KPPPPPVVTP 153 Score = 48.8 bits (111), Expect = 5e-06 Identities = 30/94 (31%), Positives = 31/94 (32%), Gaps = 7/94 (7%) Frame = +2 Query: 350 KXXTXKKKPPXRPXPXXPLLGGXX-----PPPXXXXXXGXGAPPXPXXRATXPSPPPXXP 514 K T K PP P P P PPP P P P PP P Sbjct: 62 KPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKP 121 Query: 515 XXPPPPFXTPXXXP--PQXPTXPPPXPXFXLPRP 610 PP P+ P P P PT PP P P P Sbjct: 122 PPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPP 155 Score = 45.2 bits (102), Expect = 6e-05 Identities = 25/69 (36%), Positives = 27/69 (39%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXX 550 KPP P P P P P PP P P+P P P PPPP TP Sbjct: 120 KPPPPPTPYTP----PPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPP--TPYP 173 Query: 551 XPPQXPTXP 577 PP+ T P Sbjct: 174 PPPKPETCP 182 Score = 44.8 bits (101), Expect = 8e-05 Identities = 30/93 (32%), Positives = 31/93 (33%), Gaps = 6/93 (6%) Frame = +2 Query: 350 KXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGA-PPXPXXRATXP-----SPPPXX 511 K T K PP P P PPP PP P T P +PPP Sbjct: 83 KPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPT 142 Query: 512 PXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 PPPP TP P PP P P P Sbjct: 143 VKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPP 175 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/52 (36%), Positives = 21/52 (40%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P + PPP P PP P PP P PPP PP P+ P Sbjct: 105 PPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPP 156 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 PPP PTP P P PPPP PPP P P P Sbjct: 121 PPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTP 158 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P P PPP PTP P P PPPP PPP P P P Sbjct: 123 PPPTPYTPPP-PTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPP 166 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPX-XXPPPXXXRPPXPLXPXXHP 833 P P PPP P PP P PPPP PPP +PP P P P Sbjct: 79 PYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPP 131 Score = 43.2 bits (97), Expect = 2e-04 Identities = 24/77 (31%), Positives = 24/77 (31%) Frame = +2 Query: 359 TXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFX 538 T K PP P P PPP P P PP P P P Sbjct: 102 TVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPE 161 Query: 539 TPXXXPPQXPTXPPPXP 589 P PP P PPP P Sbjct: 162 APCPPPPPTPYPPPPKP 178 Score = 42.3 bits (95), Expect = 4e-04 Identities = 23/61 (37%), Positives = 27/61 (44%), Gaps = 7/61 (11%) Frame = +3 Query: 687 PXFCPXXPPPX----PTPTPPXXPXXXXPPPPX-XXPPPXXXRPPXP--LXPXXHPGRHX 845 P + P PPP PT PP P PPPP PPP +PP P + P P + Sbjct: 70 PPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYT 129 Query: 846 P 848 P Sbjct: 130 P 130 Score = 41.5 bits (93), Expect = 8e-04 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXX--RPPXP 812 PPP PT PP P PPPP PPP PP P Sbjct: 97 PPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPP 133 Score = 41.1 bits (92), Expect = 0.001 Identities = 34/133 (25%), Positives = 39/133 (29%), Gaps = 4/133 (3%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXP----TXPPPXPXFXLPRPXXGXGX 628 PP P P+ P P PPP P PP P PPP P P P Sbjct: 48 PPKPPT-VKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPP 106 Query: 629 GGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXP 808 + P P+ + P PPP PPP P P Sbjct: 107 PPPYVKPPPPPTVKPPPPPTPY---TPPPPTPYTPPPPTVKPPPPPVVTPPPPTP---TP 160 Query: 809 XSXSXXPPGAPXP 847 + PP P P Sbjct: 161 EAPCPPPPPTPYP 173 Score = 40.3 bits (90), Expect = 0.002 Identities = 36/146 (24%), Positives = 39/146 (26%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXX 550 KPP +P P PP PP P PP P PPP P Sbjct: 47 KPP-KPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPP--PPTV 103 Query: 551 XPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXX 730 PP P PP P P P P P+ + Sbjct: 104 KPPPPPYVKPPPPPTVKPPP---------------PPTPYTPPPPTPYTPPPPTVKPPPP 148 Query: 731 XXXXXXPPXPPPPXXXPPPXPXXAXP 808 PP P P PPP P P Sbjct: 149 PVVTPPPPTPTPEAPCPPPPPTPYPP 174 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P PPP PT PP P PPP P PP P P P Sbjct: 131 PPPTPYTPPP-PTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKP 178 Score = 37.1 bits (82), Expect = 0.016 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXX----PXXXXPPPPXXXPPPXXXRPPXP 812 + P P P PP TP PP P PPPP PP PP P Sbjct: 43 KHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPP 93 Score = 37.1 bits (82), Expect = 0.016 Identities = 27/86 (31%), Positives = 28/86 (32%), Gaps = 5/86 (5%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPX 547 K P +P P PPP PP T PPP PPPP P Sbjct: 50 KPPTVKPPTHTPKPPTVKPPPPYIPCP---PPPYTPKPPTVKPPPPPYVKPPPPPTVKPP 106 Query: 548 XXP---PQXPTX--PPPXPXFXLPRP 610 P P P PPP P P P Sbjct: 107 PPPYVKPPPPPTVKPPPPPTPYTPPP 132 Score = 36.3 bits (80), Expect = 0.028 Identities = 25/85 (29%), Positives = 28/85 (32%), Gaps = 5/85 (5%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXX---PXXXXPPPPXXX--PPPXXXRPPXPLXPXXHPGRH 842 P P P PP PT PP P PPPP PPP +PP P + Sbjct: 38 PVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKP 97 Query: 843 XPXNTIXXXXXXXXXXXXXPPQKXP 917 P T+ P K P Sbjct: 98 PPPPTVKPPPPPYVKPPPPPTVKPP 122 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 5/51 (9%) Frame = +3 Query: 696 CPXXPPPXPTPT-PPXXPXXXXPP----PPXXXPPPXXXRPPXPLXPXXHP 833 C P P P P PP P P PP P P +PP P P P Sbjct: 28 CSDPPKPSPHPVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPP 78 Score = 33.9 bits (74), Expect = 0.15 Identities = 26/86 (30%), Positives = 26/86 (30%), Gaps = 1/86 (1%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPP 737 P P P P P P P P P PPP TP PP Sbjct: 98 PPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPP-PPPVVTPPPP 156 Query: 738 XX-PXXXXPPPPXXXPPPXXXRPPXP 812 P PPPP PP PP P Sbjct: 157 TPTPEAPCPPPPPTPYPP----PPKP 178 Score = 33.1 bits (72), Expect = 0.26 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 1/67 (1%) Frame = +2 Query: 359 TXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGA-PPXPXXRATXPSPPPXXPXXPPPPF 535 T K PP P P PPP PP P P PPP P P PP Sbjct: 118 TVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPP--PPTPYPPP 175 Query: 536 XTPXXXP 556 P P Sbjct: 176 PKPETCP 182 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 49.6 bits (113), Expect = 3e-06 Identities = 26/79 (32%), Positives = 29/79 (36%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P+ PP +PP P SPPP PPPP +P Sbjct: 553 PPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSP--- 609 Query: 554 PPQXPTXPPPXPXFXLPRP 610 PP P PP P P P Sbjct: 610 PPPSPVYSPPPPSHSPPPP 628 Score = 49.2 bits (112), Expect = 4e-06 Identities = 44/162 (27%), Positives = 49/162 (30%), Gaps = 5/162 (3%) Frame = +2 Query: 377 PXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXX-PPPPFXTPXXX 553 P P P+ PPP P P PSP P P PPPP +P Sbjct: 508 PDDPYDASPVKNRRSPPPPKVEDTRVPPPQPPM-----PSPSPPSPIYSPPPPVHSP--- 559 Query: 554 PPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXX 733 PP + PPP + P P P P F Sbjct: 560 PPPVYSSPPPPHVYSPPPPVASP------PPPSPPPPVHSPPPPPVFSPPPPVFSPPPPS 613 Query: 734 XXXXXPPX---PPPPXXXPPPXPXXAXPXSXSXXPP-GAPXP 847 PP PPPP PPP P + PP GAP P Sbjct: 614 PVYSPPPPSHSPPPPVYSPPPPTFSPPPTHNTNQPPMGAPTP 655 Score = 43.2 bits (97), Expect = 2e-04 Identities = 37/166 (22%), Positives = 43/166 (25%) Frame = +2 Query: 344 KKKXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXP 523 K+ KP P P P P P P P A P+P P Sbjct: 458 KESPKPQPSKPEDSPKPEQPK-PEESPKPEQPQIPEPTKPVSPPNEAQGPTPDDPYDASP 516 Query: 524 PPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXX 703 +P + PPP P P P P P Sbjct: 517 VKNRRSPPPPKVEDTRVPPPQPPMPSPSPP--------SPIYSPPPPVHSPPPPVYSSPP 568 Query: 704 XXXXXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPPGAP 841 PP PPPP PPP P + P PP +P Sbjct: 569 PPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSP 614 Score = 42.3 bits (95), Expect = 4e-04 Identities = 22/79 (27%), Positives = 23/79 (29%) Frame = +3 Query: 576 PPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPPXXPXXX 755 PP P P P P + P P P P P P Sbjct: 534 PPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHS 593 Query: 756 XPPPPXXXPPPXXXRPPXP 812 PPPP PPP PP P Sbjct: 594 PPPPPVFSPPPPVFSPPPP 612 Score = 41.5 bits (93), Expect = 8e-04 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 P P F P PPP P +PP P PPPP PPP PP Sbjct: 602 PPPPVFSP--PPPSPVYSPP--PPSHSPPPPVYSPPPPTFSPP 640 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/83 (28%), Positives = 28/83 (33%), Gaps = 3/83 (3%) Frame = +3 Query: 678 PXLPXFCPXXP---PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P + P P PP P + P P PPPP PPP PP P+ P P Sbjct: 545 PPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPS--PPPPVHSPPPPPVFSP 602 Query: 849 XNTIXXXXXXXXXXXXXPPQKXP 917 + PP P Sbjct: 603 PPPVFSPPPPSPVYSPPPPSHSP 625 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P PP P +PP PPPP PPP PP P Sbjct: 598 PVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPP 635 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/60 (36%), Positives = 24/60 (40%), Gaps = 3/60 (5%) Frame = +3 Query: 678 PXLPXFCPXXP---PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P +P P P PP P +PP PPP PPP PP P P P H P Sbjct: 538 PPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPP---PPVHSP 594 Score = 39.1 bits (87), Expect = 0.004 Identities = 24/92 (26%), Positives = 28/92 (30%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPP 737 P +P+ P P P P P P PPP P +PP Sbjct: 545 PPSPIYSPPPPVHSPPPPV-YSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPP 603 Query: 738 XXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 PP P PPP PP P+ P Sbjct: 604 PPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPP 635 Score = 37.9 bits (84), Expect = 0.009 Identities = 22/62 (35%), Positives = 23/62 (37%), Gaps = 2/62 (3%) Frame = +3 Query: 678 PXLPXFCPXXP-PPXPTPTPPXXPXXXXPPPPXXXPPPXXX-RPPXPLXPXXHPGRHXPX 851 P P P P PP P +PP P PPP PPP PP P P P Sbjct: 575 PPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPP 634 Query: 852 NT 857 T Sbjct: 635 PT 636 Score = 37.5 bits (83), Expect = 0.012 Identities = 20/60 (33%), Positives = 25/60 (41%), Gaps = 7/60 (11%) Frame = +3 Query: 699 PXXPPPXPTPTPPXX-----PXXXXPPPPXXX--PPPXXXRPPXPLXPXXHPGRHXPXNT 857 P PP P+P+PP P PPPP PPP PP P+ P P ++ Sbjct: 534 PPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHS 593 Score = 32.7 bits (71), Expect = 0.35 Identities = 29/133 (21%), Positives = 34/133 (25%), Gaps = 1/133 (0%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPR-PXXGXGXGGLX 640 P P P P P P P P P P PP P P Sbjct: 463 PQPSKPEDSPKPEQPKPEESPKP-EQPQIPEPTKPVSPPNEAQGPTPDDPYDASPVKNRR 521 Query: 641 XXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXS 820 P P + P PPP PPP + P + Sbjct: 522 SPPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSP-PPPVYSSPPPPHVYSPPPPVA 580 Query: 821 XXPPGAPXPXKHN 859 PP +P P H+ Sbjct: 581 SPPPPSPPPPVHS 593 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 48.4 bits (110), Expect = 7e-06 Identities = 45/170 (26%), Positives = 47/170 (27%), Gaps = 14/170 (8%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXG----APPXPXXRATXPSPPPXXPXXPPPPFXT 541 PP P PL PPP APP P A P P PPPP T Sbjct: 459 PPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPT 518 Query: 542 PXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXR----XXPXPSXFLXXXX 709 PP P PPP P P G + P P Sbjct: 519 TIAAPP--PPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPS 576 Query: 710 XXXXXXXXXXXXXPPXPPPP------XXXPPPXPXXAXPXSXSXXPPGAP 841 PP PPPP PPP P A + PP P Sbjct: 577 PPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPPMAMANGAAGPPPPPP 626 Score = 42.7 bits (96), Expect = 3e-04 Identities = 26/82 (31%), Positives = 28/82 (34%), Gaps = 5/82 (6%) Frame = +2 Query: 359 TXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPP-----XXPXXP 523 T PP P P + PPP PP P +A P PPP P P Sbjct: 519 TIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPP 578 Query: 524 PPPFXTPXXXPPQXPTXPPPXP 589 P P P P PPP P Sbjct: 579 PMPMGNSGSGGP--PPPPPPMP 598 Score = 41.9 bits (94), Expect = 6e-04 Identities = 42/171 (24%), Positives = 49/171 (28%), Gaps = 8/171 (4%) Frame = +2 Query: 374 PPXRPXPXXPL-------LGGXXPPPXXXXXX-GXGAPPXPXXRATXPSPPPXXPXXPPP 529 PP P P PL L PPP PP P P+ P PPP Sbjct: 417 PPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPP 476 Query: 530 PFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXX 709 P P P PPP P +P G P P Sbjct: 477 PPPLPPAVMPLKHFAPPP-PTPPAFKPLKGSA------------PPPPPPPPLPTTIAAP 523 Query: 710 XXXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXKHNS 862 PP PPPP P P P + + PP P P ++ + Sbjct: 524 PPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRA 574 Score = 40.7 bits (91), Expect = 0.001 Identities = 27/92 (29%), Positives = 28/92 (30%), Gaps = 5/92 (5%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P PPP PP P + PPP P P TP Sbjct: 549 PPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPP 608 Query: 554 PP-----QXPTXPPPXPXFXLPRPXXGXGXGG 634 PP PPP P PR G G Sbjct: 609 PPPMAMANGAAGPPPPP----PRMGMANGAAG 636 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P P F P P P PP P PPP PP PP P P Sbjct: 495 PTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPP 542 Score = 37.1 bits (82), Expect = 0.016 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 7/55 (12%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP-------TPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P LP PPP P P PP P PPP PP PP P P Sbjct: 514 PPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPP 568 Score = 36.7 bits (81), Expect = 0.022 Identities = 20/62 (32%), Positives = 21/62 (33%), Gaps = 5/62 (8%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP-----TPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRH 842 P P PPP P P PP P PPP PP P P P + G Sbjct: 529 PPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSG 588 Query: 843 XP 848 P Sbjct: 589 GP 590 Score = 36.3 bits (80), Expect = 0.028 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 9/54 (16%) Frame = +3 Query: 708 PPPXPTPTPPXXP-XXXXPPPPXXXPPPXXXR--------PPXPLXPXXHPGRH 842 P P P PTPP PPPP PPP PP PL P P +H Sbjct: 436 PLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKH 489 Score = 35.1 bits (77), Expect = 0.066 Identities = 25/87 (28%), Positives = 26/87 (29%) Frame = +2 Query: 359 TXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFX 538 T PP P P PPP G G PP P P P P PPP Sbjct: 558 TQAAPPPPPPPPMQN--RAPSPPPMPMGNSGSGGPPPP------PPPMPLANGATPPPPP 609 Query: 539 TPXXXPPQXPTXPPPXPXFXLPRPXXG 619 P PPP P + G Sbjct: 610 PPMAMANGAAGPPPPPPRMGMANGAAG 636 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 9/47 (19%) Frame = +3 Query: 708 PPPXPT---------PTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 PPP P P PP P PPP PP PP P P Sbjct: 509 PPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPP 555 Score = 30.3 bits (65), Expect = 1.9 Identities = 21/74 (28%), Positives = 22/74 (29%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPX 547 + P P P G PPP GA P P P PPPP P Sbjct: 573 RAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPP---PPPPMAMANGAAGPPPP--PPR 627 Query: 548 XXPPQXPTXPPPXP 589 PPP P Sbjct: 628 MGMANGAAGPPPPP 641 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 PPP P P P PPPP PP P Sbjct: 590 PPPPPPPMPLANGATPPPPPPPMAMANGAAGPPPP 624 Score = 27.9 bits (59), Expect = 10.0 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPP 788 PPP P P PP P PPP Sbjct: 416 PPPPPPPPPPPLSFIKTASLPLPSPPP 442 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 47.6 bits (108), Expect = 1e-05 Identities = 44/159 (27%), Positives = 47/159 (29%), Gaps = 10/159 (6%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGA-PPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQ 562 P P P PPP A PP P PSPPP PPP +P PP Sbjct: 502 PPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPP-PSPSPPPPY 560 Query: 563 XPTXPPP----XPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXX 730 + PPP P P P P PS Sbjct: 561 IYSSPPPVVNCPPTTQSPPP---------PKYEQTPSPREYYPSPSPPYYQYTSSPPPPT 611 Query: 731 XXXXXXPPXPPPP-----XXXPPPXPXXAXPXSXSXXPP 832 PP PPPP PPP P P + S PP Sbjct: 612 YYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPP 650 Score = 45.2 bits (102), Expect = 6e-05 Identities = 26/81 (32%), Positives = 30/81 (37%), Gaps = 4/81 (4%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRA-TXPSPPPXXPXXPPPPFXTPXX 550 PP P P+ PPP PP P + SPPP P PP +P Sbjct: 633 PPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPP 692 Query: 551 XP---PQXPTXPPPXPXFXLP 604 P P PPP P + LP Sbjct: 693 SPVYYPPVTQSPPPPPVYYLP 713 Score = 40.7 bits (91), Expect = 0.001 Identities = 41/166 (24%), Positives = 49/166 (29%), Gaps = 13/166 (7%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P P + PPP +PP P T PSP P PP + Sbjct: 550 PPPSPSPPPPYIYS-SPPPVVNCPPTTQSPPPPKYEQT-PSPREYYPSPSPPYYQYTSSP 607 Query: 554 PP------QXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXF---LXXX 706 PP Q P PPP + + P P P + + Sbjct: 608 PPPTYYATQSPPPPPPPTYYAVQSPPPP------PPVYYPPVTASPPPPPVYYTPVIQSP 661 Query: 707 XXXXXXXXXXXXXXPPXP----PPPXXXPPPXPXXAXPXSXSXXPP 832 PP P PP PPP P P + S PP Sbjct: 662 PPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPP 707 Score = 39.5 bits (88), Expect = 0.003 Identities = 39/166 (23%), Positives = 45/166 (27%), Gaps = 13/166 (7%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP---XXPPP----P 532 PP P + PPP PP PSP P P PPP P Sbjct: 513 PPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCP 572 Query: 533 FXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXF--LXXX 706 T PP+ P P + P P P P + + Sbjct: 573 PTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSP 632 Query: 707 XXXXXXXXXXXXXXPPXPP----PPXXXPPPXPXXAXPXSXSXXPP 832 PP PP P PPP P P + S PP Sbjct: 633 PPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPP 678 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/85 (27%), Positives = 31/85 (36%), Gaps = 6/85 (7%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPX------PXXRATXPSPPPXXPXXPPP 529 + PP P P+ PPP +PP P ++ P P P P Sbjct: 659 QSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSP 718 Query: 530 PFXTPXXXPPQXPTXPPPXPXFXLP 604 P +P PP + PPP P + P Sbjct: 719 PPPSPVYYPPVAKSPPPPSPVYYPP 743 Score = 38.7 bits (86), Expect = 0.005 Identities = 26/84 (30%), Positives = 30/84 (35%), Gaps = 5/84 (5%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXX-----PPPP 532 + PP P P P +PP P AT PPP P PPPP Sbjct: 576 QSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPP 635 Query: 533 FXTPXXXPPQXPTXPPPXPXFXLP 604 P PP + PPP P + P Sbjct: 636 --PPVYYPPVTASPPPP-PVYYTP 656 Score = 38.3 bits (85), Expect = 0.007 Identities = 26/93 (27%), Positives = 28/93 (30%), Gaps = 5/93 (5%) Frame = +2 Query: 347 KKXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP 526 K T + PP P PPP A P P PS P PP Sbjct: 447 KMSPTFRATPPPPSSKMSPSFRATPPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPP 506 Query: 527 PPFXTPXXXPPQXPTXP-----PPXPXFXLPRP 610 P + P PP P PP P P P Sbjct: 507 PEY-EPSPPPPSSEMSPSVRAYPPPPPLSPPPP 538 Score = 37.9 bits (84), Expect = 0.009 Identities = 25/89 (28%), Positives = 28/89 (31%), Gaps = 1/89 (1%) Frame = +2 Query: 347 KKXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGA-PPXPXXRATXPSPPPXXPXXP 523 K + + PP P PPP A PP P PSPPP Sbjct: 462 KMSPSFRATPPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMS 521 Query: 524 PPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P PP P P P P + P Sbjct: 522 PSVRAYPPP-PPLSPPPPSPPPPYIYSSP 549 Score = 37.5 bits (83), Expect = 0.012 Identities = 28/91 (30%), Positives = 32/91 (35%), Gaps = 10/91 (10%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXP---SPPPXXP-------X 517 + PP P P+ PPP +PP P P SPPP P Sbjct: 688 QSPPPSPVYYPPVTQSPPPPPVYYLPV-TQSPPPPSPVYYPPVAKSPPPPSPVYYPPVTQ 746 Query: 518 XPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 PPPP PP P PP P + P P Sbjct: 747 SPPPPSTPVEYHPPASPNQSPP-PEYQSPPP 776 Score = 36.3 bits (80), Expect = 0.028 Identities = 17/48 (35%), Positives = 20/48 (41%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P + + P PPP P+PP P P PPP PP P P Sbjct: 495 PSVKAYPPPPPPPEYEPSPP-PPSSEMSPSVRAYPPPPPLSPPPPSPP 541 Score = 36.3 bits (80), Expect = 0.028 Identities = 23/76 (30%), Positives = 26/76 (34%), Gaps = 6/76 (7%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXR--ATXPSPPPXXPXXPP----PPF 535 PP P P+ P P PP P T PPP PP PP Sbjct: 676 PPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPP 735 Query: 536 XTPXXXPPQXPTXPPP 583 +P PP + PPP Sbjct: 736 PSPVYYPPVTQSPPPP 751 Score = 35.5 bits (78), Expect = 0.050 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 PP P+P+PP P PPP PP PP P Sbjct: 549 PPPPSPSPP-PPYIYSSPPPVVNCPPTTQSPPPP 581 Score = 35.1 bits (77), Expect = 0.066 Identities = 25/85 (29%), Positives = 30/85 (35%), Gaps = 6/85 (7%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATX--PSPPPXXPXXPPPPFXT 541 + PP P P + PPP +PP P T SPPP P P + Sbjct: 616 QSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPP-PVYYSPVTQS 674 Query: 542 PXXXP----PQXPTXPPPXPXFXLP 604 P P P PPP P + P Sbjct: 675 PPPPPPVYYPPVTQSPPPSPVYYPP 699 Score = 34.7 bits (76), Expect = 0.087 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP 788 P + + P P P P+PP PPPP PPP Sbjct: 522 PSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPP 558 Score = 34.3 bits (75), Expect = 0.11 Identities = 21/56 (37%), Positives = 23/56 (41%), Gaps = 11/56 (19%) Frame = +3 Query: 678 PXLPXFCPXXPPPX----PT-----PTPPXXPXXXXPPPP--XXXPPPXXXRPPXP 812 P P + P PPP P+ P PP P PPPP PPP PP P Sbjct: 504 PPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPP 559 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPL 815 P PP P+P PP PPP PPP P P+ Sbjct: 531 PPLSPPPPSPPPPYI-YSSPPPPSPSPPPPYIYSSPPPV 568 Score = 34.3 bits (75), Expect = 0.11 Identities = 34/148 (22%), Positives = 38/148 (25%), Gaps = 8/148 (5%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTX---PPPXPX 592 PPP PP P SPPP P PP +P P PPP P Sbjct: 607 PPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPV 666 Query: 593 FXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPP--- 763 + P + PP P Sbjct: 667 YYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYY 726 Query: 764 PPXX--XPPPXPXXAXPXSXSXXPPGAP 841 PP PPP P P + S PP P Sbjct: 727 PPVAKSPPPPSPVYYPPVTQSPPPPSTP 754 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/46 (32%), Positives = 17/46 (36%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPL 815 P P + PP P P PPPP PP PP P+ Sbjct: 607 PPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPV 652 Score = 31.9 bits (69), Expect = 0.61 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +2 Query: 758 PPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PPPP PPP P P S PP +P P Sbjct: 528 PPPPPLSPPP-PSPPPPYIYSSPPPPSPSP 556 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/63 (30%), Positives = 21/63 (33%), Gaps = 6/63 (9%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPT------PPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGR 839 P + PPP P PT PP P PP PPP P P P Sbjct: 608 PPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVY 667 Query: 840 HXP 848 + P Sbjct: 668 YSP 670 Score = 31.9 bits (69), Expect = 0.61 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPP-PPXXXPPPXXXRPP 806 PP +P PP P PP P PPP PP Sbjct: 742 PPVTQSPPPPSTPVEYHPPASPNQSPPPEYQSPP 775 Score = 31.5 bits (68), Expect = 0.81 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPP--XXXPPPXXXRPPXPLXP 821 P L P PPP +PP P PPPP PPP PP P Sbjct: 531 PPLSPPPPSPPPPYIYSSPP--PPSPSPPPPYIYSSPPPVVNCPPTTQSP 578 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP-XXHP 833 PPP P PP PPP PP PP P P HP Sbjct: 719 PPPSPVYYPPVAKSP--PPPSPVYYPPVTQSPPPPSTPVEYHP 759 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/52 (28%), Positives = 18/52 (34%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P + P P P P PPPP P + P P P +P Sbjct: 691 PPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPPSPVYYP 742 Score = 30.7 bits (66), Expect = 1.4 Identities = 41/176 (23%), Positives = 47/176 (26%), Gaps = 3/176 (1%) Frame = +2 Query: 347 KKXXTXKKKPPXRPXPXX-PLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXP 523 K T + PP P P PPP A P P PS P Sbjct: 431 KMSPTVRVLPPPPPSSKMSPTFRATPPPPSSKMSPSFRATPPPPSSKMSPS----FRATP 486 Query: 524 PPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXX 703 PPP + P PPP P P P P PS Sbjct: 487 PPP--SSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSP---- 540 Query: 704 XXXXXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPP--GAPXPXKHNSS 865 PPPP PPP + P PP +P P K+ + Sbjct: 541 ----------PPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQT 586 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/52 (30%), Positives = 18/52 (34%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P + P P P P PPPP P PP P P +P Sbjct: 634 PPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPP-PPVYYP 684 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/53 (32%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +3 Query: 699 PXXPPPXPTP---TPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P PP TP +PP P P PPP PP P P + P Sbjct: 647 PPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPP 699 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/53 (32%), Positives = 19/53 (35%), Gaps = 6/53 (11%) Frame = +3 Query: 708 PPPXP------TPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PPP P T +PP P PP PP PP P P + P Sbjct: 661 PPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLP 713 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 693 FCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 + P P P P P PPP PP PP P Sbjct: 668 YSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPP 707 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 PPP P PP PPPP P PP P P +P Sbjct: 690 PPPSPVYYPPVTQ---SPPPPPVYYLPVTQSPPPP-SPVYYP 727 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP 788 P F PPP +P PPPP P P Sbjct: 480 PSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSP 513 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +1 Query: 745 PPXXXPPPPXPXPPXXXXGXP 807 PP PPPP P PP P Sbjct: 530 PPPLSPPPPSPPPPYIYSSPP 550 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/31 (35%), Positives = 13/31 (41%) Frame = +3 Query: 720 PTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P+P+PP PPPP PP P Sbjct: 594 PSPSPPYYQYTSSPPPPTYYATQSPPPPPPP 624 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 6/43 (13%) Frame = +3 Query: 678 PXLPXFCPXX---PPPXPTPT---PPXXPXXXXPPPPXXXPPP 788 P P + P PPP TP PP P PPP PPP Sbjct: 735 PPSPVYYPPVTQSPPPPSTPVEYHPPASPNQS-PPPEYQSPPP 776 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 47.2 bits (107), Expect = 2e-05 Identities = 42/165 (25%), Positives = 47/165 (28%), Gaps = 7/165 (4%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXP------SPPPXXPXXPPPPF 535 PP P P++ PPP +PP T P SPPP PPP Sbjct: 41 PPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPP- 99 Query: 536 XTPXXXPPQXP-TXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXX 712 TP PP P T PP P P P P P Sbjct: 100 STPATTPPAPPQTVSPPPPPDASPSPPAPTTTN--PPPKPSPSPPGETPSPPGETPSPPK 157 Query: 713 XXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 P PPP PP P + + PP P P Sbjct: 158 PSPSTPTPTTTTSPPPPPATSASPPSSNPTDPSTLA--PPPTPLP 200 Score = 43.6 bits (98), Expect = 2e-04 Identities = 42/167 (25%), Positives = 48/167 (28%), Gaps = 3/167 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPP-PFXTPXX 550 P P P P++ PPP +PP P A SPPP P PP P T Sbjct: 66 PSSSPPPSPPVITS--PPPTVA-----SSPPPPVVIA---SPPPSTPATTPPAPPQTVSP 115 Query: 551 XPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXX 730 PP + PP P P P G P PS Sbjct: 116 PPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPP 175 Query: 731 XXXXXXPPXPP--PPXXXPPPXPXXAXPXSXSXXPPGAPXPXKHNSS 865 P P P PPP P P P P N++ Sbjct: 176 ATSASPPSSNPTDPSTLAPPPTPLPVVPREKPIAKPTGPASNNGNNT 222 Score = 41.1 bits (92), Expect = 0.001 Identities = 35/145 (24%), Positives = 39/145 (26%), Gaps = 3/145 (2%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXL 601 P P + P T P+ P P PPP +P PP + PP P Sbjct: 6 PLPILSPPSSNSSTTAPPPLQTQPTTPSAPPPVTPPP--SPPQSPPPVVSSSPPPPVVSS 63 Query: 602 PRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXP 781 P P P P PPPP P Sbjct: 64 PPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASP 123 Query: 782 -PPXPXXA-XPXSXSXXPPG-APXP 847 PP P P S PPG P P Sbjct: 124 SPPAPTTTNPPPKPSPSPPGETPSP 148 Score = 40.3 bits (90), Expect = 0.002 Identities = 28/93 (30%), Positives = 30/93 (32%), Gaps = 10/93 (10%) Frame = +2 Query: 359 TXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-----XXP 523 T PP P P PPP P P + P P P P P Sbjct: 112 TVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSP 171 Query: 524 PPPFXTPXXXPPQXPT-----XPPPXPXFXLPR 607 PPP T P PT PPP P +PR Sbjct: 172 PPPPATSASPPSSNPTDPSTLAPPPTPLPVVPR 204 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P PPP P +PP PPP PPP PP P Sbjct: 37 PVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSP 74 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/80 (26%), Positives = 23/80 (28%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXPXNT 857 P P PPP +P+PP PP P PP PP P P T Sbjct: 107 PAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPT 166 Query: 858 IXXXXXXXXXXXXXPPQKXP 917 PP P Sbjct: 167 TTTSPPPPPATSASPPSSNP 186 Score = 35.5 bits (78), Expect = 0.050 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +3 Query: 708 PPPXPT-PTPPXXPXXXXPPP--PXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PPP T PT P P PPP P PP PP P+ P P Sbjct: 22 PPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPP 71 Score = 35.5 bits (78), Expect = 0.050 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 2/62 (3%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP--LXPXXHPGRHXPX 851 P P PP P TPP P PPP PP PP P P P P Sbjct: 88 PPPPVVIASPPPSTPATTPPAPPQTVSPPP----PPDASPSPPAPTTTNPPPKPSPSPPG 143 Query: 852 NT 857 T Sbjct: 144 ET 145 Score = 35.1 bits (77), Expect = 0.066 Identities = 24/77 (31%), Positives = 24/77 (31%) Frame = +2 Query: 359 TXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFX 538 T PP P P P P P P PSPP P P P Sbjct: 104 TTPPAPPQTVSPPPP--PDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPS 161 Query: 539 TPXXXPPQXPTXPPPXP 589 TP P T PPP P Sbjct: 162 TP---TPTTTTSPPPPP 175 Score = 34.3 bits (75), Expect = 0.11 Identities = 38/171 (22%), Positives = 43/171 (25%), Gaps = 8/171 (4%) Frame = +2 Query: 359 TXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXP----- 523 T PP P P P PPP P ++ P PP P Sbjct: 31 TPSAPPPVTPPPSPP----QSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVAS 86 Query: 524 -PPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLX 700 PPP PP P PP P + P + P P Sbjct: 87 SPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPG-ET 145 Query: 701 XXXXXXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPPG--APXP 847 P P PPP A P S + P AP P Sbjct: 146 PSPPGETPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDPSTLAPPP 196 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/58 (31%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = +3 Query: 669 GRXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRP---PXPLXPXXHP 833 G P P P P P T +PP P PP P P P P+ P P Sbjct: 150 GETPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDPSTLAPPPTPLPVVPREKP 207 Score = 31.9 bits (69), Expect = 0.61 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P P TPP P PP PPP P P Sbjct: 29 PTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPP 66 Score = 31.5 bits (68), Expect = 0.81 Identities = 36/158 (22%), Positives = 42/158 (26%), Gaps = 5/158 (3%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSP----PPXXPXXPPPPFXT 541 PP + P P PPP +PP P ++ P P PP P PPP Sbjct: 23 PPLQTQPTTP----SAPPPVTPPPSPPQSPP-PVVSSSPPPPVVSSPP--PSSSPPPSPP 75 Query: 542 PXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXX 721 PP PP P P PS Sbjct: 76 VITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPP 135 Query: 722 XXXXXXXXXPPXPPPPXXXPP-PXPXXAXPXSXSXXPP 832 P PP PP P P P + + PP Sbjct: 136 KPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPP 173 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP 788 P P PPP + +PP P PPP PPP Sbjct: 41 PPSPPQSPPPVVSSSPP--PPVVSSPPPSSSPPP 72 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/46 (32%), Positives = 18/46 (39%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PP P +PP PPP P PP P+ P P + P Sbjct: 5 PPLPILSPPSSNSSTTAPPPLQTQPTTPSAPP-PVTPPPSPPQSPP 49 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P PPP TP PP P P PPP PP P P Sbjct: 32 PSAPPPV-TP-PPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSP 74 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/57 (28%), Positives = 17/57 (29%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXPXNT 857 P PPP +PP PP PPP P P P P T Sbjct: 49 PPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATT 105 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/56 (30%), Positives = 18/56 (32%), Gaps = 1/56 (1%) Frame = +3 Query: 669 GRXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPX-XXPPPXXXRPPXPLXPXXHP 833 G P P P P P P+ P PPP PP P L P P Sbjct: 143 GETPSPPGETPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDPSTLAPPPTP 198 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 47.2 bits (107), Expect = 2e-05 Identities = 29/80 (36%), Positives = 31/80 (38%), Gaps = 3/80 (3%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXP--SPPPXXPXX-PPPPFXTP 544 PP P P PPP +PP P P SPPP P PPPP +P Sbjct: 553 PPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSP 612 Query: 545 XXXPPQXPTXPPPXPXFXLP 604 PP P PP P F P Sbjct: 613 ---PPPPPVYSPPPPVFSPP 629 Score = 46.8 bits (106), Expect = 2e-05 Identities = 37/148 (25%), Positives = 41/148 (27%), Gaps = 3/148 (2%) Frame = +2 Query: 359 TXKKKPPXRPX--PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP 532 T ++ PP P P P+ PPP P P + P PPP PPP Sbjct: 513 TKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPV 572 Query: 533 FXTPXXX-PPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXX 709 F P P P PP P P P P P F Sbjct: 573 FSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPP-PVHSPPPPPPVYSPPPPVFSPPPS 631 Query: 710 XXXXXXXXXXXXXPPXPPPPXXXPPPXP 793 P PP PPP P Sbjct: 632 QSPPVVYSPPPRPPKINSPPVQSPPPAP 659 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/52 (40%), Positives = 22/52 (42%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P P PPP +P PP P PPP PPP PP P P P Sbjct: 519 PPAPVNSP--PPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSP 568 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/80 (31%), Positives = 28/80 (35%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXPXNT 857 P P P PPP +P PP PPPP PPP PP P+ P H P Sbjct: 536 PPPPVHSP--PPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPP-PPVHSPPPP 592 Query: 858 IXXXXXXXXXXXXXPPQKXP 917 + PP P Sbjct: 593 VHSPPPPAPVHSPPPPVHSP 612 Score = 41.5 bits (93), Expect = 8e-04 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P PP P +PP P PPPP PPP PP P P Sbjct: 597 PPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPP-SQSPPVVYSPPPRP 644 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +3 Query: 678 PXLPXFCPXXP---PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P F P P PP P +PP PP P PPP PP P Sbjct: 568 PPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPP 615 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/52 (40%), Positives = 24/52 (46%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P + P PPP P +PP P PPPP PPP PP P+ P Sbjct: 526 PPPPVYSPPPPPP-PVHSPPP-PVHSPPPPPVYSPPP----PPPPVHSPPPP 571 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/80 (30%), Positives = 27/80 (33%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXPXNT 857 P P + P PPP P +PP P PPP PPP PP P H P Sbjct: 551 PPPPVYSPPPPPP-PVHSPPP-PVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPP 608 Query: 858 IXXXXXXXXXXXXXPPQKXP 917 + PP P Sbjct: 609 VHSPPPPPPVYSPPPPVFSP 628 Score = 39.1 bits (87), Expect = 0.004 Identities = 37/152 (24%), Positives = 40/152 (26%), Gaps = 10/152 (6%) Frame = +3 Query: 423 PPPXXXXPXGGXPPXPPXXXXXXXXXXXXXXXXXXXXXXXXXXXRPXTPLXPPXXPXXXX 602 PPP P PP PP P P+ P P Sbjct: 526 PPPPVYSPP---PPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSP 582 Query: 603 PXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPP--XXPXXXXPP---- 764 P P V P P P PPP +P PP P PP Sbjct: 583 PPPVHSPPPPVHSPPPPAPV---HSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYS 639 Query: 765 ----PPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PP PP PP P+ P H P Sbjct: 640 PPPRPPKINSPPVQSPPPAPVEKKETPPAHAP 671 Score = 38.7 bits (86), Expect = 0.005 Identities = 20/51 (39%), Positives = 22/51 (43%), Gaps = 4/51 (7%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPP--XXXPPPXXXRPPXPL--XPXXHPGRHXP 848 PPP P +PP PPPP PPP PP P+ P P H P Sbjct: 518 PPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSP 568 Score = 37.5 bits (83), Expect = 0.012 Identities = 21/71 (29%), Positives = 25/71 (35%), Gaps = 2/71 (2%) Frame = +2 Query: 374 PPXRPX--PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPX 547 PP P P P+ PPP +PP SPPP P PP +P Sbjct: 597 PPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPP 656 Query: 548 XXPPQXPTXPP 580 P + PP Sbjct: 657 PAPVEKKETPP 667 Score = 36.3 bits (80), Expect = 0.028 Identities = 35/136 (25%), Positives = 38/136 (27%), Gaps = 8/136 (5%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPF-XTPXXXPPQXPTXP--PPXPXFXLP--RPXXGXGX 628 P P P+P P P P P TP P PT P P P P +P Sbjct: 430 PVPTTPVHKPTPVPTTPVQKPSPVPTTPVQKPSPVPTTPVHEPSPVLATPVDKPSPVPSR 489 Query: 629 GGLXXXXXXXXXXRXXP---XPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXPPPXPXX 799 P P PP PPPP PPP P Sbjct: 490 PVQKPQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPP-PVH 548 Query: 800 AXPXSXSXXPPGAPXP 847 + P PP P P Sbjct: 549 SPPPPPVYSPPPPPPP 564 Score = 36.3 bits (80), Expect = 0.028 Identities = 34/148 (22%), Positives = 41/148 (27%), Gaps = 16/148 (10%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPP------------FXTPXXXPPQXPTXP--PPXPXFXL 601 P P PSP P P P P TP P P+ P P P Sbjct: 441 PVPTTPVQKPSPVPTTPVQKPSPVPTTPVHEPSPVLATPVDKPSPVPSRPVQKPQPPKES 500 Query: 602 PRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXP 781 P+P + P P + PP PP P Sbjct: 501 PQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPP 560 Query: 782 PPXPXXAXPXSXSXXPPG--APXPXKHN 859 PP P + P PP +P P H+ Sbjct: 561 PPPPVHSPPPPVFSPPPPVYSPPPPVHS 588 Score = 33.9 bits (74), Expect = 0.15 Identities = 32/141 (22%), Positives = 36/141 (25%), Gaps = 13/141 (9%) Frame = +2 Query: 464 PXPXXRATXPSPP----PXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXG 631 P P + P P P PPP PP PPP P P P Sbjct: 494 PQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPP 553 Query: 632 GLXXXXXXXXXXRXXPXPSXF----LXXXXXXXXXXXXXXXXXPP-----XPPPPXXXPP 784 + P P + PP PPPP PP Sbjct: 554 PVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPP 613 Query: 785 PXPXXAXPXSXSXXPPGAPXP 847 P P P PP + P Sbjct: 614 PPPPVYSPPPPVFSPPPSQSP 634 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P P PP P PPP PP P P P Sbjct: 503 PDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSP 543 Score = 28.3 bits (60), Expect = 7.5 Identities = 32/141 (22%), Positives = 36/141 (25%), Gaps = 10/141 (7%) Frame = +2 Query: 449 GXGAPPXPXXRATXPSPPPXXPXXPPPPF-XTPXXXPPQXPT----XPPPXPXFXLPRPX 613 G + P P+P P P P P TP P PT P P P + P Sbjct: 414 GGSSTPSKPSPVHKPTPVPTTPVHKPTPVPTTPVQKPSPVPTTPVQKPSPVPTTPVHEPS 473 Query: 614 XGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPP----XPPPPXXXP 781 + P PP PPPP P Sbjct: 474 PVLATPVDKPSPVPSRPVQKPQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSP 533 Query: 782 PPXPXXA-XPXSXSXXPPGAP 841 PP P P PP P Sbjct: 534 PPPPPPVHSPPPPVHSPPPPP 554 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 47.2 bits (107), Expect = 2e-05 Identities = 43/143 (30%), Positives = 44/143 (30%) Frame = -2 Query: 801 AXXGXGGGXXXGGGGXGGXXXXXXXXXXXXXXXXGKKXEGXGXXRXXXXXXXXXGRPPXP 622 A G GG GGG GG GK G G Sbjct: 126 AGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGA 185 Query: 621 XPXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXX 442 G G GGG VG GG G GGGG G G G G + G GG Sbjct: 186 GGSVGAGGGIGSGGGGTVGA-GGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSG 244 Query: 441 XXXXGGGXXPPKRGXXGXGRXGG 373 GGG RG G G GG Sbjct: 245 GGSVGGGG----RGSGGVGASGG 263 Score = 44.0 bits (99), Expect = 1e-04 Identities = 46/156 (29%), Positives = 46/156 (29%), Gaps = 1/156 (0%) Frame = -2 Query: 837 APGGXXXXEXGXAXXGXGGGXXXGGGGXGGXXXXXXXXXXXXXXXXGKKXEGXGXXRXXX 658 A GG G A G GG G GG GG G G G Sbjct: 388 ASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGA 447 Query: 657 XXXXXXGRPPXPXPXXGRGRXKXGXG-GGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVA 481 G GRG G G GG VG GG V GGGG G GG Sbjct: 448 VGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGG----VGVGGGGGIGGGAGGGVGGG 503 Query: 480 RXXGXGGAPXPXXXXXXGGGXXPPKRGXXGXGRXGG 373 G GG GGG RG G G Sbjct: 504 VGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAG 539 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G GG GGG GGGG G GGVG G GGG G G Sbjct: 473 GTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRG 514 Score = 43.2 bits (97), Expect = 2e-04 Identities = 29/78 (37%), Positives = 30/78 (38%), Gaps = 2/78 (2%) Frame = -2 Query: 600 RXKXGXG--GGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXG 427 R K G G G G GG G+ GGGG G GG G V G GG Sbjct: 39 RHKHGRGSVGVGAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGAS 98 Query: 426 GGXXPPKRGXXGXGRXGG 373 GG G G GR GG Sbjct: 99 GGAG---GGGKGRGRKGG 113 Score = 42.7 bits (96), Expect = 3e-04 Identities = 44/156 (28%), Positives = 46/156 (29%), Gaps = 3/156 (1%) Frame = -2 Query: 831 GGXXXXEXGXAXXGXGGGXXXG---GGGXGGXXXXXXXXXXXXXXXXGKKXEGXGXXRXX 661 GG G + G GGG G GGG GG G G G Sbjct: 157 GGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGG 216 Query: 660 XXXXXXXGRPPXPXPXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVA 481 GR G G GGG G GG G +G GG G GG G V Sbjct: 217 GGTVGAGGR------GSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGV-GASGGAGGNVG 269 Query: 480 RXXGXGGAPXPXXXXXXGGGXXPPKRGXXGXGRXGG 373 G GG GG G G GG Sbjct: 270 AGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGG 305 Score = 41.9 bits (94), Expect = 6e-04 Identities = 44/163 (26%), Positives = 45/163 (27%), Gaps = 10/163 (6%) Frame = -2 Query: 831 GGXXXXEXGXAXXGXGGGXXXGGGGXGGXXXXXXXXXXXXXXXXGKKXEGXGXXRXXXXX 652 GG G G GGG G GG G G G R Sbjct: 54 GGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGG 113 Query: 651 XXXXGRPPXPXPXXGRGRXKXGXGGGXVG-----XWGGXXXGVXKGGGGXXGXXGGGE-- 493 G G G GGG G GG GV GG G G GGG Sbjct: 114 GGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGG 173 Query: 492 ---GXVARXXGXGGAPXPXXXXXXGGGXXPPKRGXXGXGRXGG 373 G V G GG+ GGG G G GG Sbjct: 174 GVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGG 216 Score = 40.7 bits (91), Expect = 0.001 Identities = 30/79 (37%), Positives = 30/79 (37%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXX 430 GRG G G G G GG G GGGG G GG G GGA Sbjct: 43 GRGSVGVGAGAGG-GASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGA 101 Query: 429 GGGXXPPKRGXXGXGRXGG 373 GGG RG G G GG Sbjct: 102 GGGG--KGRGRKGGGGAGG 118 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/41 (51%), Positives = 21/41 (51%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G RG GG GGG G GG G GGVGVG G G G Sbjct: 206 GGRGSGGAS--GGGGTVGAGGRGSGGASGGVGVGGGAGGSG 244 Score = 39.9 bits (89), Expect = 0.002 Identities = 44/155 (28%), Positives = 45/155 (29%), Gaps = 3/155 (1%) Frame = -2 Query: 831 GGXXXXEXGXAXXGXGGGXXXGGGGXGGXXXXXXXXXXXXXXXXGKKXEGXGXXRXXXXX 652 GG G A G GGG GGGG G G G G Sbjct: 291 GGAVGGAVGGAVGGGGGGSV-GGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGG 349 Query: 651 XXXXGRPPXPXPXXGR-GRXKXGXGGGXVGXWGGXXXGVXKG--GGGXXGXXGGGEGXVA 481 G G G GGG VG G G G GG G GG G + Sbjct: 350 VGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGAS 409 Query: 480 RXXGXGGAPXPXXXXXXGGGXXPPKRGXXGXGRXG 376 G GGA GGG G G G G Sbjct: 410 --GGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGG 442 Score = 39.1 bits (87), Expect = 0.004 Identities = 26/79 (32%), Positives = 26/79 (32%), Gaps = 1/79 (1%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXW-GGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXX 433 G GR G GG G GG G G G G GG G V G GG Sbjct: 380 GGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGG 439 Query: 432 XGGGXXPPKRGXXGXGRXG 376 GG G G G G Sbjct: 440 VGGAVGGAVGGAVGGGGGG 458 Score = 38.3 bits (85), Expect = 0.007 Identities = 45/159 (28%), Positives = 45/159 (28%), Gaps = 7/159 (4%) Frame = -2 Query: 831 GGXXXXEXGXAXXGXGGGXXXGGGGXGGXXXXXXXXXXXXXXXXGKKXEGXGXXRXXXXX 652 GG G GGG GGGG G G G G Sbjct: 177 GGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGV 236 Query: 651 XXXXGRPPXPXPXXGRGRXKXGXG-----GGXVGXWGGXXXGVXKG-GGGXXGXXGGGEG 490 G G GR G G GG VG GG GV G GGG G GG G Sbjct: 237 GGGAGGSGG-GSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVG 295 Query: 489 X-VARXXGXGGAPXPXXXXXXGGGXXPPKRGXXGXGRXG 376 V G GG GG G G G Sbjct: 296 GAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGG 334 Score = 38.3 bits (85), Expect = 0.007 Identities = 25/72 (34%), Positives = 25/72 (34%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPP 409 G GGG VG G G GG G GG G V G GG GGG Sbjct: 304 GGGGGSVGGGGRGSGGA--SGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGA 361 Query: 408 KRGXXGXGRXGG 373 G G GG Sbjct: 362 VGGAVGGAVGGG 373 Score = 37.9 bits (84), Expect = 0.009 Identities = 26/72 (36%), Positives = 26/72 (36%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPP 409 G GGG G GG G GGGG GGG G GGA GG Sbjct: 353 GVGGGVGGAVGGAVGGAV-GGGGGGSVGGGGRG---SGGASGGASGGASGGASGGASGGA 408 Query: 408 KRGXXGXGRXGG 373 G G G GG Sbjct: 409 SGGVGGAGGAGG 420 Score = 37.9 bits (84), Expect = 0.009 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGG----GGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GGR G G GG GG G GG+G G GGG G G Sbjct: 454 GGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGG 506 Score = 37.9 bits (84), Expect = 0.009 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GG GGG GGG G GGVG G GGG G G Sbjct: 472 GGTGGSVGAGGGVGVGGGGGIGGGAGGGVG--GGVGGGVGGGVRGAVGG 518 Score = 37.5 bits (83), Expect = 0.012 Identities = 20/50 (40%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = -1 Query: 832 GWXXGXRGWGGRXXX-GGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G +G GG GGG GGG G GG+G G GG G G Sbjct: 105 GKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASG 154 Score = 37.5 bits (83), Expect = 0.012 Identities = 39/155 (25%), Positives = 39/155 (25%), Gaps = 2/155 (1%) Frame = -2 Query: 831 GGXXXXEXGXAXXGXGGGXXXGGGGXGGXXXXXXXXXXXXXXXXGKKXEGXGXXRXXXXX 652 GG G G GG GGG GG G Sbjct: 249 GGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGG 308 Query: 651 XXXXGRPPXPXPXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXX--GXXGGGEGXVAR 478 G G G GG VG GG GV G GG G G G V Sbjct: 309 SVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGG 368 Query: 477 XXGXGGAPXPXXXXXXGGGXXPPKRGXXGXGRXGG 373 G GG GG G G GG Sbjct: 369 AVGGGGGGSVGGGGRGSGGASGGASGGASGGASGG 403 Score = 37.5 bits (83), Expect = 0.012 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -1 Query: 820 GXRGWGGRXXXGG-GXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G RG GG GG G G GG G GGVG G GG G G Sbjct: 251 GGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGG 296 Score = 36.3 bits (80), Expect = 0.028 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G GG GGG GGGG G G G GGG G Sbjct: 184 GAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVG 221 Score = 35.9 bits (79), Expect = 0.038 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G GG GGGG G G GVG GGG G G Sbjct: 50 GAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGG 91 Score = 35.9 bits (79), Expect = 0.038 Identities = 42/154 (27%), Positives = 42/154 (27%), Gaps = 1/154 (0%) Frame = -2 Query: 831 GGXXXXEXGXAXXGXGGGXXXGGG-GXGGXXXXXXXXXXXXXXXXGKKXEGXGXXRXXXX 655 GG G A G GGG GG GG G G G Sbjct: 142 GGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGG 201 Query: 654 XXXXXGRPPXPXPXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARX 475 GR G G G G G G GGG G G G G V Sbjct: 202 TVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGAS 261 Query: 474 XGXGGAPXPXXXXXXGGGXXPPKRGXXGXGRXGG 373 G GG GGG G G G GG Sbjct: 262 GGAGG--NVGAGGGLGGGVGGGVGGGVG-GSVGG 292 Score = 35.9 bits (79), Expect = 0.038 Identities = 18/45 (40%), Positives = 20/45 (44%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G G +G GG+ G G GGG G G VG G G G G Sbjct: 155 GVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGG 199 Score = 35.9 bits (79), Expect = 0.038 Identities = 19/47 (40%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGG--GXXGQKXG 686 G G G GGG GGG G GG+G G GG G G+ G Sbjct: 165 GKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSG 211 Score = 35.9 bits (79), Expect = 0.038 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G G G GG G GGVG G GGG G G Sbjct: 323 GASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGG 364 Score = 35.9 bits (79), Expect = 0.038 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 805 GGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 GG GGG GGGG G GG G GG G G Sbjct: 367 GGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASG 406 Score = 35.9 bits (79), Expect = 0.038 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -1 Query: 805 GGRXXXGGGXXXGGGGXXXXGXXGGVG--VGXGGG 707 GG GGG GGGG G GG G VG GGG Sbjct: 449 GGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGG 483 Score = 35.5 bits (78), Expect = 0.050 Identities = 21/49 (42%), Positives = 22/49 (44%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GGR G G G GG G GG+G G GGG G G Sbjct: 242 GSGGGSVGGGGRGSGGVGASGGAGGNVGAG--GGLGGGVGGGVGGGVGG 288 Score = 35.1 bits (77), Expect = 0.066 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGG-GGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G GG GGG GG GG G GGVG G GG G G Sbjct: 50 GAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASG 99 Score = 35.1 bits (77), Expect = 0.066 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXGR 683 G GG GG G GG G G +G G GG G GR Sbjct: 66 GGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGR 108 Score = 35.1 bits (77), Expect = 0.066 Identities = 28/79 (35%), Positives = 28/79 (35%), Gaps = 1/79 (1%) Frame = -1 Query: 919 GGXFWGGXXXXXXXXXXXXGIVFXGXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGX 740 GG GG G V G G G G GG GGG G GG G Sbjct: 154 GGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGA 213 Query: 739 XGGVG-VGXGGGXXGQKXG 686 GG G VG GG G G Sbjct: 214 SGGGGTVGAGGRGSGGASG 232 Score = 35.1 bits (77), Expect = 0.066 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 805 GGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 GG GGG GGGG G GG G GG G Sbjct: 299 GGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGG 334 Score = 35.1 bits (77), Expect = 0.066 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G GG GGG G GG G GGVG GG G G Sbjct: 331 GAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGG 372 Score = 35.1 bits (77), Expect = 0.066 Identities = 26/84 (30%), Positives = 28/84 (33%), Gaps = 5/84 (5%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGG-----GGXXGXXGGGEGXVARXXGXGGAPXPX 445 G G G GGG G GG G +G GG G G G G + G GG Sbjct: 488 GGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAGGG 547 Query: 444 XXXXXGGGXXPPKRGXXGXGRXGG 373 G G G G GG Sbjct: 548 VGGGANVGVGVGAGGSTGGGAAGG 571 Score = 34.7 bits (76), Expect = 0.087 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GG GGG GG G GG G GGG G G Sbjct: 55 GGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGG 103 Score = 34.7 bits (76), Expect = 0.087 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GG G G GGG G G G GG G+K G Sbjct: 65 GGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGG 113 Score = 34.7 bits (76), Expect = 0.087 Identities = 22/72 (30%), Positives = 22/72 (30%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPP 409 G GG G GG G G G GG G G GG GGG Sbjct: 384 GSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGA 443 Query: 408 KRGXXGXGRXGG 373 G G GG Sbjct: 444 VGGAVGGAVGGG 455 Score = 34.3 bits (75), Expect = 0.11 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 2/57 (3%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXGGGXXX--GGGGXXXXGXXGGVGVGXGGGXXGQKXGR 683 G R G G GG GGG G GG G G +G G GG G GR Sbjct: 107 GRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGR 163 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GG GGG G GG G G VG GG G G Sbjct: 410 GGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGG 458 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G G G GGG GGG G G GVG GG G Sbjct: 226 GSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGG 266 Score = 33.9 bits (74), Expect = 0.15 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXX---GXXGGVGVGXGGGXXGQKXG 686 G RG GG G GG G G GGVG G GGG G G Sbjct: 313 GGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGG 360 Score = 33.9 bits (74), Expect = 0.15 Identities = 24/79 (30%), Positives = 24/79 (30%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXX 430 G G G GG G G G GG G G GG G G G Sbjct: 384 GSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGA 443 Query: 429 GGGXXPPKRGXXGXGRXGG 373 GG G G G GG Sbjct: 444 VGGAVGGAVGGGGGGSVGG 462 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GG GG G GGVG G GGG G G Sbjct: 394 GGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGG 442 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GR G G GG G GG VG G G G G Sbjct: 518 GAVGGGVGGAGRGSGGASGGAGAGGGAGGGVGGGANVGVGVGAGGSTGG 566 Score = 33.5 bits (73), Expect = 0.20 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXG-GGXXGQKXG 686 G G GG G G GGG G GGVG G G GG G G Sbjct: 90 GGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGG 139 Score = 33.5 bits (73), Expect = 0.20 Identities = 40/144 (27%), Positives = 41/144 (28%), Gaps = 1/144 (0%) Frame = -2 Query: 831 GGXXXXEXGXAXXGXGGGXXXGGG-GXGGXXXXXXXXXXXXXXXXGKKXEGXGXXRXXXX 655 GG G A G GGG GGG G GG G G Sbjct: 441 GGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGV 500 Query: 654 XXXXXGRPPXPXPXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARX 475 G RG GGG G G G GG G G GGG G A Sbjct: 501 GGGVGGGVGGGV----RGAVGGAVGGGVGG--AGRGSGGASGGAGAGGGAGGGVGGGANV 554 Query: 474 XGXGGAPXPXXXXXXGGGXXPPKR 403 GA GGG +R Sbjct: 555 GVGVGAGGSTGGGAAGGGGVGNRR 578 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 814 RGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 RG GG G G G GG G GVGVG GG G G Sbjct: 529 RGSGGASG-GAGAGGGAGGGVGGGANVGVGVGAGGSTGGGAAG 570 Score = 33.1 bits (72), Expect = 0.26 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 3/52 (5%) Frame = -1 Query: 832 GWXXGXRGWGGRXXX---GGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GG+ GGG G GG G G VG GGG G G Sbjct: 95 GGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGG 146 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G GG GGG G GG G G VG GG G G Sbjct: 263 GAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGG 304 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GG GG G GGVG G GGG G G Sbjct: 398 GGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGG 446 Score = 32.7 bits (71), Expect = 0.35 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 4/53 (7%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGG--GXXXXGXXGGVG--VGXGGGXXGQKXG 686 G G G GG GGG GG G G GG G VG GGG G G Sbjct: 296 GAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGG 348 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GGR G GG G G G G GGG G G Sbjct: 304 GGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGG 352 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G G G G GG G GGVG G GG G G Sbjct: 402 GGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGG 450 Score = 32.7 bits (71), Expect = 0.35 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -1 Query: 832 GWXXGXRGWGG-RXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GG GGG G GG G G VG GGG G G Sbjct: 481 GGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRG 530 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 1/69 (1%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGG-GXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXP 412 G GGG G GG G G G G G GG G GG GG Sbjct: 507 GVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAGGGVGGGANVGVGVGAGGSTGG 566 Query: 411 PKRGXXGXG 385 G G G Sbjct: 567 GAAGGGGVG 575 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGG--GXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G G GG GGG G G GGVG GG G G Sbjct: 250 GGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGG 300 Score = 30.7 bits (66), Expect = 1.4 Identities = 27/80 (33%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGG-XXGXXGGGEGXVARXXGXGGAPXPXXXXX 433 G G G GG VG G G GGGG G GG A GGA Sbjct: 353 GVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGV 412 Query: 432 XGGGXXPPKRGXXGXGRXGG 373 G G G G G GG Sbjct: 413 GGAGGAGGSVG-AGGGVGGG 431 Score = 30.7 bits (66), Expect = 1.4 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXG--GGXXXGGGGXXXXGXXGGV--GVGXGGGXXG 698 G G G GGR G GG G G G GG GVG GG G Sbjct: 372 GGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGG 420 Score = 30.3 bits (65), Expect = 1.9 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGG--GXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GG GGG GG G G GG G GG G G Sbjct: 364 GAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGG 414 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G G G G GGG G GG G G G GGG G Sbjct: 526 GAGRGSGGASGGAGAGGGAGGGVGGGANVGVGVGAGGSTGGGAAG 570 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GG G GG G G G G GGG G G Sbjct: 390 GGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGG 438 Score = 29.5 bits (63), Expect = 3.3 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXG--GGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G G GG G GG G GG G VG GGG G G Sbjct: 257 GVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGG 312 Score = 29.5 bits (63), Expect = 3.3 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GG GGG G GG G G VG GG G G Sbjct: 330 GGAGGSVGAGG--GVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGG 376 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G GGG G GG G VG GGG G G Sbjct: 339 GGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGG 380 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GGG G GG G VG G GG G G Sbjct: 340 GGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRG 384 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -1 Query: 784 GGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G G G G GG+GVG GGG G Sbjct: 43 GRGSVGVGAGAGGGASGGIGVGGGGGGGG 71 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G GG G GGGG G GG G G GG G G Sbjct: 439 GVGGAVGGAVGGAVGGGGGGSVGG-GGRGSGGAGGGTGGSVG 479 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G G R GG G GG G G GGG G G Sbjct: 502 GGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAGGGVGG 550 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G GGG G GG G VG G GG G G Sbjct: 425 GGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRG 466 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G GG G GGGG G GG G G GG G G Sbjct: 357 GVGGAVGGAVGGAVGGGG---GGSVGGGGRGSGGASGGASGG 395 Score = 28.3 bits (60), Expect = 7.5 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 9/54 (16%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGG-GXXXXGXXGGVG--------VGXGGGXXGQKXG 686 G RG GG G GG G G GGVG VG GGG G G Sbjct: 381 GGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGG 434 Score = 27.9 bits (59), Expect = 10.0 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 5/47 (10%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGG-----GXXXXGXXGGVGVGXGGGXXGQKXG 686 G GG G G GGG G G GG G G GG G G Sbjct: 495 GAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAG 541 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 47.2 bits (107), Expect = 2e-05 Identities = 26/79 (32%), Positives = 29/79 (36%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 P P P P+LG P P P P P+PPP PPP F P Sbjct: 70 PNPNPNPNPPVLGSSPPSPTDSSS-STSISPNPPAPIVNPNPPPPSTPNPPPEFSPP--P 126 Query: 554 PPQXPTXPPPXPXFXLPRP 610 P T PP P +P P Sbjct: 127 PDLDTTTAPPPPSTDIPIP 145 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/65 (32%), Positives = 24/65 (36%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQX 565 P P P++ PPP +PP P T PPP PPP P P Sbjct: 99 PNPPAPIVNPNPPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPPAPVSASP-- 156 Query: 566 PTXPP 580 P PP Sbjct: 157 PLTPP 161 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P P P P PP P PPP PPP P P Sbjct: 99 PNPPAPIVNPNPPP-PSTPNPPPEFSPPPPDLDTTTAPPPP 138 Score = 31.5 bits (68), Expect = 0.81 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 5/53 (9%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPP-----PXXXPPPXXXRPPXPLXP 821 P P PPP +P PP PPP P PPP PL P Sbjct: 108 PNPPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPPAPVSASPPLTP 160 Score = 31.1 bits (67), Expect = 1.1 Identities = 26/111 (23%), Positives = 28/111 (25%), Gaps = 2/111 (1%) Frame = +2 Query: 482 ATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXX 661 +T PS PF TP P P PP P P + Sbjct: 46 STDPSSSSSSSSSSTSPFITPFPNPNPNPNPNPPVLGSSPPSPTDSSSSTSISPNPPAPI 105 Query: 662 XXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPP--PXXXPPPXPXXAXP 808 P PS PP P P PPP P A P Sbjct: 106 VNPNPPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPPAPVSASP 156 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 Query: 723 TPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 +P PP PPPP PP PP P Sbjct: 98 SPNPPAPIVNPNPPPPSTPNPPPEFSPPPP 127 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPP----XXXPPPXXXRPPXPLXP 821 P P P P+ P P PPPP PPP P P P Sbjct: 104 PIVNPNPPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPP 148 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 47.2 bits (107), Expect = 2e-05 Identities = 30/87 (34%), Positives = 32/87 (36%), Gaps = 5/87 (5%) Frame = +2 Query: 359 TXKKKPPXRPXPXXPLLGGXXPP--PXXXXXXGXGAPPXPXXRA--TXPSPPPXXPXXPP 526 T PP P P PL PP P PP P A T P P P PP Sbjct: 89 TIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPP 148 Query: 527 PPFXTPXXXP-PQXPTXPPPXPXFXLP 604 PP +P P P P+ P P P P Sbjct: 149 PPPESPPSLPAPDPPSNPLPPPKLVPP 175 Score = 45.2 bits (102), Expect = 6e-05 Identities = 29/77 (37%), Positives = 31/77 (40%) Frame = +2 Query: 359 TXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFX 538 T PP P P P L G PPP +PP PSPPP P PPP Sbjct: 66 TPLSSPPPEPSPPSPSLTG--PPPTTIPV----SPPPE------PSPPPPLPTEAPPP-A 112 Query: 539 TPXXXPPQXPTXPPPXP 589 P PP + PPP P Sbjct: 113 NPVSSPPPESSPPPPPP 129 Score = 41.5 bits (93), Expect = 8e-04 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P PPP P+P PP P P PPP PP P Sbjct: 87 PTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPP 128 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/83 (28%), Positives = 27/83 (32%), Gaps = 4/83 (4%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P P PP P + P+P P PPP P Sbjct: 119 PPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHS 178 Query: 554 PPQXPTXPP----PXPXFXLPRP 610 PP+ PP P P LP P Sbjct: 179 PPRHLPSPPASEIPPPPRHLPSP 201 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P P PPP PT PP PPP PPP P P P P Sbjct: 91 PVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAP-PTTPITSP 141 Score = 39.1 bits (87), Expect = 0.004 Identities = 34/149 (22%), Positives = 38/149 (25%), Gaps = 4/149 (2%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXL 601 PP PP + P P P P PP T PP P+ PPP P Sbjct: 50 PPETTNTPAQSSPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPT-EA 108 Query: 602 PRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXP 781 P P P P PP P Sbjct: 109 PPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLP 168 Query: 782 PP--XPXXAXPXSXSXXPPGA--PXPXKH 856 PP P P PP + P P +H Sbjct: 169 PPKLVPPSHSPPRHLPSPPASEIPPPPRH 197 Score = 39.1 bits (87), Expect = 0.004 Identities = 30/107 (28%), Positives = 33/107 (30%), Gaps = 6/107 (5%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXX------PPPX 719 P TPL P P P G + P LP P PPP Sbjct: 64 PETPLSSP--PPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPE 121 Query: 720 PTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXPXNTI 860 +P PP P P P P P PP P P P P N + Sbjct: 122 SSPPPPP-PTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPL 167 Score = 38.7 bits (86), Expect = 0.005 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 13/60 (21%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXX------PPPPXXXP------PPXXXRPPXPLXPXXH-PGRHXP 848 PPP PT PP P PPPP P PP PP L P H P RH P Sbjct: 125 PPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLP 184 Score = 36.7 bits (81), Expect = 0.022 Identities = 24/81 (29%), Positives = 25/81 (30%), Gaps = 3/81 (3%) Frame = +2 Query: 377 PXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXP 556 P P P P PPP P R PSPP PPP +P P Sbjct: 217 PSPPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPPSPPEETLPPPKPSPDPLP 276 Query: 557 ---PQXPTXPPPXPXFXLPRP 610 PT PP P P Sbjct: 277 SNSSSPPTLLPPSSVVSPPSP 297 Score = 35.9 bits (79), Expect = 0.038 Identities = 24/77 (31%), Positives = 26/77 (33%), Gaps = 5/77 (6%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXP-PPXXXXXXGXGAPPXPXXRATXPSPP----PXXPXXPPPPFX 538 PP P P P PP PP P + PSPP P P PP Sbjct: 201 PPASERPSTPPSDSEHPSPPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPPSP 260 Query: 539 TPXXXPPQXPTXPPPXP 589 PP P+ P P P Sbjct: 261 PEETLPPPKPS-PDPLP 276 Score = 33.1 bits (72), Expect = 0.26 Identities = 22/79 (27%), Positives = 24/79 (30%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP R P P PP +PP P PPP P P +P Sbjct: 193 PPPRHLPSPPASERPSTPPSDSEHP---SPPPPGHPKRREQPPPPGSKRPTPSPPSPSDS 249 Query: 554 PPQXPTXPPPXPXFXLPRP 610 PP P LP P Sbjct: 250 KRPVHPSPPSPPEETLPPP 268 Score = 32.7 bits (71), Expect = 0.35 Identities = 35/146 (23%), Positives = 41/146 (28%), Gaps = 5/146 (3%) Frame = +2 Query: 425 PPXXXXXXGXGAPPXPXXRATXPSPPPXX--PXXPPPPFXTPXXXPPQXPTXPPPXPXFX 598 PP G A P T +PP P PP TP PP P+ PP P Sbjct: 27 PPPQPSFPGDNATS-PTREPTNGNPPETTNTPAQSSPPPETPLSSPPPEPS--PPSPSLT 83 Query: 599 LPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPP---PP 769 P P P P+ + PP P P Sbjct: 84 GP-PPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPS 142 Query: 770 XXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP P + P + PP P P Sbjct: 143 PPTNPPPPPESPPSLPAPDPPSNPLP 168 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 6/48 (12%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXP----PPPXXXP--PPXXXRPPXPLXPXXHP 833 PP P +PP P P PPP P PP PP PL P Sbjct: 63 PPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPP 110 Score = 30.7 bits (66), Expect = 1.4 Identities = 25/97 (25%), Positives = 26/97 (26%), Gaps = 9/97 (9%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPX----PXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPT 725 P P PP P P P S P P P P Sbjct: 148 PPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERP 207 Query: 726 PTPPXXPXXXXPPPP-----XXXPPPXXXRPPXPLXP 821 TPP PPPP PPP + P P P Sbjct: 208 STPPSDSEHPSPPPPGHPKRREQPPPPGSKRPTPSPP 244 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/54 (31%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = +3 Query: 708 PPPX---PTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXPXNTI 860 PPP PTP+PP P P PP PP P P T+ Sbjct: 232 PPPGSKRPTPSPPSPSDSKRPVHPSPPSPPEETLPPPKPSPDPLPSNSSSPPTL 285 Score = 28.7 bits (61), Expect = 5.7 Identities = 19/72 (26%), Positives = 20/72 (27%), Gaps = 3/72 (4%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPPXXXPPP---XXXRPPXPLXPXXHPGRHXPXNTIXXXXXXX 881 PP TP P P P PPP PP P P P P Sbjct: 62 PPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPE 121 Query: 882 XXXXXXPPQKXP 917 PP + P Sbjct: 122 SSPPPPPPTEAP 133 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/47 (29%), Positives = 15/47 (31%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PPP P+PP PP P P P PG P Sbjct: 193 PPPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRREQPPPPGSKRP 239 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/50 (30%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Frame = +3 Query: 714 PXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP--XPLXPXXHPGRHXPXNT 857 P + PP P PP P P PP P+ P P P T Sbjct: 57 PAQSSPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPT 106 Score = 27.9 bits (59), Expect = 10.0 Identities = 25/97 (25%), Positives = 27/97 (27%), Gaps = 3/97 (3%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTP- 734 P TP+ P P P P P P P P P + Sbjct: 134 PTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVP--PSHSPPRHLPSPPASEI 191 Query: 735 PXXPXXXXPPPPXXXP--PPXXXRPPXPLXPXXHPGR 839 P P PP P PP P P P HP R Sbjct: 192 PPPPRHLPSPPASERPSTPPSDSEHPSP-PPPGHPKR 227 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 47.2 bits (107), Expect = 2e-05 Identities = 26/84 (30%), Positives = 28/84 (33%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP +P P P P P P P T P P P P PP P P Sbjct: 34 PPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQP-KPAPPPEPKPAPPPA 92 Query: 554 PPQXPTXPPPXPXFXLPRPXXGXG 625 P P PP P P+P G Sbjct: 93 PKPVPCPSPPKPPAPTPKPVPPHG 116 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/58 (39%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Frame = +3 Query: 678 PXLPXFCPXXPP-PXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P CP PP P P P PP P PP P P P +PP P P H P Sbjct: 62 PVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPP--HGP 117 Score = 44.8 bits (101), Expect = 8e-05 Identities = 27/82 (32%), Positives = 29/82 (35%), Gaps = 3/82 (3%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 P P P P PPP PP P + P PPP P PP P P Sbjct: 26 PGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPK---PVPPPACPPTPPKPQPKPAPP 82 Query: 554 P---PQXPTXPPPXPXFXLPRP 610 P P P P P P P+P Sbjct: 83 PEPKPAPPPAPKPVPCPSPPKP 104 Score = 43.6 bits (98), Expect = 2e-04 Identities = 26/83 (31%), Positives = 28/83 (33%), Gaps = 3/83 (3%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPP---PFXT 541 KPP P P P P PP P P+PPP PPP P Sbjct: 41 KPPPAPSPSP--CPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPC 98 Query: 542 PXXXPPQXPTXPPPXPXFXLPRP 610 P P PT P P P+P Sbjct: 99 PSPPKPPAPTPKPVPPHGPPPKP 121 Score = 42.7 bits (96), Expect = 3e-04 Identities = 36/142 (25%), Positives = 42/142 (29%), Gaps = 1/142 (0%) Frame = +2 Query: 425 PPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTX-PPPXPXFXL 601 PP APP P + P P P PP P P P P PPP P Sbjct: 3 PPTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQ--- 59 Query: 602 PRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXP 781 P+P + + P P+ PP PP P P Sbjct: 60 PKP--------VPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAP--TP 109 Query: 782 PPXPXXAXPXSXSXXPPGAPXP 847 P P P + P AP P Sbjct: 110 KPVPPHGPPPKPAPAPTPAPSP 131 Score = 42.3 bits (95), Expect = 4e-04 Identities = 26/80 (32%), Positives = 29/80 (36%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPX-XPXXPPPPFXTPXX 550 PP +P P P+ PP PP P A P+P P P P PP TP Sbjct: 54 PPPKPQPK-PVPPPACPPTPPKPQPKPAPPPEPKP-APPPAPKPVPCPSPPKPPAPTPKP 111 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 PP P P P P Sbjct: 112 VPPHGPPPKPAPAPTPAPSP 131 Score = 41.5 bits (93), Expect = 8e-04 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = +3 Query: 678 PXLPXFCPXXPP---PXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P CP PP P P P P P PP P P P PP P P P Sbjct: 25 PPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKP 79 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPL-XPXXHPGRHXPXN 854 P P P P P+PP P P P PPP P P P P P N Sbjct: 90 PPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKPEN 142 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P P P P+PP P PPP P P +P P P Sbjct: 43 PPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKP 87 Score = 37.9 bits (84), Expect = 0.009 Identities = 23/71 (32%), Positives = 25/71 (35%), Gaps = 1/71 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSP-PPXXPXXPPPPFXTPXX 550 P +P P P PPP P P A P P PP P P P TP Sbjct: 73 PKPQPKPAPPPEPKPAPPPAPKPVP---CPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAP 129 Query: 551 XPPQXPTXPPP 583 P P+ P P Sbjct: 130 SPKPAPSPPKP 140 Score = 36.7 bits (81), Expect = 0.022 Identities = 25/76 (32%), Positives = 27/76 (35%), Gaps = 1/76 (1%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPP-PFXT 541 K PP P P P P P +PP P P+P P P PPP P Sbjct: 78 KPAPPPEPKPAPPPAPKPVPCP---------SPPKP----PAPTPKPVPPHGPPPKPAPA 124 Query: 542 PXXXPPQXPTXPPPXP 589 P P P PP P Sbjct: 125 PTPAPSPKPAPSPPKP 140 Score = 35.9 bits (79), Expect = 0.038 Identities = 25/80 (31%), Positives = 26/80 (32%), Gaps = 8/80 (10%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXR---ATXPSPPPXXPXXP-----PP 529 P P P P P PP P + A PSP P P P PP Sbjct: 6 PDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPP 65 Query: 530 PFXTPXXXPPQXPTXPPPXP 589 P P PQ PPP P Sbjct: 66 PACPPTPPKPQPKPAPPPEP 85 Score = 35.9 bits (79), Expect = 0.038 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +3 Query: 678 PXLPXFCPXXPPP-XPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P P P PP P PTP P PP P P P P P P Sbjct: 90 PPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPP 138 Score = 35.1 bits (77), Expect = 0.066 Identities = 19/67 (28%), Positives = 22/67 (32%), Gaps = 1/67 (1%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXX 550 KP +P P P P PP P + P PP P P P +P Sbjct: 74 KPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKP 133 Query: 551 XP-PQXP 568 P P P Sbjct: 134 APSPPKP 140 Score = 33.9 bits (74), Expect = 0.15 Identities = 22/81 (27%), Positives = 24/81 (29%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPX 547 K P P P P P P P + P PP P P PP P Sbjct: 61 KPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTP-KPVPPHGPPP 119 Query: 548 XXPPQXPTXPPPXPXFXLPRP 610 P P P P P+P Sbjct: 120 KPAPAPTPAPSPKPAPSPPKP 140 Score = 27.9 bits (59), Expect = 10.0 Identities = 12/38 (31%), Positives = 13/38 (34%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P P P PP P P P P P +P P Sbjct: 109 PKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKPENKTIP 146 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 46.8 bits (106), Expect = 2e-05 Identities = 27/80 (33%), Positives = 28/80 (35%), Gaps = 5/80 (6%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRA-----TXPSPPPXXPXXPPP 529 K PP +P P L P PP P RA T P P PP Sbjct: 315 KLPPPVQPPPLRGLESDEQELPYSQNKPKFSQPPPPPNRAAFQAITQEKSPVPPPRRSPP 374 Query: 530 PFXTPXXXPPQXPTXPPPXP 589 P TP PP P PPP P Sbjct: 375 PLQTPPPPPPPPPLAPPPPP 394 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRP 803 PPP +P P P PPPP PPP RP Sbjct: 367 PPPRRSPPPLQTPPPPPPPPPLAPPPPPQKRP 398 Score = 34.7 bits (76), Expect = 0.087 Identities = 18/43 (41%), Positives = 20/43 (46%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXP 589 PP P ++T PSPP P P PF PQ PPP P Sbjct: 42 PPPPDFQST-PSPP--LPDTPDQPFFPENPSTPQQTLFPPPPP 81 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P F PPP PPP PPP PP P P P Sbjct: 342 PKFSQPPPPPNRAAFQAITQEKSPVPPPRRSPPPLQTPPPPPPPPPLAP 390 Score = 31.5 bits (68), Expect = 0.81 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 720 PTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P P P P PPP PPP PP P Sbjct: 365 PVPPPRRSPPPLQTPPPPPPPPPLAPPPPPQKRP 398 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 46.8 bits (106), Expect = 2e-05 Identities = 29/92 (31%), Positives = 31/92 (33%), Gaps = 2/92 (2%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAP-PXPXXRATXPSPPPXXPXXPPPPFXT 541 K KP P P P PP P P P T P P P PP P T Sbjct: 41 KPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPT 100 Query: 542 PXXXPPQXPTXPPPXP-XFXLPRPXXGXGXGG 634 P PP+ P P P P+P GG Sbjct: 101 PAPTPPKPKPAPAPAPTPAPKPKPAPKPAPGG 132 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/83 (31%), Positives = 26/83 (31%), Gaps = 1/83 (1%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAP-PXPXXRATXPSPPPXXPXXPPPPFXT 541 K KP P P P PP P P P T P P P PP P Sbjct: 30 KPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPK 89 Query: 542 PXXXPPQXPTXPPPXPXFXLPRP 610 P PP P P P P P Sbjct: 90 PAPTPPNPKPTPAPTPPKPKPAP 112 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/76 (30%), Positives = 24/76 (31%), Gaps = 1/76 (1%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAP-PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQ 562 P P P PP P P P T P P P PP P P PP+ Sbjct: 26 PKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPK 85 Query: 563 XPTXPPPXPXFXLPRP 610 P P P P P Sbjct: 86 PKPKPAPTPPNPKPTP 101 Score = 38.3 bits (85), Expect = 0.007 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P P PP P PTP P P P P P P P P P P Sbjct: 28 PPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPP 84 Score = 37.9 bits (84), Expect = 0.009 Identities = 22/83 (26%), Positives = 23/83 (27%) Frame = +3 Query: 564 TPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPPXX 743 TP P P P P + P P P P P PTPP Sbjct: 38 TPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNP 97 Query: 744 PXXXXPPPPXXXPPPXXXRPPXP 812 P PP P P P P Sbjct: 98 KPTPAPTPPKPKPAPAPAPTPAP 120 Score = 37.5 bits (83), Expect = 0.012 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P P P P PTPP P PP P P P P P + P Sbjct: 35 PAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKP 88 Score = 37.1 bits (82), Expect = 0.016 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P P P P PTPP P PP P P P P P + P Sbjct: 57 PAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKP 110 Score = 36.7 bits (81), Expect = 0.022 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P P P P PTPP P PP P P P P P P Sbjct: 46 PAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKP 99 Score = 35.9 bits (79), Expect = 0.038 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P P PP P P P P P P P P P P P P P Sbjct: 39 PPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPP 95 Score = 35.1 bits (77), Expect = 0.066 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P P PP P P P P P P P P P P P P P Sbjct: 50 PPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPP 106 Score = 35.1 bits (77), Expect = 0.066 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P P PP P P P P P P P P P P P P Sbjct: 61 PPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAP 112 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P PP P P P P P P P P P P P P P Sbjct: 24 PAPKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPP 73 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQX-PTXPPPXP 589 P P P+P P P P P TP P+ PT P P P Sbjct: 24 PAPKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKP 66 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/63 (28%), Positives = 20/63 (31%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXL 601 P P AP P + T PP P P P P P P P P Sbjct: 24 PAPKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTP 83 Query: 602 PRP 610 P+P Sbjct: 84 PKP 86 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +2 Query: 482 ATXPSPP---PXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 A P PP P PP P TP PP+ P P P P P Sbjct: 23 APAPKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAP 68 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTP-PXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P P PP P PTP P P P P P P P P Sbjct: 83 PPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKP 128 Score = 31.5 bits (68), Expect = 0.81 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P P P P P P P P P PP P P P P Sbjct: 48 PTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKP 99 Score = 31.5 bits (68), Expect = 0.81 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P P P P P P P P P PP P P P P Sbjct: 59 PTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKP 110 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P PTP P PP P P P +P P P Sbjct: 77 PAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTP 118 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP 788 P P P PP P P P P P P P P Sbjct: 94 PPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKPAP 130 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 46.8 bits (106), Expect = 2e-05 Identities = 37/161 (22%), Positives = 44/161 (27%), Gaps = 1/161 (0%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPX 547 K P +P P P + PP P P + P PP P PP P Sbjct: 66 KPPTVKPHPKPPTVKPHPKPPTVKPH-----PKPPTVKPPHPKPPTKPHPHPKPPIVKPP 120 Query: 548 XXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXX 727 PP PP P P+P P P+ Sbjct: 121 TKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTP-TPTPPVVTPPT 179 Query: 728 XXXXXXXPPXPPPPXXXPP-PXPXXAXPXSXSXXPPGAPXP 847 PP P PP PP P P P + + P P Sbjct: 180 PTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTP 220 Score = 45.6 bits (103), Expect = 5e-05 Identities = 26/86 (30%), Positives = 29/86 (33%) Frame = +2 Query: 347 KKXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP 526 K + K P +P P P PPP P P P+PP P P Sbjct: 133 KPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPP-TPTPTPPVVTPPTPTPPVITPPTPT 191 Query: 527 PPFXTPXXXPPQXPTXPPPXPXFXLP 604 PP TP P T P P P P Sbjct: 192 PPVVTPPTPTPPVITPPTPTPPVITP 217 Score = 45.2 bits (102), Expect = 6e-05 Identities = 24/77 (31%), Positives = 27/77 (35%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P P++ PP P P P+PP P P PP TP Sbjct: 164 PPPTPTPTPPVV---TPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTP 220 Query: 554 PPQXPTXPPPXPXFXLP 604 P T P P P P Sbjct: 221 TPPVVTPPTPTPPVVTP 237 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P P P PP TP PP P P PP PPP +PP P Sbjct: 112 PKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPP 159 Score = 41.5 bits (93), Expect = 8e-04 Identities = 22/73 (30%), Positives = 26/73 (35%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQX 565 P P P++ P P P P P+PP P P PP TP P Sbjct: 178 PTPTPPVITPPTPTPPVVTPP---TPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPPV 234 Query: 566 PTXPPPXPXFXLP 604 T P P P +P Sbjct: 235 VTPPTPTPPTPIP 247 Score = 38.3 bits (85), Expect = 0.007 Identities = 32/129 (24%), Positives = 38/129 (29%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLX 640 PP P + P PP P PP P P PP+ P PP P +P Sbjct: 29 PPKP---SPAPHKPPKHPVKPPKP---PAVKPPKPPAVKPPTPKPPTVKPHP---KPPTV 79 Query: 641 XXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXS 820 + P P P P PP PP P + P + Sbjct: 80 KPHPKPPTVKPHPKP-------PTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPT 132 Query: 821 XXPPGAPXP 847 PP P P Sbjct: 133 KPPPSTPKP 141 Score = 37.1 bits (82), Expect = 0.016 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +3 Query: 696 CPXXPP-PXPTP-TPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 C PP P P P PP P PP P P +PP P P P P Sbjct: 25 CDCTPPKPSPAPHKPPKHPVKPPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPP 77 Score = 37.1 bits (82), Expect = 0.016 Identities = 31/129 (24%), Positives = 33/129 (25%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLX 640 PP P P PP P P PP P PP P P P+P Sbjct: 46 PPKPPA-VKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVK-----P 99 Query: 641 XXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXS 820 P P P P PP PPP + P Sbjct: 100 PHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPP----STPKPPH 155 Query: 821 XXPPGAPXP 847 PP P P Sbjct: 156 HKPPPTPCP 164 Score = 35.9 bits (79), Expect = 0.038 Identities = 39/159 (24%), Positives = 43/159 (27%), Gaps = 1/159 (0%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 P P P P PP P P + P PP P P PP P Sbjct: 30 PKPSPAPHKPPKHPVKPPKPPAVKP----PKPPAVKPPTPKPPTVKP-HPKPPTVKPHPK 84 Query: 554 PPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXX 733 PP P P P P P + P PS Sbjct: 85 PPTVKPHPKP-PTVKPPHPKPPTKPHPHPKPPIVKPPTK--PPPSTPKPPTKPPPSTPKP 141 Query: 734 XXXXXPP-XPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP P PP PPP P P + + PP P Sbjct: 142 PTTKPPPSTPKPPHHKPPPTP--CPPPTPTPTPPVVTPP 178 Score = 35.1 bits (77), Expect = 0.066 Identities = 23/82 (28%), Positives = 26/82 (31%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXPX 851 + P + P P P P PP PP P P +PP P P P H P Sbjct: 56 KPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHP-KPPTKPHPH-PK 113 Query: 852 NTIXXXXXXXXXXXXXPPQKXP 917 I PP K P Sbjct: 114 PPIVKPPTKPPPSTPKPPTKPP 135 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXPXNT 857 P P PT PP P PP P P +PP P P P T Sbjct: 124 PPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVT 176 Score = 33.5 bits (73), Expect = 0.20 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 7/59 (11%) Frame = +3 Query: 678 PXLPXFCPXXP-PP---XPTPTPPXXPXXXXPPPPXXXPP---PXXXRPPXPLXPXXHP 833 P P P P PP PTPTPP P PP PP P PP P P P Sbjct: 190 PTPPVVTPPTPTPPVITPPTPTPPVI-TPPTPTPPVVTPPTPTPPVVTPPTPTPPTPIP 247 Score = 32.7 bits (71), Expect = 0.35 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 10/60 (16%) Frame = +3 Query: 699 PXXPPPXPTP---TPP-XXPXXXXPP---PPXXXPP---PXXXRPPXPLXPXXHPGRHXP 848 P PP PTP TPP P PP PP PP P PP P P P P Sbjct: 173 PVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTP 232 Score = 32.3 bits (70), Expect = 0.46 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +3 Query: 699 PXXPPPXPTP---TPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXPXNTI 860 P PP PTP TPP PP P P PP P P P P I Sbjct: 193 PVVTPPTPTPPVITPPTPTPPVITPP---TPTPPVVTPPTPTPPVVTPPTPTPPTPI 246 Score = 31.5 bits (68), Expect = 0.81 Identities = 18/60 (30%), Positives = 19/60 (31%), Gaps = 1/60 (1%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXR-PPXPLXPXXHPGRHXP 848 + P P P PP PTP P PP P P P P P P P Sbjct: 45 KPPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKP 104 Score = 29.5 bits (63), Expect = 3.3 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 3/60 (5%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRP---PXPLXPXXHPGRHXP 848 P P P PP P P P PP P PP P P P P P P Sbjct: 29 PPKPSPAPHKPPKHPVKPPK--PPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPP 86 Score = 29.5 bits (63), Expect = 3.3 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 5/57 (8%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXP--XXXXPPPPXXXP---PPXXXRPPXPLXPXXHP 833 P P P PP P PP P P PP P PP P P HP Sbjct: 36 PHKPPKHPVKPPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHP 92 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/57 (28%), Positives = 19/57 (33%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXP 556 P P P++ P P P P P+PP P P PP P P Sbjct: 198 PTPTPPVITPPTPTPPVITPP---TPTPPVVTPPTPTPPVVTPPTPTPPTPIPETCP 251 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 46.4 bits (105), Expect = 3e-05 Identities = 29/85 (34%), Positives = 31/85 (36%), Gaps = 5/85 (5%) Frame = +2 Query: 371 KPPXRPXPXXPLLG-GXXPPPXXXXXXGXGAPPXPXXRATXPS--PPPXXPXXPPPPFXT 541 +PP + P P G G PPP G PP P PPP PPP Sbjct: 156 RPPGQMPPQPPFAGQGGPPPPYGMRPPYPGPPPPQYGGQQRPMMIPPPGGMMRGPPPPHG 215 Query: 542 PXXXPPQXPTXPPP--XPXFXLPRP 610 PP P PPP P F P P Sbjct: 216 MQGPPPSRPGMPPPGGAPMFAPPHP 240 Score = 36.3 bits (80), Expect = 0.028 Identities = 24/71 (33%), Positives = 24/71 (33%) Frame = +2 Query: 377 PXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXP 556 P P P P GG P G P P PPP P PPP P P Sbjct: 181 PPYPGPPPPQYGGQQRPMMIPPPGGMMRGPPPPHGMQ--GPPPSRPGMPPPG-GAPMFAP 237 Query: 557 PQXPTXPPPXP 589 P P PP P Sbjct: 238 PH-PGMPPAPP 247 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 PP P P PPPP PP PP Sbjct: 157 PPGQMPPQPPFAGQGGPPPPYGMRPPYPGPPP 188 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXP---PPXXXRPPXPLXPXXHPGRH 842 PPP PP P PPP P PP PP P P H +H Sbjct: 211 PPPHGMQGPP--PSRPGMPPPGGAPMFAPPHPGMPPAP--PNHHNQQH 254 Score = 28.3 bits (60), Expect = 7.5 Identities = 23/70 (32%), Positives = 25/70 (35%), Gaps = 15/70 (21%) Frame = +3 Query: 669 GRXPXLPXFC----PXXP----PPXPTPTPPXXPXXXXP---PPP----XXXPPPXXXRP 803 G+ P P F P P PP P P PP P PPP PPP + Sbjct: 159 GQMPPQPPFAGQGGPPPPYGMRPPYPGPPPPQYGGQQRPMMIPPPGGMMRGPPPPHGMQG 218 Query: 804 PXPLXPXXHP 833 P P P P Sbjct: 219 PPPSRPGMPP 228 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPP----XXXPPPXXXRPPXPLXPXXHP 833 P P PP P P+PP P PPPP PPP PP PL P P Sbjct: 1069 PPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSP 1121 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/61 (37%), Positives = 24/61 (39%), Gaps = 7/61 (11%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPT-------PTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPG 836 P LP P PPP P P PP PPPP PPP PP P P P Sbjct: 1070 PPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPPS 1129 Query: 837 R 839 + Sbjct: 1130 Q 1130 Score = 44.0 bits (99), Expect = 1e-04 Identities = 27/83 (32%), Positives = 30/83 (36%), Gaps = 1/83 (1%) Frame = +2 Query: 365 KKKPPXRPXPXX-PLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXT 541 +K P P P L PPP P P ++ P PPP P PP Sbjct: 1049 EKSTEFNPLPEDSPPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPP--- 1105 Query: 542 PXXXPPQXPTXPPPXPXFXLPRP 610 P PP P PPP P P P Sbjct: 1106 PPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 37.1 bits (82), Expect = 0.016 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 2/57 (3%) Frame = +3 Query: 684 LPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP--LXPXXHPGRHXP 848 LP P P P P PP P PPPP PP PP P L P P P Sbjct: 1057 LPEDSPPLPQESPPPLPPLPP---SPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQP 1110 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 749 PPXPP-PPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP PP PP PPP P P PP P P Sbjct: 1081 PPSPPLPPSSLPPPPPAALFPPLPP--PPSQPPP 1112 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +2 Query: 752 PXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 P PPP PP P + P PP +P P Sbjct: 1092 PPPPPAALFPPLPPPPSQPPPPPLSPPPSPPP 1123 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP PP P P P P PP P P Sbjct: 1092 PPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPP 1124 Score = 27.9 bits (59), Expect = 10.0 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +3 Query: 714 PXPTPTPPXXPXXXXPPPPX--XXPPPXXXRPPXPLXP 821 P P +PP P PP PPP PP L P Sbjct: 1056 PLPEDSPPLPQESPPPLPPLPPSPPPPSPPLPPSSLPP 1093 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 46.4 bits (105), Expect = 3e-05 Identities = 42/160 (26%), Positives = 46/160 (28%), Gaps = 6/160 (3%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P + PPP +PP P + P PPP PPPP Sbjct: 92 PPVLLSPPPPPVNLSPPPPPVNL-----SPPPPPVLLSPP-PPPVLLSPPPPPVNLSPPP 145 Query: 554 PPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXX 733 PP + PPP F P P P P Sbjct: 146 PPVLLSPPPPPVLFSPPPPTVTR-----PPPPPTITRSPPPPRPQAAAYYKKTPPPPPYK 200 Query: 734 XXXXXPPXPPPP------XXXPPPXPXXAXPXSXSXXPPG 835 PP PPPP PPP P S PPG Sbjct: 201 YGRVYPPPPPPPQAARSYKRSPPPPPPSKYGRVYSPPPPG 240 Score = 41.1 bits (92), Expect = 0.001 Identities = 36/159 (22%), Positives = 44/159 (27%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PPP +PP P + P PPP PPPP PP + Sbjct: 44 PPPPPVNISSPPPPVNL-----SPPPPPVNLSPP-PPPVNLSPPPPPVNLSPPPPPVLLS 97 Query: 572 XPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXP 751 PPP P P + P P L Sbjct: 98 PPPPPVNLSPPPPP-------VNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLL 150 Query: 752 PXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXKHNSSF 868 PPPP PP P P P P +++ Sbjct: 151 SPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAY 189 Score = 40.7 bits (91), Expect = 0.001 Identities = 25/79 (31%), Positives = 29/79 (36%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P + PPP +PP P + P PP PPP +P Sbjct: 65 PPVNLSPPPPPVNLSPPPPPVNL-----SPPPPPVLLSPPPPPVNLSPPPPPVNLSP--P 117 Query: 554 PPQXPTXPPPXPXFXLPRP 610 PP PPP P P P Sbjct: 118 PPPVLLSPPPPPVLLSPPP 136 Score = 39.9 bits (89), Expect = 0.002 Identities = 30/117 (25%), Positives = 33/117 (28%) Frame = +2 Query: 458 APPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGL 637 +PP P + P PP PPP +P PP PPP P P P L Sbjct: 43 SPPPPPVNISSPPPPVNLSPPPPPVNLSP--PPPPVNLSPPPPPVNLSPPPPP-----VL 95 Query: 638 XXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXP 808 P P P PPP PPP P P Sbjct: 96 LSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSP 152 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPP---XXXPPPXXXRPPXP 812 P P PPP +PP P PPPP PPP RPP P Sbjct: 125 PPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPP 172 Score = 35.1 bits (77), Expect = 0.066 Identities = 29/119 (24%), Positives = 30/119 (25%), Gaps = 2/119 (1%) Frame = +2 Query: 491 PSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXR 670 P P P PPPP PP PPP P P P Sbjct: 34 PEPAPLVDLSPPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVN-----LSPPPPPVNLS 88 Query: 671 XXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXPPPXP--XXAXPXSXSXXPPGAP 841 P P P PPP PPP P P + PP P Sbjct: 89 PPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPP 147 Score = 33.5 bits (73), Expect = 0.20 Identities = 26/92 (28%), Positives = 28/92 (30%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPP 737 P L PP P P P V+ P P PP +P PP Sbjct: 65 PPVNLSPPPPPVNLSPPPPP-----VNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPP 119 Query: 738 XXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 PPP PPP PP L P P Sbjct: 120 PVLLSPPPPPVLLSPPP----PPVNLSPPPPP 147 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPX---XXPPPXXXRPPXP 812 P P PPP PP PPPP PPP PP P Sbjct: 117 PPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPP 164 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPX--XXPPPXXXRPPXPLXPXXHP 833 PPP +PP P PPPP PPP PP L P P Sbjct: 54 PPPPVNLSPPPPPVNLSPPPPPVNLSPPP----PPVNLSPPPPP 93 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPX---XXPPPXXXRPPXP 812 P P PPP PP PPPP PPP PP P Sbjct: 45 PPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPP 92 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPX---XXPPPXXXRPPXP 812 P P PPP PP PPPP PPP PP P Sbjct: 63 PPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPP 110 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPX--XXPPPXXXRPPXPLXPXXHP 833 PPP +PP P PPPP PPP PP L P P Sbjct: 63 PPPPVNLSPPPPPVNLSPPPPPVNLSPPP----PPVLLSPPPPP 102 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPX-XXPPPXXXRPPXPLXPXXHP 833 PPP +PP PPPP PPP PP L P P Sbjct: 46 PPPVNISSPPPPVNLSPPPPPVNLSPPP----PPVNLSPPPPP 84 Score = 30.3 bits (65), Expect = 1.9 Identities = 27/97 (27%), Positives = 29/97 (29%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPP 737 P L PP P P P V+ P F P PPP T PP Sbjct: 119 PPVLLSPPPPPVLLSPPPPP-----VNLSPPPPPVLLSPPPPPVLFSP--PPPTVTRPPP 171 Query: 738 XXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PPPP + P P P GR P Sbjct: 172 PPTITRSPPPPRPQAAAYYKKTPPP--PPYKYGRVYP 206 Score = 27.9 bits (59), Expect = 10.0 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = +3 Query: 708 PPPXP----TPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P P +P PP PPP PPP PP L P P Sbjct: 34 PEPAPLVDLSPPPPPVNISSPPPPVNLSPPP----PPVNLSPPPPP 75 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 46.4 bits (105), Expect = 3e-05 Identities = 38/138 (27%), Positives = 39/138 (28%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P PPP P P + P PPP PPPP TP Sbjct: 31 PPTDSAPPPSPPADSSPPPALPSLPPAVFSPPPT--VSSPPPPPLDSSPPPPPDLTPPPS 88 Query: 554 PPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXX 733 P P PPP P P P P P F Sbjct: 89 SPPPPDAPPPIP-IVFPPPIDS----------PPPESTNSPPPPEVF------EPPPPPA 131 Query: 734 XXXXXPPXPPPPXXXPPP 787 PP PPPP PPP Sbjct: 132 DEDESPPAPPPPEQLPPP 149 Score = 41.1 bits (92), Expect = 0.001 Identities = 39/161 (24%), Positives = 41/161 (25%), Gaps = 3/161 (1%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX-PPQ 562 P P PP G APP P A PSPP P P P PP Sbjct: 5 PTSSPPAPSADSAPPPDTSSDGSAAPP-PTDSAPPPSPPADSSPPPALPSLPPAVFSPPP 63 Query: 563 XPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXX 742 + PPP P P P P Sbjct: 64 TVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEV 123 Query: 743 XXPPXPP--PPXXXPPPXPXXAXPXSXSXXPPGAPXPXKHN 859 PP PP P P P P S G P KH+ Sbjct: 124 FEPPPPPADEDESPPAPPPPEQLPPPASSPQGGPKKPKKHH 164 Score = 41.1 bits (92), Expect = 0.001 Identities = 40/164 (24%), Positives = 43/164 (26%), Gaps = 9/164 (5%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPX---PXXRATXP----SPPPXXPXXPPPP 532 PP P P L PPP PP P P SPPP PPPP Sbjct: 62 PPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPP 121 Query: 533 --FXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXX 706 F P + + P P P LP P G P PS Sbjct: 122 EVFEPPPPPADEDESPPAPPPPEQLPPPASSPQGGPKKPKKHHPGPATSPPAPSAPATSP 181 Query: 707 XXXXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPPGA 838 P P P P S + PP A Sbjct: 182 PAPPNAPPRNSSHALPPKSTAAGGPLTSPSRGVPSSGNSVPPPA 225 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPT-PPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P LP P P PT + PP P PPPP PP PP P Sbjct: 49 PALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPP 97 Score = 36.7 bits (81), Expect = 0.022 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPP-PXXXPPPXXXRPP 806 P P PPP TP P P PPP P PPP PP Sbjct: 69 PPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPP 112 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P P P P PP P PPP PPP P P Sbjct: 78 PPPPDLTPPPSSPPPPDAPPPIPIVF--PPPIDSPPPESTNSPPP 120 Score = 32.7 bits (71), Expect = 0.35 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 PPP + PP P PPP PP PP Sbjct: 30 PPPTDSAPPPSPPADSSPPPALPSLPPAVFSPP 62 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 PPP P P PP PPP PP P Sbjct: 37 PPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPP 71 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P PPP P PP P PP PPP P P Sbjct: 93 PDAPPPIPIVFPP--PIDSPPPESTNSPPPPEVFEPPP 128 Score = 29.5 bits (63), Expect = 3.3 Identities = 24/88 (27%), Positives = 27/88 (30%), Gaps = 4/88 (4%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPX----XPPPPFXT 541 P P P GG P +PP P AT P PP P PP T Sbjct: 143 PEQLPPPASSPQGGPKKPKKHHPGPAT-SPPAPSAPATSPPAPPNAPPRNSSHALPPKST 201 Query: 542 PXXXPPQXPTXPPPXPXFXLPRPXXGXG 625 P P+ P +P P G Sbjct: 202 AAGGPLTSPSRGVPSSGNSVPPPANSGG 229 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 5/48 (10%) Frame = +3 Query: 708 PPPXPTPTPP----XXPXXXXPPPPXXXPPPXXXRPPXPLXP-XXHPG 836 PPP PP PPPP PPP P P HPG Sbjct: 119 PPPEVFEPPPPPADEDESPPAPPPPEQLPPPASSPQGGPKKPKKHHPG 166 Score = 27.9 bits (59), Expect = 10.0 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 699 PXXPPPXPTPTPPXX---PXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P PP +P P P PPP PPP P P P P Sbjct: 38 PPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSP 90 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 45.2 bits (102), Expect = 6e-05 Identities = 29/85 (34%), Positives = 33/85 (38%), Gaps = 3/85 (3%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP---F 535 K PP P P PPP PP P + PSPP P PPPP + Sbjct: 402 KPSPPIVALPPPPPPSPPLPPPVY------SPPPSPPVFSPPPSPPVYSP--PPPPSIHY 453 Query: 536 XTPXXXPPQXPTXPPPXPXFXLPRP 610 +P P + PPP P F P P Sbjct: 454 SSPPPPPVHHSSPPPPSPEFEGPLP 478 Score = 35.9 bits (79), Expect = 0.038 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPP---XXXPPPXXXRPPXPLXP 821 P P F P PP +P PP PPPP PPP PL P Sbjct: 429 PSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSPEFEGPLPP 479 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXH 830 P PPP P+P P P PP PPP P P H Sbjct: 405 PPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIH 452 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPP-PPXXXPPP 788 P P P PPP +P PP P PP PP PPP Sbjct: 411 PPPPPPSPPLPPPVYSP-PPSPPVFSPPPSPPVYSPPP 447 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 6/54 (11%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPP------XXXPPPXXXRPPXPLXP 821 P LP PP P +PP P PPPP PPP P P P Sbjct: 418 PPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSP 471 Score = 31.9 bits (69), Expect = 0.61 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXKHNSS 865 PP PPP PP P + P S P P P H SS Sbjct: 418 PPLPPPVYSPPPSPPVFSPPPSPPVYSP-PPPPSIHYSS 455 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/65 (27%), Positives = 21/65 (32%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P + PPP PP P ++ P P P PP Sbjct: 431 PPVFSPPPSPPVYSPPPPPSIHYS---SPPPPPVHHSSPPPPSPEFEGPLPPVIGVSYAS 487 Query: 554 PPQXP 568 PP P Sbjct: 488 PPPPP 492 Score = 31.5 bits (68), Expect = 0.81 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 726 PTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P+PP PPP PPP PP P Sbjct: 403 PSPPIVALPPPPPPSPPLPPPVYSPPPSP 431 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXKHNSS 865 PP PP PP P + P S P P H+SS Sbjct: 427 PPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSS 465 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 PP PP P PPP PP P P P P Sbjct: 405 PPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSP 445 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = +2 Query: 479 RATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 R+ PP PPPP +P PP PPP P P P Sbjct: 398 RSVVKPSPPIVALPPPPP-PSPPLPPPVY--SPPPSPPVFSPPP 438 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 45.2 bits (102), Expect = 6e-05 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 2/59 (3%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPT--PTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P P PPP P P P P PPP PPP PP L P P R P Sbjct: 46 PPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPP 104 Score = 44.4 bits (100), Expect = 1e-04 Identities = 27/76 (35%), Positives = 28/76 (36%), Gaps = 4/76 (5%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXP----PPPFXT 541 PP P P P PPP PP P PPP P P PPP Sbjct: 41 PPPSPPPS-PSSPPRLPPPFPALF-----PPEPPLPPRFELPPPLFPPPPLPRLPPPLLP 94 Query: 542 PXXXPPQXPTXPPPXP 589 P PP+ P PPP P Sbjct: 95 PPEEPPREPPPPPPPP 110 Score = 39.5 bits (88), Expect = 0.003 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 1/71 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXP-SPPPXXPXXPPPPFXTPXX 550 PP P P L P P PP P R P PPP P PPP Sbjct: 52 PPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPP------ 105 Query: 551 XPPQXPTXPPP 583 PP P PPP Sbjct: 106 -PPPPPEEPPP 115 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +2 Query: 449 GXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 G PP SPPP P P P P P P PP P F LP P Sbjct: 25 GTCCPPPLVFPLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPP 78 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P P P PP P P P P PP PPP PP P P Sbjct: 42 PPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLP 89 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 PPP P PP P PP PPP PP P Sbjct: 82 PPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPPP 116 Score = 35.9 bits (79), Expect = 0.038 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPP--PXXXPPPXXXRPPXPLXPXXHPGRHXPX 851 P LP PP P P P P PPP P PPP P P P P Sbjct: 67 PPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPPPASCLRTKSPE 126 Query: 852 NTI 860 N I Sbjct: 127 NGI 129 Score = 35.5 bits (78), Expect = 0.050 Identities = 28/106 (26%), Positives = 29/106 (27%) Frame = +2 Query: 470 PXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXX 649 P T PP P P P +P P P PPP P P P Sbjct: 21 PGTTGTCCPPPLVFPLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPP--------LPPR 72 Query: 650 XXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXPPP 787 P P L PP PPPP PPP Sbjct: 73 FELPPPLFPPPP---LPRLPPPLLPPPEEPPREPPPPPPPPEEPPP 115 Score = 34.3 bits (75), Expect = 0.11 Identities = 27/81 (33%), Positives = 27/81 (33%), Gaps = 2/81 (2%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXP-PPPFXTPXX 550 PP P PL PPP PP P A P PP P PPP P Sbjct: 29 PPPLVFPLLPLSPPPSPPPSPSSPPRL-PPPFP---ALFPPEPPLPPRFELPPPLFPPPP 84 Query: 551 XPP-QXPTXPPPXPXFXLPRP 610 P P PPP P P Sbjct: 85 LPRLPPPLLPPPEEPPREPPP 105 Score = 33.5 bits (73), Expect = 0.20 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = +2 Query: 374 PPXRPXPXX-PLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP 532 PP P P L PPP PP P P PPP P PPPP Sbjct: 64 PPEPPLPPRFELPPPLFPPPPLPRLPPPLLPP-PEEPPREPPPPPPPPEEPPPP 116 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 4/42 (9%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPP----PPXXXPPPXXXRPPXPLXP 821 PPP P P P PP PP PP PP P P Sbjct: 29 PPPLVFPLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLP 70 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 45.2 bits (102), Expect = 6e-05 Identities = 26/59 (44%), Positives = 29/59 (49%), Gaps = 4/59 (6%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVG---VGXGGGXXGQ-KXGR 683 G +R GW G G GG GGG GGGG G GG G G GGG G+ + GR Sbjct: 63 GSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGREGR 121 Score = 37.9 bits (84), Expect = 0.009 Identities = 22/51 (43%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXX-GXXGGGEGXVARXXGXGG 460 G G + G GGG G GG G GGGG G GGG G G GG Sbjct: 61 GSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGG 111 Score = 36.7 bits (81), Expect = 0.022 Identities = 22/69 (31%), Positives = 25/69 (36%) Frame = -2 Query: 606 RGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXG 427 R + + GG WG G GGGG G GGG G G GG G Sbjct: 52 RDKKRSYNGGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGG 111 Query: 426 GGXXPPKRG 400 GG + G Sbjct: 112 GGKGKGREG 120 Score = 36.7 bits (81), Expect = 0.022 Identities = 23/67 (34%), Positives = 23/67 (34%) Frame = -2 Query: 600 RXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGG 421 R G G WGG G GGGG G GGG G G GG G G Sbjct: 56 RSYNGGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKG 115 Query: 420 XXPPKRG 400 RG Sbjct: 116 KGREGRG 122 Score = 36.3 bits (80), Expect = 0.028 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXX-GXXGGGEGXVARXXGXGG 460 G R G GGG G GG G GGGG G GGG G G GG Sbjct: 63 GSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGG 113 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGG--XXGXXGGGEG 490 G G G GGG G GG G GGGG G GGG+G Sbjct: 74 GGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKG 115 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 805 GGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 GG G GGGG G GG G G GGG Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGG 92 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 831 GGXXXXEXGXAXXGXGGGXXXGGGGXGG 748 GG G G GGG GGGG GG Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGG 87 Score = 28.3 bits (60), Expect = 7.5 Identities = 19/57 (33%), Positives = 21/57 (36%) Frame = -2 Query: 543 GVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPPKRGXXGXGRXGG 373 G + G G G GGG G G GG GGG K G G G+ G Sbjct: 63 GSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWY--KWGCGGGGKGKG 117 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 44.8 bits (101), Expect = 8e-05 Identities = 30/83 (36%), Positives = 32/83 (38%), Gaps = 4/83 (4%) Frame = +2 Query: 374 PPXRPXPXXPL-LGGXXPPPXXXXXXGXGAP---PXPXXRATXPSPPPXXPXXPPPPFXT 541 P P P PL L G PPP G +P P P P PPP P P Sbjct: 189 PLPSPGPDSPLPLPG--PPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPL 246 Query: 542 PXXXPPQXPTXPPPXPXFXLPRP 610 P PP P+ P P P LP P Sbjct: 247 PSPGPPPSPS-PTPGPDSPLPSP 268 Score = 38.3 bits (85), Expect = 0.007 Identities = 30/101 (29%), Positives = 33/101 (32%), Gaps = 4/101 (3%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTP- 734 P +PL P P P P + G LP PPP +PTP Sbjct: 186 PDSPLPSPG-PDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPL---PGPPPSSSPTPG 241 Query: 735 PXXPXXXXPPPPXXXPPPXXXRP---PXPLXPXXHPGRHXP 848 P P PPP P P P P P P PG P Sbjct: 242 PDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPP 282 Score = 37.1 bits (82), Expect = 0.016 Identities = 24/78 (30%), Positives = 26/78 (33%) Frame = +2 Query: 377 PXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXP 556 P P P P PPP P P + PSP P P P P +P P Sbjct: 161 PPLPPPPPPYPSPLPPPP--------SPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTP 212 Query: 557 PQXPTXPPPXPXFXLPRP 610 P P P LP P Sbjct: 213 GPDSPLPSPGPDSPLPLP 230 Score = 37.1 bits (82), Expect = 0.016 Identities = 31/125 (24%), Positives = 32/125 (25%), Gaps = 3/125 (2%) Frame = +2 Query: 491 PSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXG-GLXXXXXXXXXX 667 P PPP PPPP +P P P P LP P G Sbjct: 165 PPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPD 224 Query: 668 RXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPP-PXXXPP-PXPXXAXPXSXSXXPPGAP 841 P P PP P P P P P P P P P Sbjct: 225 SPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPPLP 284 Query: 842 XPXKH 856 P H Sbjct: 285 SPGPH 289 Score = 37.1 bits (82), Expect = 0.016 Identities = 22/79 (27%), Positives = 25/79 (31%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 P P P PL P + P P + PSP P P P +P Sbjct: 208 PSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPS 267 Query: 554 PPQXPTXPPPXPXFXLPRP 610 P P P P LP P Sbjct: 268 PGPDSPLPSPGPDPPLPSP 286 Score = 36.7 bits (81), Expect = 0.022 Identities = 28/122 (22%), Positives = 31/122 (25%) Frame = +2 Query: 482 ATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXX 661 ++ P PP P P P P P P P P P P P G Sbjct: 158 SSDPPLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSP 217 Query: 662 XXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPPGAP 841 P L P PPP P P P P P +P Sbjct: 218 LPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSP 277 Query: 842 XP 847 P Sbjct: 278 GP 279 Score = 36.7 bits (81), Expect = 0.022 Identities = 23/66 (34%), Positives = 25/66 (37%), Gaps = 9/66 (13%) Frame = +3 Query: 678 PXLPXFCPXXP---PPXPTPTPPXXPXXXXPPP------PXXXPPPXXXRPPXPLXPXXH 830 P LP P P PP P+P+P P P P P PPP P P P Sbjct: 161 PPLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPS 220 Query: 831 PGRHXP 848 PG P Sbjct: 221 PGPDSP 226 Score = 35.5 bits (78), Expect = 0.050 Identities = 23/76 (30%), Positives = 24/76 (31%), Gaps = 4/76 (5%) Frame = +2 Query: 374 PPXRPXPXXPLL--GGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPX 547 P P P PL G P P P P P P P PPP +P Sbjct: 180 PSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPT 239 Query: 548 XXP--PQXPTXPPPXP 589 P P PPP P Sbjct: 240 PGPDSPLPSPGPPPSP 255 Score = 35.1 bits (77), Expect = 0.066 Identities = 27/94 (28%), Positives = 27/94 (28%), Gaps = 1/94 (1%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPX-FCPXXPPPXPTPTP 734 P P PP P P P G G LP P P P P P Sbjct: 161 PPLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSP----GPDSPLPLPGPPPSPSPTPGPDS 216 Query: 735 PXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPG 836 P P P PPP P P P PG Sbjct: 217 PLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPG 250 Score = 35.1 bits (77), Expect = 0.066 Identities = 22/78 (28%), Positives = 24/78 (30%) Frame = +2 Query: 377 PXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXP 556 P P P G P P P P + P P P PPP +P P Sbjct: 202 PGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGP 261 Query: 557 PQXPTXPPPXPXFXLPRP 610 P P P LP P Sbjct: 262 DS--PLPSPGPDSPLPSP 277 Score = 34.7 bits (76), Expect = 0.087 Identities = 30/97 (30%), Positives = 31/97 (31%), Gaps = 2/97 (2%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXL-PXFCPXXPPPXPTPTP 734 P +PL P P P P G S G P P P P P P P P Sbjct: 195 PDSPLPLPGPPPSPSPTP-GPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPP 253 Query: 735 PXXPXXXXPPPPXXXPPPXXXRP-PXPLXPXXHPGRH 842 P P P P P P P P P PG H Sbjct: 254 SPSP-TPGPDSPLPSPGPDSPLPSPGPDPPLPSPGPH 289 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 44.8 bits (101), Expect = 8e-05 Identities = 40/163 (24%), Positives = 46/163 (28%), Gaps = 9/163 (5%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PPP PP P ++ P PP PPPP+ PP Sbjct: 261 PPPPYVYSSPPPPPYVYK---SPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVY 317 Query: 572 XPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXP 751 PP P + P P P + P Sbjct: 318 KSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPAPYVYKPPPYVYKPPPYVYNYSPP 377 Query: 752 PXP----PPP---XXXPPPXP--XXAXPXSXSXXPPGAPXPXK 853 P P PPP PPP P P S PP AP K Sbjct: 378 PAPYVYKPPPYVYSYSPPPAPYVYKPPPYVYSYSPPPAPYVYK 420 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/73 (30%), Positives = 27/73 (36%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PPP PP P ++ P PP PPPP+ PP Sbjct: 111 PPPPYVYSSPPPPPYVYK---SPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 167 Query: 572 XPPPXPXFXLPRP 610 PPP P + P Sbjct: 168 SPPPPPPYVYQSP 180 Score = 42.3 bits (95), Expect = 4e-04 Identities = 26/80 (32%), Positives = 31/80 (38%), Gaps = 6/80 (7%) Frame = +2 Query: 368 KKPPXRPX-----PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP 532 K PP P P P + PPP PP P ++ P PP PPPP Sbjct: 108 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYS---SPPPPPYVYSSPPPPPYVYKSPPPPP 164 Query: 533 F-XTPXXXPPQXPTXPPPXP 589 + +P PP PPP P Sbjct: 165 YVYSPPPPPPYVYQSPPPPP 184 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/83 (28%), Positives = 29/83 (34%), Gaps = 2/83 (2%) Frame = +2 Query: 368 KKPPX--RPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXT 541 K PP P P + PPP PP P ++ P PP PPPP+ Sbjct: 61 KPPPYIYSSPPPPPYVYSSPPPPPYVYN---SPPPPPYVYSSPPPPPYVYKSPPPPPYVY 117 Query: 542 PXXXPPQXPTXPPPXPXFXLPRP 610 PP PP P + P Sbjct: 118 SSPPPPPYVYKSPPPPPYVYSSP 140 Score = 41.1 bits (92), Expect = 0.001 Identities = 35/154 (22%), Positives = 44/154 (28%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PPP PP P ++ P PP PPPP+ PP Sbjct: 241 PPPPYVYSSPPPPPYVYK---SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY 297 Query: 572 XPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXP 751 PP P + P + P P ++ Sbjct: 298 SSPPPPPYVYSSPPP---PPYVYKSPPPPPYVYTSPPPPPYV----YKSPPPPPYVDSYS 350 Query: 752 PXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXK 853 P P P PPP P + PP AP K Sbjct: 351 PPPAPYVYKPPPYVYKPPPYVYNYSPPPAPYVYK 384 Score = 40.7 bits (91), Expect = 0.001 Identities = 27/89 (30%), Positives = 34/89 (38%), Gaps = 8/89 (8%) Frame = +2 Query: 368 KKPPXRPX-----PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP 532 K PP P P P + PPP +PP P + P PPP PPPP Sbjct: 128 KSPPPPPYVYSSPPPPPYVYSSPPPPPYVYK----SPPPPPYVYSPPPPPPYVYQSPPPP 183 Query: 533 ---FXTPXXXPPQXPTXPPPXPXFXLPRP 610 + +P P + PPP + P P Sbjct: 184 PYVYSSPPPPPYVYKSPPPPPYVYSSPPP 212 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/73 (28%), Positives = 26/73 (35%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PPP PP P ++ P PP PPPP+ PP Sbjct: 161 PPPPYVYSPPPPPPYVYQ---SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY 217 Query: 572 XPPPXPXFXLPRP 610 PP P + P Sbjct: 218 KSPPPPPYVYSSP 230 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/73 (28%), Positives = 26/73 (35%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PPP PP P ++ P PP PPPP+ PP Sbjct: 181 PPPPYVYSSPPPPPYVYK---SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY 237 Query: 572 XPPPXPXFXLPRP 610 PP P + P Sbjct: 238 KSPPPPPYVYSSP 250 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/73 (28%), Positives = 26/73 (35%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PPP PP P ++ P PP PPPP+ PP Sbjct: 201 PPPPYVYSSPPPPPYVYK---SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY 257 Query: 572 XPPPXPXFXLPRP 610 PP P + P Sbjct: 258 KSPPPPPYVYSSP 270 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/73 (28%), Positives = 26/73 (35%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PPP PP P ++ P PP PPPP+ PP Sbjct: 221 PPPPYVYSSPPPPPYVYK---SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY 277 Query: 572 XPPPXPXFXLPRP 610 PP P + P Sbjct: 278 KSPPPPPYVYSSP 290 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/73 (28%), Positives = 25/73 (34%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PPP PP P + P PP PPPP+ PP Sbjct: 81 PPPPYVYNSPPPPPYVYS---SPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 137 Query: 572 XPPPXPXFXLPRP 610 PP P + P Sbjct: 138 SSPPPPPYVYSSP 150 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/74 (31%), Positives = 27/74 (36%), Gaps = 1/74 (1%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFX-TPXXXPPQXP 568 P P + PPP PP P + P PP PPPP+ + PP Sbjct: 101 PPPPYVYKSPPPPPYVYS---SPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVY 157 Query: 569 TXPPPXPXFXLPRP 610 PPP P P P Sbjct: 158 KSPPPPPYVYSPPP 171 Score = 39.9 bits (89), Expect = 0.002 Identities = 24/71 (33%), Positives = 29/71 (40%), Gaps = 3/71 (4%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP---FXTPXXXP 556 P P P + PPP +PP P P PPP PPPP + +P P Sbjct: 169 PPPPPPYVYQSPPPPPYVY----SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP-P 223 Query: 557 PQXPTXPPPXP 589 P + PPP P Sbjct: 224 PYVYSSPPPPP 234 Score = 39.5 bits (88), Expect = 0.003 Identities = 45/175 (25%), Positives = 53/175 (30%), Gaps = 13/175 (7%) Frame = +2 Query: 368 KKPPXRPX-----PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP 532 K PP P P P + PPP +PP P P PPP PPPP Sbjct: 198 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVY----SSPPPPPYVYKSPPPPPYVYSSPPPP 253 Query: 533 ---FXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXX 703 + +P PP + PPP P P + P P ++ Sbjct: 254 PYVYKSPPP-PPYVYSSPPPPPYVYKSPPPPPY----VYSSPPPPPYVYSSPPPPPYVYS 308 Query: 704 XXXXXXXXXXXXXXXP-----PXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXK 853 P P PPP PP P P S PP AP K Sbjct: 309 SPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPP----PYVDSYSPPPAPYVYK 359 Score = 37.5 bits (83), Expect = 0.012 Identities = 23/69 (33%), Positives = 28/69 (40%), Gaps = 3/69 (4%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP---FXTPXXXPPQ 562 P P + PPP +PP P P PPP PPPP + +P PP Sbjct: 191 PPPPYVYKSPPPPPYVY----SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP-PPY 245 Query: 563 XPTXPPPXP 589 + PPP P Sbjct: 246 VYSSPPPPP 254 Score = 36.7 bits (81), Expect = 0.022 Identities = 21/67 (31%), Positives = 25/67 (37%), Gaps = 1/67 (1%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXP- 568 P P + PPP PP P + P PP PPPP+ PP Sbjct: 151 PPPPYVYKSPPPPPYVYSP---PPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 207 Query: 569 TXPPPXP 589 + PPP P Sbjct: 208 SSPPPPP 214 Score = 35.9 bits (79), Expect = 0.038 Identities = 22/76 (28%), Positives = 29/76 (38%), Gaps = 3/76 (3%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPP---PFXTPXXXPPQ 562 P P + PPP +PP P + P PPP PPP + +P P Sbjct: 91 PPPPYVYSSPPPPPYVYK----SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 146 Query: 563 XPTXPPPXPXFXLPRP 610 + PPP + P P Sbjct: 147 YSSPPPPPYVYKSPPP 162 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPT--PTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P + PPP P +PP P PPPP PP PP P Sbjct: 140 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPP---PPYVYQSPPPP 183 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/51 (35%), Positives = 21/51 (41%), Gaps = 4/51 (7%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 + P P + PPP P +P PP PPPP PP PP P Sbjct: 128 KSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPP----PPPP 174 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/55 (32%), Positives = 22/55 (40%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 + P P + PPP P +P PP PPPP PPP + P P Sbjct: 108 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPP 162 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +3 Query: 693 FCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 + P PPP +PP P PPP PP PP P Sbjct: 167 YSPPPPPPYVYQSPPPPPYVYSSPPP---PPYVYKSPPPP 203 Score = 32.3 bits (70), Expect = 0.46 Identities = 23/85 (27%), Positives = 28/85 (32%), Gaps = 5/85 (5%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSP-----PPXXPXXPPPPF 535 KPP P + PPP PP + P+P PP PPP Sbjct: 359 KPPPYVYKPPPYVYNYSPPPAPYVYK---PPPYVYSYSPPPAPYVYKPPPYVYSYSPPPA 415 Query: 536 XTPXXXPPQXPTXPPPXPXFXLPRP 610 PP + P P P + P P Sbjct: 416 PYVYKPPPYVYSSPSPPPYYSSPSP 440 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP + P P Sbjct: 80 PPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 132 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP + P P Sbjct: 170 PPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 222 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP + P P Sbjct: 190 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 242 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP + P P Sbjct: 210 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 262 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP + P P Sbjct: 230 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 282 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +2 Query: 491 PSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 PSPPP PP + +P P + PPP + P P Sbjct: 53 PSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPP 92 Score = 31.5 bits (68), Expect = 0.81 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP---TPTPPXXPXXXXPPPP-----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP + P P Sbjct: 150 PPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPP 202 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 + P P + PPP P +P PP PPPP PPP P P Sbjct: 158 KSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 212 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 + P P + PPP P +P PP PPPP PPP P P Sbjct: 198 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 252 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 + P P + PPP P +P PP PPPP PPP P P Sbjct: 218 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 272 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 + P P + PPP P +P PP PPPP PPP P P Sbjct: 238 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 292 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 + P P + PPP P +P PP PPPP PPP P P Sbjct: 258 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPP 312 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/50 (34%), Positives = 20/50 (40%), Gaps = 8/50 (16%) Frame = +3 Query: 687 PXFCPXXPPPXP----TPTPPXXPXXXXPPPPX----XXPPPXXXRPPXP 812 P + PPP P +P PP PPPP PPP + P P Sbjct: 63 PPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPP 112 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/53 (33%), Positives = 20/53 (37%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP P P Sbjct: 70 PPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 122 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/53 (33%), Positives = 20/53 (37%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP P P Sbjct: 90 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 142 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/53 (33%), Positives = 20/53 (37%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP P P Sbjct: 100 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPP 152 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/53 (33%), Positives = 20/53 (37%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPT--PTPPXXPXXXXPPPP------XXXPPPXXXRPPXP 812 P P + PPP P +PP P PPP PPP PP P Sbjct: 120 PPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPP 172 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/53 (33%), Positives = 20/53 (37%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP P P Sbjct: 180 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 232 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/53 (33%), Positives = 20/53 (37%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP P P Sbjct: 250 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPP 302 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +3 Query: 714 PXPTPTPPXXPXXXXPPPP----XXXPPPXXXRPP 806 P PTP P P PPP PPP +PP Sbjct: 29 PTPTPYSPLPPYVYNSPPPYVYNSPSPPPYVYKPP 63 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +3 Query: 684 LPXFCPXXPPPXPTPTPPXXPXXXXPPP---PXXXPPPXXXRPPXP 812 LP + PPP +P P PPP PPP P P Sbjct: 37 LPPYVYNSPPPYVYNSPSPPPYVYKPPPYIYSSPPPPPYVYSSPPP 82 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 44.8 bits (101), Expect = 8e-05 Identities = 27/74 (36%), Positives = 28/74 (37%), Gaps = 2/74 (2%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGG--XX 415 G GGG GG G+ GGGG G GG G GG P GGG Sbjct: 400 GGGGGGGDGGGGQGTGIGGGGGGEQGTGVGGGGDTCTQVTHGGGGAPLTMIGGGGGEQGV 459 Query: 414 PPKRGXXGXGRXGG 373 G G GR GG Sbjct: 460 TGSDGGGGRGRGGG 473 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 GW G G + G G GGGG G G G+G GGG Sbjct: 383 GWGGGGAGAVTQVMQGCG---GGGGGGDGGGGQGTGIGGGGG 421 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/64 (34%), Positives = 25/64 (39%), Gaps = 8/64 (12%) Frame = -2 Query: 588 GXGGGXVGX-------WGGXXXG-VXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXX 433 G GGG G WGG G V + G G GGG+G + G GG Sbjct: 368 GCGGGDAGAITQVMQGWGGGGAGAVTQVMQGCGGGGGGGDGGGGQGTGIGGGGGGEQGTG 427 Query: 432 XGGG 421 GGG Sbjct: 428 VGGG 431 Score = 30.3 bits (65), Expect = 1.9 Identities = 26/75 (34%), Positives = 26/75 (34%), Gaps = 2/75 (2%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXX 430 G GR K G GGG G G GG GGG V GAP P Sbjct: 62 GGGRRKTGDGGGDPVVISGGENHASGGMGGTSATRGGGGEPV-----IPGAPPPNRGGGE 116 Query: 429 G--GGXXPPKRGXXG 391 G PP RG G Sbjct: 117 TVIPGAPPPIRGGGG 131 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GGG GGG G GV GGG G K G Sbjct: 281 GRGGEGREEDNGGGRGAEGGGRGSTGE----GVTDGGGRTGNKGG 321 Score = 28.3 bits (60), Expect = 7.5 Identities = 22/72 (30%), Positives = 23/72 (31%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPP 409 G GGG G G + GG G GGG G GG GG Sbjct: 271 GRGGGGDKTNGRGGEGREEDNGGGRGAEGGGRGSTGEGVTDGGG----RTGNKGGNGGSI 326 Query: 408 KRGXXGXGRXGG 373 K G G GG Sbjct: 327 KIGVGTNGITGG 338 Score = 27.9 bits (59), Expect = 10.0 Identities = 19/64 (29%), Positives = 21/64 (32%), Gaps = 1/64 (1%) Frame = -2 Query: 609 GRGRXKXGXGG-GXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXX 433 G GR + GG G G G GGG G GG G + G G Sbjct: 284 GEGREEDNGGGRGAEGGGRGSTGEGVTDGGGRTGNKGGNGGSIKIGVGTNGITGGTGGGE 343 Query: 432 XGGG 421 G G Sbjct: 344 AGAG 347 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 44.4 bits (100), Expect = 1e-04 Identities = 26/80 (32%), Positives = 28/80 (35%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQX 565 P P P +GG PPP G APP P + P PP PPP Sbjct: 241 PPPQRPPMGGPPPPP----HIGGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPP 296 Query: 566 PTXPPPXPXFXLPRPXXGXG 625 P PP PRP G Sbjct: 297 PYGAPPQNNMGGPRPPQNYG 316 Score = 43.6 bits (98), Expect = 2e-04 Identities = 28/86 (32%), Positives = 32/86 (37%), Gaps = 2/86 (2%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXP--PPPFXT 541 ++PP P P +GG PPP G APP P PPP P PPP+ Sbjct: 244 QRPPMGGPPPPPHIGGSAPPP---PHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPPPYGA 300 Query: 542 PXXXPPQXPTXPPPXPXFXLPRPXXG 619 P P PP P P G Sbjct: 301 PPQNNMGGPR--PPQNYGGTPPPNYG 324 Score = 29.1 bits (62), Expect = 4.3 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 5/55 (9%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPP----XXXPPPXXXRPPXPLXPXXHPG-RHXP 848 P PP P PP PPPP PPP + P P G RH P Sbjct: 242 PPQRPPMGGPPPPPHIGGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPP 296 Score = 27.9 bits (59), Expect = 10.0 Identities = 21/72 (29%), Positives = 22/72 (30%), Gaps = 6/72 (8%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGX-GAPPXPXXRATXPSP-----PPXXPXXPPPPFXTPX 547 P P + G PPP G P P P P PP PP Sbjct: 283 PPPPNNMGGPRHPPPYGAPPQNNMGGPRPPQNYGGTPPPNYGGAPPANNMGGAPPPNYGG 342 Query: 548 XXPPQXPTXPPP 583 PPQ PPP Sbjct: 343 GPPPQYGAVPPP 354 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/50 (42%), Positives = 24/50 (48%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXGR 683 G+ G G+GGR GGG G GG G G G G GG G + GR Sbjct: 28 GYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGR 77 Score = 35.1 bits (77), Expect = 0.066 Identities = 25/75 (33%), Positives = 27/75 (36%), Gaps = 4/75 (5%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKG-GGGXXGXXG---GGEGXVARXXGXGGAPXPXXXXXXGGG 421 G GG + +GG G G GGG G G G G G GG GGG Sbjct: 9 GGGGAPIPSYGGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGG 68 Query: 420 XXPPKRGXXGXGRXG 376 RG G G G Sbjct: 69 YQGGDRGGRGSGGGG 83 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/46 (41%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -1 Query: 820 GXRGWGGRXXXGGG-XXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G+GG GGG GG G G GG G GGG G + G Sbjct: 19 GGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGG 64 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 4/41 (9%) Frame = -1 Query: 820 GXRGWGGRXXXGG----GXXXGGGGXXXXGXXGGVGVGXGG 710 G +GGR GG G GGGG G GG G G GG Sbjct: 43 GGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGG 83 Score = 32.3 bits (70), Expect = 0.46 Identities = 22/50 (44%), Positives = 23/50 (46%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGG 460 GRG G GG G GG G +GGGG G GG G R G GG Sbjct: 38 GRGASGGGSYGGRGGYGGGGGRG-NRGGGGG-GYQGGDRG--GRGSGGGG 83 Score = 31.9 bits (69), Expect = 0.61 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = -2 Query: 618 PXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGG--GXXGXXGGGEGXVARXXGXGG 460 P G G GGG G G GGG G G GGG G R G GG Sbjct: 14 PIPSYGGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGG 68 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G+GG GG GGG G GG G G G G G G Sbjct: 25 GGGGYGGGDAGYGGRGASGGG--SYGGRGGYGGGGGRGNRGGGGG 67 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXG 511 G GR G GGG G GG G GGGG G Sbjct: 56 GGGRGNRGGGGG--GYQGGDRGGRGSGGGGRDG 86 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/40 (42%), Positives = 19/40 (47%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEG 490 GRG G G G G GG G +GG G G GG +G Sbjct: 49 GRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGG--GGRDG 86 Score = 27.9 bits (59), Expect = 10.0 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVG-XGGGXXGQKXG 686 G G GG GGGG G G G G GGG G + G Sbjct: 10 GGGAPIPSYGGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGG 52 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/50 (42%), Positives = 24/50 (48%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXGR 683 G+ G G+GGR GGG G GG G G G G GG G + GR Sbjct: 28 GYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGR 77 Score = 35.1 bits (77), Expect = 0.066 Identities = 25/75 (33%), Positives = 27/75 (36%), Gaps = 4/75 (5%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKG-GGGXXGXXG---GGEGXVARXXGXGGAPXPXXXXXXGGG 421 G GG + +GG G G GGG G G G G G GG GGG Sbjct: 9 GGGGAPIPSYGGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGG 68 Query: 420 XXPPKRGXXGXGRXG 376 RG G G G Sbjct: 69 YQGGDRGGRGSGGGG 83 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/46 (41%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -1 Query: 820 GXRGWGGRXXXGGG-XXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G+GG GGG GG G G GG G GGG G + G Sbjct: 19 GGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGG 64 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 4/41 (9%) Frame = -1 Query: 820 GXRGWGGRXXXGG----GXXXGGGGXXXXGXXGGVGVGXGG 710 G +GGR GG G GGGG G GG G G GG Sbjct: 43 GGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGG 83 Score = 32.3 bits (70), Expect = 0.46 Identities = 22/50 (44%), Positives = 23/50 (46%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGG 460 GRG G GG G GG G +GGGG G GG G R G GG Sbjct: 38 GRGASGGGSYGGRGGYGGGGGRG-NRGGGGG-GYQGGDRG--GRGSGGGG 83 Score = 31.9 bits (69), Expect = 0.61 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = -2 Query: 618 PXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGG--GXXGXXGGGEGXVARXXGXGG 460 P G G GGG G G GGG G G GGG G R G GG Sbjct: 14 PIPSYGGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGG 68 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G+GG GG GGG G GG G G G G G G Sbjct: 25 GGGGYGGGDAGYGGRGASGGG--SYGGRGGYGGGGGRGNRGGGGG 67 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXG 511 G GR G GGG G GG G GGGG G Sbjct: 56 GGGRGNRGGGGG--GYQGGDRGGRGSGGGGRDG 86 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/40 (42%), Positives = 19/40 (47%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEG 490 GRG G G G G GG G +GG G G GG +G Sbjct: 49 GRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGG--GGRDG 86 Score = 27.9 bits (59), Expect = 10.0 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVG-XGGGXXGQKXG 686 G G GG GGGG G G G G GGG G + G Sbjct: 10 GGGAPIPSYGGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGG 52 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 43.6 bits (98), Expect = 2e-04 Identities = 26/78 (33%), Positives = 28/78 (35%), Gaps = 3/78 (3%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATX---PSPPPXXPXXPPPPF 535 + PP P L PPP PP P +T P PPP P PP P Sbjct: 672 RSPPPISNSDKKPALPRPPPPP----------PPPPMQHSTVTKVPPPPPPAPPAPPTPI 721 Query: 536 XTPXXXPPQXPTXPPPXP 589 PP P PPP P Sbjct: 722 VHTSSPPPPPPPPPPPAP 739 Score = 41.9 bits (94), Expect = 6e-04 Identities = 27/74 (36%), Positives = 30/74 (40%), Gaps = 2/74 (2%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXR--ATXPSPPPXXPXXPPPPFXTPX 547 PP P P P++ PPP APP P + S PP P PP T Sbjct: 711 PPAPPAPPTPIVHTSSPPPPPPPPPPP-APPTPQSNGISAMKSSPPAPPA--PPRLPTHS 767 Query: 548 XXPPQXPTXPPPXP 589 PP PT PPP P Sbjct: 768 ASPPP-PTAPPPPP 780 Score = 41.5 bits (93), Expect = 8e-04 Identities = 26/81 (32%), Positives = 28/81 (34%) Frame = +2 Query: 347 KKXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP 526 KK + PP P P PPP APP P + P PPP P P Sbjct: 682 KKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPP---APPTPIVHTSSPPPPPPPPPPPA 738 Query: 527 PPFXTPXXXPPQXPTXPPPXP 589 PP TP PP P Sbjct: 739 PP--TPQSNGISAMKSSPPAP 757 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 PPP P P P P PP PPP PP P Sbjct: 708 PPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTP 742 Score = 36.7 bits (81), Expect = 0.022 Identities = 27/93 (29%), Positives = 28/93 (30%), Gaps = 7/93 (7%) Frame = +3 Query: 564 TPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPPXX 743 T PP P P P G+S P LP PPP P PP Sbjct: 724 TSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPA-PPRLPTHSASPPPPTAPPPPPLG 782 Query: 744 ----PXXXXPPPP---XXXPPPXXXRPPXPLXP 821 P PPPP P PP P P Sbjct: 783 QTRAPSAPPPPPPKLGTKLSPSGPNVPPTPALP 815 Score = 35.5 bits (78), Expect = 0.050 Identities = 21/70 (30%), Positives = 22/70 (31%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P P APP P T + PP PPPP Sbjct: 728 PPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPPPLG--QTR 785 Query: 554 PPQXPTXPPP 583 P P PPP Sbjct: 786 APSAPPPPPP 795 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXX-PPPPXXXPPPXXXRPPXPLXPXXHP 833 PP P P PP P PPPP PPP + P P P Sbjct: 754 PPAP-PAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPP 794 Score = 33.5 bits (73), Expect = 0.20 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 9/59 (15%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPX---------PTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 + P LP P PPP P P PP P P PPP PP P P Sbjct: 682 KKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPP 740 Score = 33.5 bits (73), Expect = 0.20 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXK 853 PP PPPP PP P + PP P P + Sbjct: 728 PPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPR 762 Score = 32.7 bits (71), Expect = 0.35 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P P PP P PPP PP P P H P Sbjct: 684 PALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPP 729 Score = 32.7 bits (71), Expect = 0.35 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P PPP P P PPP PPP PP P+ P Sbjct: 687 PRPPPPPPPPPMQHSTVTKVPPP----PPPAPPAPPTPIVHTSSP 727 Score = 32.3 bits (70), Expect = 0.46 Identities = 23/72 (31%), Positives = 24/72 (33%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTP 544 K PP P P PPP PP P + PS PP PPP T Sbjct: 751 KSSPPAPPAPPRLPTHSASPPPPT------APPPPPLGQTRAPSAPPP----PPPKLGTK 800 Query: 545 XXXPPQXPTXPP 580 P P PP Sbjct: 801 LS--PSGPNVPP 810 Score = 30.3 bits (65), Expect = 1.9 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 10/60 (16%) Frame = +3 Query: 699 PXXPPPXPTP----------TPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P PP PTP +PP P P PPP PP PL P P Sbjct: 733 PPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPP 792 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +2 Query: 752 PXPPPPXXXPPPXPXXAX--PXSXSXXPPGAPXPXKHNSS 865 P PPPP PP P PP P P H SS Sbjct: 687 PRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSS 726 Score = 29.5 bits (63), Expect = 3.3 Identities = 19/61 (31%), Positives = 20/61 (32%), Gaps = 9/61 (14%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXP-------XXXXPPPPXXXP--PPXXXRPPXPLXPXXH 830 P + P PPP P P P P PP P P P PP P P Sbjct: 720 PIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPP 779 Query: 831 P 833 P Sbjct: 780 P 780 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXKHNSS 865 PP PPPP P + S PP P H++S Sbjct: 731 PPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSAS 769 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 758 PPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PPPP PP P S PP P P Sbjct: 707 PPPPPPAPPAPPTPIVHTSSPPPPPPPPPP 736 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/49 (42%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = +3 Query: 708 PPPXPTPTPPXX--PXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PPP +P PP P PPPP PPP PP P+ P P H P Sbjct: 69 PPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISPP--PKVHHP 115 Score = 42.7 bits (96), Expect = 3e-04 Identities = 25/86 (29%), Positives = 29/86 (33%), Gaps = 3/86 (3%) Frame = +2 Query: 359 TXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSP---PPXXPXXPPP 529 T +P P P PPP PP P + P P PP PPP Sbjct: 33 TTNYQPIYSPPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPP 92 Query: 530 PFXTPXXXPPQXPTXPPPXPXFXLPR 607 + P PP P PPP P+ Sbjct: 93 IYPPPIYSPPPTPISPPPKVHHPAPQ 118 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTP-PXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P P PP P P P PPPP PPP PP P+ P Sbjct: 50 PVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYP 95 Score = 36.7 bits (81), Expect = 0.022 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 6/55 (10%) Frame = +3 Query: 687 PXFCPXXPP---PXPTPTPPXX---PXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P + P PP P P PP P PPPP PPP PP P P Sbjct: 38 PIYSPPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPP 92 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 PPP P +PP P PPP PPP PP Sbjct: 67 PPPPPIYSPPPPPIY--PPPIYSPPPPPIYPPP 97 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXKHN 859 PP PPP PPP P P P +P P H+ Sbjct: 78 PPIYPPPIYSPPPPPIYPPPIYSPPPTPISPPPKVHH 114 Score = 31.9 bits (69), Expect = 0.61 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 6/36 (16%) Frame = +2 Query: 521 PPPPFXTPXXXPPQXPTX------PPPXPXFXLPRP 610 PPPP+ +P PP P PPP P + P P Sbjct: 43 PPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPP 78 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/46 (30%), Positives = 16/46 (34%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P PP PPPP P PP P+ P + P Sbjct: 38 PIYSPPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPP 83 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 43.2 bits (97), Expect = 2e-04 Identities = 25/74 (33%), Positives = 25/74 (33%), Gaps = 2/74 (2%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P P PPP G PP P P P PPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPPPK 105 Query: 554 PPQ--XPTXPPPXP 589 PPQ P PP P Sbjct: 106 PPQKNLPRRHPPPP 119 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP 788 P P PPP P P PP P PPPP PPP Sbjct: 35 PPLFPQSPPPPPPPPPPPPP----PPPPPPPPPP 64 Score = 39.1 bits (87), Expect = 0.004 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 500 PPXXPXXPPPPFXTPXXXPPQXPTXPPPXP 589 PP P PPPP P PP P PPP P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 37.1 bits (82), Expect = 0.016 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P P PPP P P PP P PPPP PP P Sbjct: 36 PLFPQSPPPPPPPPPPPPPP--PPPPPPPPPAVNMSVETGIPPPP 78 Score = 36.7 bits (81), Expect = 0.022 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P L P PPP P P PP P PPP PP P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPP 79 Score = 35.9 bits (79), Expect = 0.038 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 732 PPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 PP P PPPP PPP PP P P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 35.5 bits (78), Expect = 0.050 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP PPPP PPP P A S P P P Sbjct: 48 PPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 35.1 bits (77), Expect = 0.066 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP PPPP PPP P P G P P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPP 77 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/52 (34%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT--XPPPXPXFXLPRP 610 P P P PPP P PPPP P T PPP P + +P Sbjct: 36 PLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKP 87 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +2 Query: 458 APPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLP 604 +PP P P PPP P PPPP P PPP P Sbjct: 41 SPPPPPPPPPPPPPPPPPP--PPPPPAVNMSVETGIPPPPPPVTDMIKP 87 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPP---PXXXPPPXXXRPPXPLXPXXHP 833 PPP P T P PPP P PPP +PP P HP Sbjct: 75 PPPPPPVTDMIKPLSSPPPPQPPPRSQPPP---KPPQKNLPRRHP 116 Score = 31.9 bits (69), Expect = 0.61 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 9/64 (14%) Frame = +2 Query: 425 PPXXXXXXGXGAPPXPXXRATXPSPPPXXP---------XXPPPPFXTPXXXPPQXPTXP 577 PP PP P P PPP P PPPP T P P P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPP 94 Query: 578 PPXP 589 P P Sbjct: 95 QPPP 98 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/62 (30%), Positives = 21/62 (33%), Gaps = 6/62 (9%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPP------PFXTPXXXPPQXPTXPPP 583 PPP PP P A S P PPP P +P P + PPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPPP 104 Query: 584 XP 589 P Sbjct: 105 KP 106 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXKHN 859 PP PPP PPP P PP +P K + Sbjct: 92 PPPQPPPRSQPPPKPPQKNLPRRHPPPPRSPEKPKRD 128 Score = 30.7 bits (66), Expect = 1.4 Identities = 22/88 (25%), Positives = 23/88 (26%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPP 737 P P PP P P P G P P P +P PP Sbjct: 36 PLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKP-LSSPPPP 94 Query: 738 XXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P PPP PP P P Sbjct: 95 QPPPRSQPPPKPPQKNLPRRHPPPPRSP 122 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXKHNSS 865 PP PPPP PPP + PP K SS Sbjct: 52 PPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSS 90 Score = 29.1 bits (62), Expect = 4.3 Identities = 20/83 (24%), Positives = 23/83 (27%), Gaps = 1/83 (1%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXL-PXFCPXXPPPXPTPTP 734 P P PP P P P +S + P P P P P P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQP 102 Query: 735 PXXPXXXXPPPPXXXPPPXXXRP 803 P P P PP +P Sbjct: 103 PPKPPQKNLPRRHPPPPRSPEKP 125 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P P PPP P P P PP P +P P P R P Sbjct: 46 PPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQP 102 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 PPP P PP P PP P PPP RPP P P Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPP-PAPP 301 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +2 Query: 428 PXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXP 589 P G APP P A P PPP P P PP PP PPP P Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPP-------PPPKIARPPPAP 300 Score = 35.9 bits (79), Expect = 0.038 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 2/59 (3%) Frame = +2 Query: 455 GAPPX--PXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXG 625 G PP P R+ P PP P PPP PP PPP P P P G Sbjct: 252 GLPPLKLPPGRSAPPPPPAAAPPPQPPP-------PPPPKPQPPPPPKIARPPPAPPKG 303 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = +3 Query: 699 PXXPP---PXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P PP P P P PP P PPPP PP PP P Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPP--PAPPKGAAP 306 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 PP P PP P PP P PPP PP P Sbjct: 259 PPGRSAPPPP--PAAAPPPQPPPPPPPKPQPPPPP 291 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAP 841 PP PPPP PPP P P + PP P Sbjct: 274 PPQPPPP---PPPKPQPPPPPKIARPPPAPP 301 Score = 32.3 bits (70), Expect = 0.46 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P P PP P P P P PPP PPP + P Sbjct: 266 PPPPAAAPPPQPPPPPPPKPQPP----PPPKIARPPPAPPKGAAP 306 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 758 PPPPXXXPPPXPXXAXPXSXSXXPP 832 PPPP PPP P P PP Sbjct: 266 PPPPAAAPPPQPPPPPPPKPQPPPP 290 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 749 PPXP-PPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP PP PPP P A P PP P P Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQP 287 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P PP + PP P PP PPP +PP P Sbjct: 255 PLKLPPGRSAPPPPPAAAPPPQPP--PPPPPKPQPPPP 290 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP 532 P L G PP PP P P PPP PP P Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAP 300 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPP 502 K PP R P P P P PP P P+PP Sbjct: 257 KLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPP 301 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 744 PXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P PPPP PP PP P P P Sbjct: 260 PGRSAPPPPPAAAPPPQPPPPPPPKPQPPP 289 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +2 Query: 410 GGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP 532 G PPP PP P + P PP P PP Sbjct: 261 GRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPP 301 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/39 (33%), Positives = 15/39 (38%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXKHNSS 865 P PPPP P P P P GA + N+S Sbjct: 275 PQPPPPPPPKPQPPPPPKIARPPPAPPKGAAPKRQGNTS 313 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/53 (39%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPPPP---FXTPXXXPPQXPTXPPPXPXFXLPRP 610 PP P PSP P PPPP + TP PP+ P PPP P P Sbjct: 71 PPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPR-PLPPPPPPPLHFSSP 122 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP 532 PP P P P PPP PP P PSPPP P PPPP Sbjct: 65 PPQTPPPPPPPQS--LPPPSPSPEPEH-YPPPPYHHYITPSPPPPRPLPPPPP 114 Score = 37.1 bits (82), Expect = 0.016 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 6/55 (10%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQX------PTXPPPXPXFXLPRP 610 P P T P PPP PP P P PP P+ PPP P P P Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPPP 115 Score = 36.3 bits (80), Expect = 0.028 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT--XPPPXPXFXLPRP 610 P P P PPP P PPPP P P P PPP + P P Sbjct: 54 PEPEDYLPLP-PPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSP 103 Score = 35.9 bits (79), Expect = 0.038 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXX-PPPPXXXPPPXXXRPPXPLXPXXHPGRH 842 P P P PPP P P P PPPP PP PL P P H Sbjct: 63 PPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPPPPLH 118 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +2 Query: 752 PXPPPPX-XXPPPXPXXAXPXSXSXXPPGAPXPXKHN 859 P PPPP PPP P P S S P P P H+ Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHH 97 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/43 (32%), Positives = 17/43 (39%) Frame = +3 Query: 720 PTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P+P PPPP PPP + P P P + P Sbjct: 50 PAPSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPP 92 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 P P P TPP P PPP P P PP Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPP 93 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +2 Query: 482 ATXPSPPPXXPXXPPPPFXTPXXXPPQ--XPTXPPPXPXFXLPRP 610 A P P P PPPP P PPQ P P P P P P Sbjct: 51 APSPEPEDYLP-LPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPP 94 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P P P PP PPPP PPP P P Sbjct: 52 PSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPP 92 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 42.7 bits (96), Expect = 3e-04 Identities = 25/83 (30%), Positives = 29/83 (34%), Gaps = 4/83 (4%) Frame = +2 Query: 374 PPXRPXPXX-PLLGGXXPPPXXXXXXGXGAP---PXPXXRATXPSPPPXXPXXPPPPFXT 541 P P P P++ PPP AP P P P+ PP P PPP + Sbjct: 79 PTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPAS 138 Query: 542 PXXXPPQXPTXPPPXPXFXLPRP 610 P P P P P P P Sbjct: 139 PPPAPASPPPAPVSPPPVQAPSP 161 Score = 42.7 bits (96), Expect = 3e-04 Identities = 23/77 (29%), Positives = 27/77 (35%) Frame = +2 Query: 359 TXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFX 538 T +PP P P + PPP PP P P+ PP P PPP Sbjct: 95 TPPPQPPQSPPASAPTVS---PPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPV 151 Query: 539 TPXXXPPQXPTXPPPXP 589 +P P PP P Sbjct: 152 SPPPVQAPSPISLPPAP 168 Score = 42.3 bits (95), Expect = 4e-04 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 3/60 (5%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXP---PPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P P P P P PP P P PPP PP PP P P P P Sbjct: 82 PPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPP 141 Score = 41.5 bits (93), Expect = 8e-04 Identities = 26/82 (31%), Positives = 28/82 (34%), Gaps = 2/82 (2%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTP-- 544 +PP P P + PP A P P SPP P PPP P Sbjct: 65 QPPASPVTPPPAVTPTSPPAPKVAPVISPATPPP---QPPQSPPASAPTVSPPPVSPPPA 121 Query: 545 XXXPPQXPTXPPPXPXFXLPRP 610 PP P PPP P P P Sbjct: 122 PTSPPPTPASPPPAPASPPPAP 143 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/79 (29%), Positives = 26/79 (32%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP +P P PP PP P P+ PP P PPP +P Sbjct: 96 PPPQPPQSPPASAPTVSPPPV------SPPPAPTSPPPTPASPPPAPASPPPAPASPPPA 149 Query: 554 PPQXPTXPPPXPXFXLPRP 610 P P P P P P Sbjct: 150 PVSPPPVQAPSPISLPPAP 168 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/88 (26%), Positives = 27/88 (30%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPP 737 P +P+ PP P P +S P P P P PT P Sbjct: 67 PASPVTPPPAVTPTSP-PAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSP 125 Query: 738 XXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 PP P PP PP P+ P Sbjct: 126 PPTPASPPPAPASPPPAPASPPPAPVSP 153 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXX----PXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P P PPP P PP P PPP PPP P L P P Sbjct: 115 PVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAPAP 170 Score = 37.5 bits (83), Expect = 0.012 Identities = 32/136 (23%), Positives = 36/136 (26%), Gaps = 5/136 (3%) Frame = +2 Query: 455 GAPPXPXXRATXPSPP----PXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPR-PXXG 619 G P T PP P PPP TP Q P P P P P Sbjct: 26 GPAASPVTSTTTAPPPTTAAPPTTAAPPPTTTTPPVSAAQPPASPVTPPPAVTPTSPPAP 85 Query: 620 XGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXPPPXPXX 799 + + P + + P PPP PPP P Sbjct: 86 KVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPAS 145 Query: 800 AXPXSXSXXPPGAPXP 847 P S P AP P Sbjct: 146 PPPAPVSPPPVQAPSP 161 Score = 37.1 bits (82), Expect = 0.016 Identities = 36/145 (24%), Positives = 39/145 (26%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXL 601 PPP APP + P PPP TP PP P P Sbjct: 39 PPPTTAAPPTTAAPPPTTTTPPVSAAQPPASPVTPPPAVTPTS-PPAPKVAPVISPATPP 97 Query: 602 PRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXP 781 P+P P P+ P PPP Sbjct: 98 PQPPQSPPASA-----PTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVS 152 Query: 782 PPXPXXAXPXSXSXXPPGAPXPXKH 856 PP P A P S P AP P KH Sbjct: 153 PP-PVQA-PSPISLPPAPAPAPTKH 175 Score = 36.7 bits (81), Expect = 0.022 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPT---PTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRH 842 P P P PPP P P P P PPP P P P P H +H Sbjct: 122 PTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAPAPAPTKHKRKH 179 Score = 32.7 bits (71), Expect = 0.35 Identities = 24/82 (29%), Positives = 25/82 (30%), Gaps = 3/82 (3%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP---PPFXTP 544 PP P P + PP P P P P P P PP P Sbjct: 52 PP--PTTTTPPVSAAQPPASPVTPPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAP 109 Query: 545 XXXPPQXPTXPPPXPXFXLPRP 610 PP P PPP P P P Sbjct: 110 TVSPP--PVSPPPAPTSPPPTP 129 Score = 32.7 bits (71), Expect = 0.35 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 P P PPP TPT P P P PP PP Sbjct: 66 PPASPVTPPPAVTPTSPPAPKVAPVISPATPPPQPPQSPP 105 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/62 (27%), Positives = 19/62 (30%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 P P P P PPP A P P + P+P P P P P Sbjct: 109 PTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAP 168 Query: 554 PP 559 P Sbjct: 169 AP 170 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/57 (29%), Positives = 17/57 (29%), Gaps = 2/57 (3%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPT--PTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRH 842 P P P PPP P P P P P P PP P H H Sbjct: 129 PASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAPAPAPTKHKRKHKHKRHH 185 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 42.7 bits (96), Expect = 3e-04 Identities = 30/95 (31%), Positives = 32/95 (33%), Gaps = 3/95 (3%) Frame = +2 Query: 359 TXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFX 538 T + PP + P P PP P P AT PP P PP PF Sbjct: 145 TNPESPPLQSPPAPPASDPTNSPPASPLDPTNPPPIQPSGPAT---SPPANPNAPPSPFP 201 Query: 539 T-PXXXPPQXPTXPP--PXPXFXLPRPXXGXGXGG 634 T P P P P P P P G G GG Sbjct: 202 TVPPKTPSSGPVVSPSLTSPSKGTPTPNQGNGDGG 236 Score = 34.7 bits (76), Expect = 0.087 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQ---XPTXPPP 583 PPP + P P T P PP P PP P PP PT PPP Sbjct: 124 PPPSQDLQSPPPSSPSPNVGPTNPESPPLQS-PPAPPASDPTNSPPASPLDPTNPPP 179 Score = 32.7 bits (71), Expect = 0.35 Identities = 21/71 (29%), Positives = 22/71 (30%), Gaps = 2/71 (2%) Frame = +2 Query: 377 PXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXP 556 P P PL PP P P PSPP P PP + P Sbjct: 65 PPLPSILPPLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPPNESNDNNP 124 Query: 557 P--QXPTXPPP 583 P Q PPP Sbjct: 125 PPSQDLQSPPP 135 Score = 32.3 bits (70), Expect = 0.46 Identities = 20/71 (28%), Positives = 23/71 (32%) Frame = +2 Query: 377 PXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXP 556 P P P PP +PP P + SPP PPPP P Sbjct: 50 PPLSEPSTPPPDSQLPPLPSILPPLTDSPPPP----SDSSPPVDSTPSPPPPTSNESPSP 105 Query: 557 PQXPTXPPPXP 589 P+ PP P Sbjct: 106 PEDSETPPAPP 116 Score = 31.5 bits (68), Expect = 0.81 Identities = 18/65 (27%), Positives = 20/65 (30%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQX 565 P P P PP PP P + +PPP PPP P Sbjct: 92 PSPPPPTSNESPSPPEDSE-----TPPAPPNESNDNNPPPSQDLQSPPPSSPSPNVGPTN 146 Query: 566 PTXPP 580 P PP Sbjct: 147 PESPP 151 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P P PT +PP P PPP P P P P Sbjct: 156 PAPPASDPTNSPPASPLDPTNPPPIQPSGPATSPPANPNAP 196 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P P PT P P PP P P P PL P P Sbjct: 135 PSSPSPNVGPTNPESPPLQSPPAPPASDPTNSP-PASPLDPTNPP 178 Score = 28.7 bits (61), Expect = 5.7 Identities = 21/72 (29%), Positives = 22/72 (30%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P PP PP PS P PPPP + Sbjct: 33 PPVDSSPPSPPADSSSTPPLSEP----STPPPDSQLPPLPSILPPLTDSPPPPSDSS--- 85 Query: 554 PPQXPTXPPPXP 589 PP T PP P Sbjct: 86 PPVDSTPSPPPP 97 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 752 PXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 P PPP PP P P + S PP P Sbjct: 55 PSTPPPDSQLPPLPSILPPLTDSPPPPSDSSP 86 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 6/51 (11%) Frame = +3 Query: 678 PXLPXFCPXX---PPPXPTPTPPXXPXXXXPPP---PXXXPPPXXXRPPXP 812 P LP P PPP +PP PPP PP PP P Sbjct: 65 PPLPSILPPLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAP 115 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/57 (29%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXT-PXXXPPQXPTXPPPXP 589 PP G P P ++ P+PP P PP P PP P+ P P Sbjct: 134 PPSSPSPNVGPTNPESPPLQSP-PAPPASDPTNSPPASPLDPTNPPPIQPSGPATSP 189 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P P PP +P P P P P PP PP P Sbjct: 156 PAPPASDPTNSPPA-SPLDPTNPPPIQPSGPATSPPANPNAPPSP 199 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = +2 Query: 458 APPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPP 583 APP P + + PP P PP + P P+ PPP Sbjct: 20 APP-PETPSENSALPPVDSSPPSPPADSSSTPPLSEPSTPPP 60 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 42.3 bits (95), Expect = 4e-04 Identities = 24/63 (38%), Positives = 24/63 (38%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXX 430 G G G GGG G GG G GG G G GGG G G GG Sbjct: 159 GYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSG 218 Query: 429 GGG 421 GGG Sbjct: 219 GGG 221 Score = 41.5 bits (93), Expect = 8e-04 Identities = 43/157 (27%), Positives = 44/157 (28%), Gaps = 3/157 (1%) Frame = -2 Query: 831 GGXXXXEXGXAXXGXGGGXXXGGGGXGGXXXXXXXXXXXXXXXXGKKXEGXGXXRXXXXX 652 GG G G G G GGGG GG G G G Sbjct: 90 GGGGAASSGGYASGAGEG---GGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYG 146 Query: 651 XXXXGRPPXPXPXXGRGRXKXGXG---GGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVA 481 G G G G GG G GG G GGG G GGG A Sbjct: 147 NGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGA 206 Query: 480 RXXGXGGAPXPXXXXXXGGGXXPPKRGXXGXGRXGGF 370 G GG GGG G G GG+ Sbjct: 207 GGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGY 243 Score = 41.1 bits (92), Expect = 0.001 Identities = 39/146 (26%), Positives = 41/146 (28%) Frame = -2 Query: 807 GXAXXGXGGGXXXGGGGXGGXXXXXXXXXXXXXXXXGKKXEGXGXXRXXXXXXXXXGRPP 628 G G GG GGGG G G G Sbjct: 109 GGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGG 168 Query: 627 XPXPXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXP 448 G G G GG G GG G GGGG G GG G G GGA Sbjct: 169 GGHGGGGGGGSAGGAHGGS-GYGGGEGGGA--GGGGSHGGAGGYGGGGGGGSGGGGAYGG 225 Query: 447 XXXXXXGGGXXPPKRGXXGXGRXGGF 370 G G + G G G GG+ Sbjct: 226 GGAHGGGYGSGGGEGGGYGGGAAGGY 251 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/49 (42%), Positives = 22/49 (44%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G+GG GGG GGGG G G G G GGG G G Sbjct: 152 GGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHG-GSGYGGGEGGGAGG 199 Score = 38.7 bits (86), Expect = 0.005 Identities = 28/82 (34%), Positives = 29/82 (35%), Gaps = 3/82 (3%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXX---GGGEGXVARXXGXGGAPXPXXX 439 G G G GG G GG G GGGG G GGGEG GG Sbjct: 198 GGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGG 257 Query: 438 XXXGGGXXPPKRGXXGXGRXGG 373 GGG + G G GG Sbjct: 258 GEGGGGSYGGEHGGGSGGGHGG 279 Score = 38.3 bits (85), Expect = 0.007 Identities = 35/140 (25%), Positives = 36/140 (25%) Frame = -2 Query: 831 GGXXXXEXGXAXXGXGGGXXXGGGGXGGXXXXXXXXXXXXXXXXGKKXEGXGXXRXXXXX 652 GG G G GGG GGGG G Sbjct: 153 GGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGG 212 Query: 651 XXXXGRPPXPXPXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXX 472 G G GGG G +GG G GGGG G GGG Sbjct: 213 GGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGG--GGEGGGGSYGGEHG 270 Query: 471 GXGGAPXPXXXXXXGGGXXP 412 G G GGG P Sbjct: 271 GGSGGGHGGGGGHGGGGYAP 290 Score = 38.3 bits (85), Expect = 0.007 Identities = 39/144 (27%), Positives = 39/144 (27%) Frame = -2 Query: 807 GXAXXGXGGGXXXGGGGXGGXXXXXXXXXXXXXXXXGKKXEGXGXXRXXXXXXXXXGRPP 628 G G GGG GGGG GG G EG G Sbjct: 154 GAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGG-GEGGGAGGGGSHGGAGGY--- 209 Query: 627 XPXPXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXP 448 G G GGG G G G GGG G GG G G G Sbjct: 210 ------GGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGG 263 Query: 447 XXXXXXGGGXXPPKRGXXGXGRXG 376 GGG G G G G Sbjct: 264 SYGGEHGGGSGGGHGGGGGHGGGG 287 Score = 37.9 bits (84), Expect = 0.009 Identities = 42/156 (26%), Positives = 42/156 (26%), Gaps = 3/156 (1%) Frame = -2 Query: 831 GGXXXXEXGXAXXGXGGGXXXGGG---GXGGXXXXXXXXXXXXXXXXGKKXEGXGXXRXX 661 GG G G GGG GGG G GG G G G Sbjct: 109 GGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGG 168 Query: 660 XXXXXXXGRPPXPXPXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVA 481 G G G G GG G G GGGG G GGG Sbjct: 169 GGHGGGGGGGSAGGAHGGSGYG--GGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGG 226 Query: 480 RXXGXGGAPXPXXXXXXGGGXXPPKRGXXGXGRXGG 373 G G GGG G G G GG Sbjct: 227 GAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGG 262 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G G+ G G GG GGG GG G GG G G GGG Sbjct: 154 GAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGG 200 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GGG GGGG G G G G GGG G G Sbjct: 201 GSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGG 245 Score = 36.7 bits (81), Expect = 0.022 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXX--GGVGVGXGGGXXGQKXG 686 G G GG GGG GGGG G GG G G GGG G G Sbjct: 207 GGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGG 253 Score = 36.7 bits (81), Expect = 0.022 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGG--GGXXXXGXXGGVGVGXGGGXXG 698 G G +GG GGG GG GG G GG G G GGG G Sbjct: 215 GGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGG 261 Score = 36.3 bits (80), Expect = 0.028 Identities = 23/72 (31%), Positives = 24/72 (33%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPP 409 G GGG GG G +GGGG G GG G GG G G Sbjct: 88 GGGGGGAASSGGYASGAGEGGGGGYGGAAGGHA-----GGGGGGSGGGGGSAYGAGGEHA 142 Query: 408 KRGXXGXGRXGG 373 G G GG Sbjct: 143 SGYGNGAGEGGG 154 Score = 36.3 bits (80), Expect = 0.028 Identities = 27/80 (33%), Positives = 28/80 (35%), Gaps = 1/80 (1%) Frame = -2 Query: 609 GRGRXKXGXGG-GXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXX 433 G G G G G G +GG G GGGG G G G G GG Sbjct: 192 GEGGGAGGGGSHGGAGGYGGGGGG-GSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGG 250 Query: 432 XGGGXXPPKRGXXGXGRXGG 373 GGG G G G GG Sbjct: 251 YGGGGG---GGEGGGGSYGG 267 Score = 35.9 bits (79), Expect = 0.038 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G GG GGG GGG G GG G G GG G G Sbjct: 213 GGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGG 257 Score = 35.1 bits (77), Expect = 0.066 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G GG GGG G GG G G G G G G G G Sbjct: 122 GGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGG 163 Score = 34.7 bits (76), Expect = 0.087 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G G GGG G GG G GG G G GGG G Sbjct: 182 GAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGG 219 Score = 34.3 bits (75), Expect = 0.11 Identities = 23/71 (32%), Positives = 24/71 (33%) Frame = -1 Query: 919 GGXFWGGXXXXXXXXXXXXGIVFXGXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGX 740 GG + GG G G G G G GG GG GGGG G Sbjct: 162 GGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGG 221 Query: 739 XGGVGVGXGGG 707 G G GGG Sbjct: 222 AYGGGGAHGGG 232 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G G G G+GG G G GG G GG G G GG G Sbjct: 176 GGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGG 225 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G+G GGG G G G GG G G GGG G G Sbjct: 144 GYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHG 185 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G G GG GGG G GG G GG G G GGG Sbjct: 221 GAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGG 262 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GGG GGGG G G G GG G G Sbjct: 150 GEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEG 194 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G G G GGG G GG G G GG G+ G Sbjct: 227 GAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGG 271 Score = 32.7 bits (71), Expect = 0.35 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G G GGG GGGG GG G G GGG Sbjct: 246 GAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGG 280 Score = 31.5 bits (68), Expect = 0.81 Identities = 24/79 (30%), Positives = 25/79 (31%), Gaps = 2/79 (2%) Frame = -2 Query: 603 GRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGG 424 G+ G G G G GG G G G G GEG G G GG Sbjct: 31 GQASGGGGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGG 90 Query: 423 GXXPPKRG--XXGXGRXGG 373 G G G G GG Sbjct: 91 GGGAASSGGYASGAGEGGG 109 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/72 (30%), Positives = 23/72 (31%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPP 409 G GG G +GG G GGG G GG G G G G Sbjct: 44 GSGGVSSGGYGGESGG-GYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYAS 102 Query: 408 KRGXXGXGRXGG 373 G G G GG Sbjct: 103 GAGEGGGGGYGG 114 Score = 31.5 bits (68), Expect = 0.81 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G + G G G GG GGG G G G GG G G GGG Sbjct: 241 GGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGG-GGGHGGG 286 Score = 31.1 bits (67), Expect = 1.1 Identities = 23/78 (29%), Positives = 24/78 (30%), Gaps = 1/78 (1%) Frame = -2 Query: 603 GRXKXGXGGG-XVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXG 427 G G GGG G GG GG G GGG G + GA G Sbjct: 55 GESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGG 114 Query: 426 GGXXPPKRGXXGXGRXGG 373 G G G GG Sbjct: 115 AAGGHAGGGGGGSGGGGG 132 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = -1 Query: 853 FXGXWRPGWXXGXRGWGGRXXXGGGXXXGGGG--XXXXGXXGGVGVGXGGGXXGQKXG 686 + G G G G G GG GGGG G G G G GGG G G Sbjct: 61 YGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGG 118 Score = 31.1 bits (67), Expect = 1.1 Identities = 24/78 (30%), Positives = 24/78 (30%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXX 430 G G G GG G G G GGGG G G A G GG Sbjct: 64 GSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASG--AGEGGGGGYGGAAGGHAG 121 Query: 429 GGGXXPPKRGXXGXGRXG 376 GGG G G G Sbjct: 122 GGGGGSGGGGGSAYGAGG 139 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GG GG G G G G G GGG G G Sbjct: 82 GGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGG 130 Score = 30.7 bits (66), Expect = 1.4 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 6/55 (10%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXG------GVGVGXGGGXXGQKXG 686 G G G G GGG GGGG G G G G G GGG G Sbjct: 107 GGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYG 161 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G GG G GGGG G G G GGG G G Sbjct: 238 GEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGG 279 Score = 30.7 bits (66), Expect = 1.4 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGG--GXXXXGXXGGVGVGXGGGXXG 698 G G GG GGG GGG G G GG G G GGG G Sbjct: 240 GGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGG-GHGGGGGHGG 285 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 805 GGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 GG G G GGG G G G G GGG G Sbjct: 58 GGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGG 93 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXG-GGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G G G G GGG G GG G GGG G G Sbjct: 175 GGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGG 220 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGV-GXGGGXXGQKXG 686 G G G GG G G G G GG G G GGG G G Sbjct: 121 GGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGG 170 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G GG G G G GG GG G GGG G G Sbjct: 136 GAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGG 177 Score = 29.9 bits (64), Expect = 2.5 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 4/58 (6%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXX--GGGXXXG--GGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G + G G G GG GG G GGG G GG G G GGG G G Sbjct: 163 GAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAG-GYGGGGGGGSGG 219 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G+GG G G GG G GG G G GGG G Sbjct: 60 GYGGGSGEGAGGGYGGAEGYASG--GGSGHGGGGGGAASSGG 99 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGG 710 G G GG GG GGGG G GG G GG Sbjct: 105 GEGGGGGYGGAAGGHAGGGGG--GSGGGGGSAYGAGG 139 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GGG GGG G GG G GG G G Sbjct: 238 GEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGGG 286 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 781 GXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G GGGG G GGV G GG G G Sbjct: 31 GQASGGGGHGGGGGSGGVSSGGYGGESGGGYG 62 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 6/41 (14%) Frame = -1 Query: 802 GRXXXGGGXXXGG------GGXXXXGXXGGVGVGXGGGXXG 698 G GGG GG GG G GG G G GGG G Sbjct: 35 GGGGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGG 75 Score = 28.3 bits (60), Expect = 7.5 Identities = 26/89 (29%), Positives = 27/89 (30%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXGRXXXXXXXXXX 653 G+ G G G GG GGG G GG G GGG G G Sbjct: 188 GYGGGEGGGAGGGGSHGGAGGYGGG--GGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGG 245 Query: 652 XXXXGETPXPXXPXGXGXXKXGXXGGXSG 566 G G G G GG SG Sbjct: 246 GAAGGYGGGGGGGEGGGGSYGGEHGGGSG 274 Score = 27.9 bits (59), Expect = 10.0 Identities = 24/79 (30%), Positives = 25/79 (31%) Frame = -2 Query: 606 RGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXG 427 R G G G GG G GG G GGG G G GG G Sbjct: 25 RNLLNYGQASGGGGHGGGGGSG-GVSSGGYGGESGGGYGG-GSGEGAGGGYGGAEGYASG 82 Query: 426 GGXXPPKRGXXGXGRXGGF 370 GG G G GG+ Sbjct: 83 GGSG-HGGGGGGAASSGGY 100 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 42.3 bits (95), Expect = 4e-04 Identities = 38/147 (25%), Positives = 40/147 (27%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP +P P P PP PP P + P P PP P P Sbjct: 45 PPPQPDPQPPT-----PPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPL-PPPLS 98 Query: 554 PPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXX 733 PPQ T PPP P P P P P Sbjct: 99 PPQ--TTPPPPPAITPPPP--------------PAITPPLSPPPPAITPPPPLATTPPAL 142 Query: 734 XXXXXPPXPPPPXXXPPPXPXXAXPXS 814 PP PP PPP P P S Sbjct: 143 PPKPLPPPLSPPQTTPPPPPAITPPLS 169 Score = 42.3 bits (95), Expect = 4e-04 Identities = 25/78 (32%), Positives = 27/78 (34%), Gaps = 3/78 (3%) Frame = +2 Query: 359 TXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRA---TXPSPPPXXPXXPPP 529 T + PP P P PPP P P + T P PPP PPP Sbjct: 58 TFQPAPPANDQPPPPPQS-TSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPP 116 Query: 530 PFXTPXXXPPQXPTXPPP 583 P PP T PPP Sbjct: 117 AITPPLSPPPPAITPPPP 134 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXPXNT 857 P P PP P PP PPPP PPP P L P P P T Sbjct: 100 PQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQT 156 Score = 40.7 bits (91), Expect = 0.001 Identities = 25/83 (30%), Positives = 26/83 (31%), Gaps = 3/83 (3%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXX---PPPPFXT 541 +PP P PPP P P PPP P PPPP T Sbjct: 52 QPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAIT 111 Query: 542 PXXXPPQXPTXPPPXPXFXLPRP 610 P P P PP P P P Sbjct: 112 PPPPPAITPPLSPPPPAITPPPP 134 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/49 (42%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXX--PPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PPP P TPP P PPPP PP PP PL P P + P Sbjct: 112 PPPPPAITPPLSPPPPAITPPPPLATTPPAL--PPKPLPPPLSPPQTTP 158 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/63 (34%), Positives = 23/63 (36%), Gaps = 6/63 (9%) Frame = +3 Query: 678 PXLPXFC---PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXR---PPXPLXPXXHPGR 839 P P C P PPP P P PP P PP PPP PP P P + Sbjct: 32 PPPPCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPK 91 Query: 840 HXP 848 P Sbjct: 92 PLP 94 Score = 37.9 bits (84), Expect = 0.009 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPP 737 P P P P P P P LP P PP P T P Sbjct: 46 PPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPK-PLPPPLSPPQTTP 104 Query: 738 XXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P PPPP PP PP P Sbjct: 105 PPPPAITPPPPPAITPPLSPPPPAITPP 132 Score = 36.7 bits (81), Expect = 0.022 Identities = 34/136 (25%), Positives = 36/136 (26%), Gaps = 7/136 (5%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXG--- 631 PP P P PPP P PP T PP PPP P P P Sbjct: 32 PPPPCICICNPGPPPPQPDPQPPTPPTFQPAPPAN-DQPPPPPQSTSPPPVATTPPALPP 90 Query: 632 GLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPP----PPXXXPPPXPXX 799 P P+ P PP PP P P P Sbjct: 91 KPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPP 150 Query: 800 AXPXSXSXXPPGAPXP 847 P + PP A P Sbjct: 151 LSPPQTTPPPPPAITP 166 Score = 36.3 bits (80), Expect = 0.028 Identities = 28/94 (29%), Positives = 30/94 (31%), Gaps = 11/94 (11%) Frame = +3 Query: 567 PLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPP-PXPTP----- 728 P PP P P P + P + P PP P P P Sbjct: 42 PGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQ 101 Query: 729 -TPPXXPXXXXPPP----PXXXPPPXXXRPPXPL 815 TPP P PPP P PPP PP PL Sbjct: 102 TTPPPPPAITPPPPPAITPPLSPPPPAITPPPPL 135 Score = 35.1 bits (77), Expect = 0.066 Identities = 22/57 (38%), Positives = 23/57 (40%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P F P PP P PP P PPP PP PP PL P P + P Sbjct: 54 PTPPTFQPA-PPANDQPPPP--PQSTSPPPVATTPPAL---PPKPLPPPLSPPQTTP 104 Score = 35.1 bits (77), Expect = 0.066 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P PP P P PP P PPPP PP PP + P P Sbjct: 85 PPALPPKPLP-PPLSPPQTTPPPPPAITPP----PPPAITPPLSP 124 Score = 35.1 bits (77), Expect = 0.066 Identities = 18/39 (46%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +3 Query: 708 PPPXPTPT-PPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P P PT + PP P PPPP PPP P PL P Sbjct: 254 PGPSPTISPPPLPPQTLKPPPPQTTPPPPPAITP-PLSP 291 Score = 34.7 bits (76), Expect = 0.087 Identities = 21/70 (30%), Positives = 22/70 (31%), Gaps = 3/70 (4%) Frame = +2 Query: 359 TXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP---XXPPP 529 T PP P P + PP P P PPP P PPP Sbjct: 102 TTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPP 161 Query: 530 PFXTPXXXPP 559 P TP PP Sbjct: 162 PAITPPLSPP 171 Score = 34.3 bits (75), Expect = 0.11 Identities = 25/74 (33%), Positives = 26/74 (35%), Gaps = 4/74 (5%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPP--PX--XXPPPXXXRPPXPLXPXXHPGRHXPXNTIXXXXX 875 PPP T TPP P PPP P PPP PP P P P P I Sbjct: 78 PPPVAT-TPPALPPKPLPPPLSPPQTTPPPPPAITPPPP--PAITPPLSPPPPAITPPPP 134 Query: 876 XXXXXXXXPPQKXP 917 PP+ P Sbjct: 135 LATTPPALPPKPLP 148 Score = 33.5 bits (73), Expect = 0.20 Identities = 27/93 (29%), Positives = 28/93 (30%), Gaps = 1/93 (1%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXP-TPTP 734 P PL PP P P P P L P PP P TP Sbjct: 89 PPKPLPPPLSPPQTTPPPP---------PAITPPPPPAITPPLSPPPPAITPPPPLATTP 139 Query: 735 PXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P PPP PP PP + P P Sbjct: 140 PALPPKPLPPP--LSPPQTTPPPPPAITPPLSP 170 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/45 (40%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = +3 Query: 693 FCPXXPP----PXPTPTPPXXPXXXXPPPPXXXP-PPXXXRPPXP 812 +CP PP P P PP P P PP P PP +PP P Sbjct: 29 YCPPPPPCICICNPGP-PPPQPDPQPPTPPTFQPAPPANDQPPPP 72 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +2 Query: 494 SPPPXXP--XXPPPPFXTPXXXPPQXPTXPPP 583 SPPP P PPPP TP P P PP Sbjct: 261 SPPPLPPQTLKPPPPQTTPPPPPAITPPLSPP 292 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 494 SPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLP 604 S P P PPP PP T PPP P P Sbjct: 252 SCPGPSPTISPPPLPPQTLKPPPPQTTPPPPPAITPP 288 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +2 Query: 458 APPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPP 559 +PP + P PP P PPPP TP PP Sbjct: 261 SPPPLPPQTLKPPPPQTTP--PPPPAITPPLSPP 292 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 42.3 bits (95), Expect = 4e-04 Identities = 23/73 (31%), Positives = 25/73 (34%), Gaps = 1/73 (1%) Frame = +2 Query: 410 GGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPP-PFXTPXXXPPQXPTXPPPX 586 G PPP PP P P PP P PPP P +P P T P P Sbjct: 46 GSSVPPPVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTPSTSPSPL 105 Query: 587 PXFXLPRPXXGXG 625 +P P G Sbjct: 106 TVPDMPSPPMPSG 118 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PPP +P P P PP P PP PP P+ P P P Sbjct: 50 PPPVMSPMPMMTP----PPMPMTPPPMPMTPPPMPMAPPPMPMASPP 92 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 PPP P TPP P P P P P P P+ P P Sbjct: 62 PPPMPM-TPPPMPMTPPPMPMAPPPMPMASPPMMPMTPSTSP 102 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +2 Query: 449 GXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXP 589 G + P P PP P PPP T PP P PPP P Sbjct: 45 GGSSVPPPVMSPMPMMTPPPMPMTPPPMPMT----PPPMPMAPPPMP 87 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 P P P TPP P PPP PPP PP Sbjct: 51 PPVMSPMPMMTPP--PMPMTPPPMPMTPPPMPMAPP 84 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P PPP P TPP P PP P PP P P P P Sbjct: 62 PPPMPMTPPPMPM-TPPPMPMAP-PPMPMASPPMMPMTPSTSPSPLTVPDMPSP 113 Score = 30.3 bits (65), Expect = 1.9 Identities = 20/70 (28%), Positives = 24/70 (34%), Gaps = 1/70 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPX-PXXRATXPSPPPXXPXXPPPPFXTPXX 550 PP P P+ P P +PP P +T PSP P P PP + Sbjct: 62 PPPMPMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTPSTSPSPLTV-PDMPSPPMPSGME 120 Query: 551 XPPQXPTXPP 580 P PP Sbjct: 121 SSPSPGPMPP 130 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/76 (26%), Positives = 23/76 (30%), Gaps = 1/76 (1%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXP-PQ 562 P P + PPP P P A P P P P P +P P Sbjct: 50 PPPVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTPSTSPSPLTVPD 109 Query: 563 XPTXPPPXPXFXLPRP 610 P+ P P P P Sbjct: 110 MPSPPMPSGMESSPSP 125 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/58 (29%), Positives = 19/58 (32%), Gaps = 1/58 (1%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRP-PXPLXPXXHPGRHXP 848 P P P PPP P +PP P P P P P + PG P Sbjct: 73 PMTPPPMPMAPPPMPMASPPMMPMTPSTSPSPLTVPDMPSPPMPSGMESSPSPGPMPP 130 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 42.3 bits (95), Expect = 4e-04 Identities = 23/66 (34%), Positives = 25/66 (37%), Gaps = 3/66 (4%) Frame = +2 Query: 344 KKKXXTXKKKPPXRPXPXXPLLGGXXP---PPXXXXXXGXGAPPXPXXRATXPSPPPXXP 514 K K +K+PP P P GG P G G PP P P PPP Sbjct: 638 KMKLVDIEKRPPRVPRPPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGG 697 Query: 515 XXPPPP 532 PPPP Sbjct: 698 PPPPPP 703 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP 788 P LP P PPP P PP P PPPP PPP Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPPPPP---PPP 705 Score = 36.7 bits (81), Expect = 0.022 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = +3 Query: 669 GRXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPL 815 G+ LP P P P P PP P PPPP PP PP L Sbjct: 662 GKSTNLPSARPPLPGGGPPPPPP--PPGGGPPPPPGGGPPPPPPPPGAL 708 Score = 35.5 bits (78), Expect = 0.050 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGR 839 P PP P PP P PPP PPP PP P P GR Sbjct: 668 PSARPPLPGGGPPPPP----PPPGGGPPPPPGGGPPPPPPPPGALGR 710 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXP 589 P P G + P R P P P PPPP P P P PPP P Sbjct: 652 PRPPPRSAGGGKSTNLPSARPPLPGGGPPPP--PPPPGGGPPPPPGGGPPPPPPPP 705 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPP 505 P PL GG PPP G G PP P P PPP Sbjct: 668 PSARPPLPGGGPPPP--PPPPGGGPPPPPGGGPPPPPPPP 705 Score = 33.5 bits (73), Expect = 0.20 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +2 Query: 491 PSPPPXXPX-XPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGG 634 PS P P PPPP P PP P PP P P G G GG Sbjct: 668 PSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPP--PPPPGALGRGAGG 714 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP PPPP PPP P P P P P Sbjct: 680 PPPPPPPGGGPPPPPGGGPP-------PPPPPP 705 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +2 Query: 749 PPXP---PPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP P PPP PPP P P PP P P Sbjct: 672 PPLPGGGPPP---PPPPPGGGPPPPPGGGPPPPPPP 704 Score = 27.9 bits (59), Expect = 10.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -1 Query: 463 GGXPPXGXXXXGGGXXPPQKGXXXXGPP 380 GG PP GGG PP G PP Sbjct: 676 GGGPPPPPPPPGGGPPPPPGGGPPPPPP 703 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 PPP P+P PP PPPP PP PP PL P P Sbjct: 49 PPPPPSPPPPSCTPS--PPPPSPPPPKKSSCPPSPLPPPPPP 88 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/50 (38%), Positives = 22/50 (44%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 PP P + PSPPP PPPP + P P PPP P + P Sbjct: 52 PPSPPPPSCTPSPPPP---SPPPPKKSSCPPSPLPPPPPPPPPNYVFTYP 98 Score = 36.3 bits (80), Expect = 0.028 Identities = 19/57 (33%), Positives = 24/57 (42%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPF 535 + +PP P P P PPP +PP P + PSP P P PPP + Sbjct: 46 QNQPPPPPSPPPPSCTPSPPPP---------SPPPPKKSSCPPSPLPPPPPPPPPNY 93 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/51 (33%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +3 Query: 699 PXXPPPXPTPT-PPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P PP P P+ P P PPP PP PP P P + + P Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPPNYVFTYPP 99 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +3 Query: 678 PXLPXFCPXXPPP-XPTPTPPXXPXXXXPPPPXXXPPPXXXR-PPXPLXP 821 P P P PPP P P P PPPP PP PP L P Sbjct: 55 PPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPPNYVFTYPPGDLYP 104 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +2 Query: 497 PPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 PPP P PPPP TP P P+ PPP P P Sbjct: 49 PPP--PPSPPPPSCTP---SPPPPSPPPPKKSSCPPSP 81 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P P P P P P P PP PPP PP P +P Sbjct: 50 PPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPP---PPPPNYVFTYP 98 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTP 544 PPP +PP P S P P PPPP P Sbjct: 51 PPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPP 91 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 41.9 bits (94), Expect = 6e-04 Identities = 31/107 (28%), Positives = 36/107 (33%), Gaps = 6/107 (5%) Frame = +3 Query: 558 PXTPLX-PPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTP 734 P TP+ PP P P V P + P PP PT +P Sbjct: 276 PPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKP-PPVQKPPTPTYSP 334 Query: 735 PXXPXXXXPPPPXXXP---PPXXXRPPXPL--XPXXHPGRHXPXNTI 860 P P PP P P PP +PP P+ P P H P I Sbjct: 335 PIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPI 381 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/55 (38%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXP---PPXXXRPPXPL--XPXXHPGRHXP 848 P PP PT +PP P PP P P PP +PP P+ P P H P Sbjct: 171 PVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKP 225 Score = 40.3 bits (90), Expect = 0.002 Identities = 39/164 (23%), Positives = 46/164 (28%), Gaps = 7/164 (4%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXX-PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPF---X 538 KPP P P+ PPP +PP P P P PPP Sbjct: 269 KPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPP 328 Query: 539 TPXXXPP-QXPTXPPPXPXFXLP--RPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXX 709 TP PP + P PP P + P P + P P + Sbjct: 329 TPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTP-IYSPPVK 387 Query: 710 XXXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPPGAP 841 PP PPP PP P + P P P Sbjct: 388 PPPIQKPPTPTYSPPIKPPP-LQKPPTPTYSPPIKLPPVKPPTP 430 Score = 40.3 bits (90), Expect = 0.002 Identities = 38/169 (22%), Positives = 44/169 (26%), Gaps = 2/169 (1%) Frame = +2 Query: 347 KKXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXP- 523 +K T PP +P P P PP PP P PP P P Sbjct: 325 QKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVH---KPPTPIYSPPVKPPPVHKPPTPI 381 Query: 524 -PPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLX 700 PP P P PT PP L +P + P Sbjct: 382 YSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPV 441 Query: 701 XXXXXXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP P PP P P + + PP P P Sbjct: 442 HKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPP 490 Score = 39.9 bits (89), Expect = 0.002 Identities = 40/174 (22%), Positives = 47/174 (27%), Gaps = 13/174 (7%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXX-PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPF---X 538 KPP P P+ PPP +PP P P P PPP Sbjct: 353 KPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPP 412 Query: 539 TPXXXPP-QXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXX 715 TP PP + P PP P + P P+ Sbjct: 413 TPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKP 472 Query: 716 XXXXXXXXXXXPPXPPPPXXXPP--------PXPXXAXPXSXSXXPPGAPXPXK 853 PP PPP PP P P + + PP P P K Sbjct: 473 PPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVK 526 Score = 39.9 bits (89), Expect = 0.002 Identities = 40/172 (23%), Positives = 50/172 (29%), Gaps = 12/172 (6%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPF--XT 541 K PP + P PPP +PP P+P P PPP T Sbjct: 387 KPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPT 446 Query: 542 PXXXPP--QXPTXPPPXPXFXLP-RPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXX 712 P PP P PP P + P +P + P P+ + Sbjct: 447 PIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPT-YSPPVKP 505 Query: 713 XXXXXXXXXXXXPPXPPPPXXXPPP-------XPXXAXPXSXSXXPPGAPXP 847 PP PPP P P P P + + PP P P Sbjct: 506 PPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 557 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/55 (38%), Positives = 23/55 (41%), Gaps = 5/55 (9%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXP---PPXXXRPPXPL--XPXXHPGRHXP 848 P PP PT +PP P PP P P PP +PP P P P H P Sbjct: 507 PIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKP 561 Score = 38.7 bits (86), Expect = 0.005 Identities = 38/164 (23%), Positives = 44/164 (26%), Gaps = 7/164 (4%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPF---XT 541 KPP P PPP +PP P P P PPP T Sbjct: 185 KPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPT 244 Query: 542 PXXXPP--QXPTXPPPXPXFXLP--RPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXX 709 P PP P PP P + P P + P P+ + Sbjct: 245 PIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPT-YSPPVK 303 Query: 710 XXXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPPGAP 841 PP PPP PP P + P P P Sbjct: 304 SPPVQKPPTPTYSPPIKPPP-VQKPPTPTYSPPIKPPPVKPPTP 346 Score = 38.7 bits (86), Expect = 0.005 Identities = 31/108 (28%), Positives = 37/108 (34%), Gaps = 6/108 (5%) Frame = +3 Query: 555 RPXTPLX-PPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPT 731 +P TP+ PP P P V P + P PP PT + Sbjct: 258 KPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKS-PPVQKPPTPTYS 316 Query: 732 PP-XXPXXXXPPPPXXXPP--PXXXRPPXPL--XPXXHPGRHXPXNTI 860 PP P PP P PP P +PP P+ P P H P I Sbjct: 317 PPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPI 364 Score = 38.7 bits (86), Expect = 0.005 Identities = 39/174 (22%), Positives = 46/174 (26%), Gaps = 12/174 (6%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPF--XT 541 K PP + P PPP +PP P+P P PPP T Sbjct: 303 KSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPT 362 Query: 542 PXXXPP--QXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXX 715 P PP P PP P + P P+ Sbjct: 363 PIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKL 422 Query: 716 XXXXXXXXXXXPPXPPPPXXXPP--------PXPXXAXPXSXSXXPPGAPXPXK 853 PP PPP PP P P + + PP P P K Sbjct: 423 PPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVK 476 Score = 38.7 bits (86), Expect = 0.005 Identities = 30/104 (28%), Positives = 35/104 (33%), Gaps = 6/104 (5%) Frame = +3 Query: 555 RPXTPLX-PPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPT 731 +P TP+ PP P P + P P P PP PT + Sbjct: 443 KPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPP--PVQKPPTPTYS 500 Query: 732 PP-XXPXXXXPPPPXXXPP--PXXXRPPXPL--XPXXHPGRHXP 848 PP P PP P PP P +PP P P P H P Sbjct: 501 PPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKP 544 Score = 38.3 bits (85), Expect = 0.007 Identities = 24/87 (27%), Positives = 26/87 (29%), Gaps = 3/87 (3%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPX 547 K PP + P PPP +PP P P P PPP P Sbjct: 656 KPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPP 715 Query: 548 XXPPQXPTXPPP---XPXFXLPRPXXG 619 P PPP P P P G Sbjct: 716 TPTYSPPIKPPPVQVPPTPTTPSPPQG 742 Score = 37.9 bits (84), Expect = 0.009 Identities = 39/172 (22%), Positives = 47/172 (27%), Gaps = 14/172 (8%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPF---XTP 544 PP + P PPP +PP P P P PPP TP Sbjct: 119 PPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTP 178 Query: 545 XXXPP-QXPTXPPPXPXFXLP--RPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXX 715 PP + P PP P + P P + P P+ + Sbjct: 179 TYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPT-YSPPVKPP 237 Query: 716 XXXXXXXXXXXPPXPPPPXXXPP--------PXPXXAXPXSXSXXPPGAPXP 847 PP PPP PP P P + PP P P Sbjct: 238 PVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPP 289 Score = 37.9 bits (84), Expect = 0.009 Identities = 21/72 (29%), Positives = 22/72 (30%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPX 547 K PP P PPP +PP P P P PPP TP Sbjct: 218 KPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPP 277 Query: 548 XXPPQXPTXPPP 583 P PPP Sbjct: 278 TPIYSPPVKPPP 289 Score = 37.9 bits (84), Expect = 0.009 Identities = 39/173 (22%), Positives = 45/173 (26%), Gaps = 14/173 (8%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPF---XT 541 KPP P P PP +PP P P P PPP T Sbjct: 504 KPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPT 563 Query: 542 PXXXPP--QXPTXPPPXPXFXLP-RPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXX 712 P PP P PP P + P +P P + Sbjct: 564 PTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP 623 Query: 713 XXXXXXXXXXXXPPXPPPPXXXPP--------PXPXXAXPXSXSXXPPGAPXP 847 PP PPP PP P P + + PP P P Sbjct: 624 PPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPP 676 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/72 (27%), Positives = 21/72 (29%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPX 547 K PP P PPP +PP P P P PPP P Sbjct: 639 KPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPP 698 Query: 548 XXPPQXPTXPPP 583 P PPP Sbjct: 699 TPTYSPPVKPPP 710 Score = 37.5 bits (83), Expect = 0.012 Identities = 22/59 (37%), Positives = 25/59 (42%), Gaps = 5/59 (8%) Frame = +3 Query: 699 PXXPPPXPTPTPP-XXPXXXXPPPPXXXPP--PXXXRPPXPL--XPXXHPGRHXPXNTI 860 P PP PT +PP P PP P PP P +PP P+ P P H P I Sbjct: 154 PVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPI 212 Score = 37.5 bits (83), Expect = 0.012 Identities = 39/173 (22%), Positives = 45/173 (26%), Gaps = 14/173 (8%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXX-PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPF---X 538 KPP P P+ PPP +PP P P P PPP Sbjct: 235 KPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPP 294 Query: 539 TPXXXPP--QXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXX 712 TP PP P PP P + P P + Sbjct: 295 TPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKP 354 Query: 713 XXXXXXXXXXXXPPXPPPPXXXPP--------PXPXXAXPXSXSXXPPGAPXP 847 PP PPP PP P P + + PP P P Sbjct: 355 PPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPP 407 Score = 37.5 bits (83), Expect = 0.012 Identities = 27/93 (29%), Positives = 30/93 (32%), Gaps = 8/93 (8%) Frame = +2 Query: 350 KXXTXKKKPPXRPXPXXP----LLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPX 517 K T PP +P P P PPP +PP P P P Sbjct: 460 KPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPP 519 Query: 518 XPPPPF--XTPXXXPP--QXPTXPPPXPXFXLP 604 PPP TP PP P PP P + P Sbjct: 520 IKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPP 552 Score = 37.5 bits (83), Expect = 0.012 Identities = 42/185 (22%), Positives = 50/185 (27%), Gaps = 18/185 (9%) Frame = +2 Query: 347 KKXXTXKKKPPXRPXPXXP----LLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP 514 +K T PP +P P P PPP +PP P P P Sbjct: 509 QKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSP 568 Query: 515 XXPPPPF---XTPXXXPP--QXPTXPPPXPXFXLP-RPXXGXGXGGLXXXXXXXXXXRXX 676 PPP TP PP P PP P + P +P Sbjct: 569 PIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHK 628 Query: 677 PXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXPP--------PXPXXAXPXSXSXXPP 832 P + PP PPP PP P P + + PP Sbjct: 629 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPP 688 Query: 833 GAPXP 847 P P Sbjct: 689 VKPPP 693 Score = 36.7 bits (81), Expect = 0.022 Identities = 30/105 (28%), Positives = 34/105 (32%), Gaps = 7/105 (6%) Frame = +3 Query: 555 RPXTPLX-PPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPT 731 +P TP PP P P + P P P PP PT + Sbjct: 493 KPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPP--PVHKPPTPTYS 550 Query: 732 PPXXPXXXXPPP-PXXXPP---PXXXRPPXPL--XPXXHPGRHXP 848 PP P PP P PP P +PP P P P H P Sbjct: 551 PPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKP 595 Score = 36.3 bits (80), Expect = 0.028 Identities = 33/143 (23%), Positives = 39/143 (27%), Gaps = 6/143 (4%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPF---XTP 544 PP + P PPP +PP P P P PPP TP Sbjct: 102 PPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTP 161 Query: 545 XXXPP--QXPTXPPPXPXFXLP-RPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXX 715 PP P PP P + P +P + P P + Sbjct: 162 TYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTP-IYSPPIKPP 220 Query: 716 XXXXXXXXXXXPPXPPPPXXXPP 784 PP PPP PP Sbjct: 221 PVHKPPTPTYSPPVKPPPVHKPP 243 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/71 (28%), Positives = 21/71 (29%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXX 550 KPP P P PP +PP P P P PPP P Sbjct: 168 KPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPT 227 Query: 551 XPPQXPTXPPP 583 P PPP Sbjct: 228 PTYSPPVKPPP 238 Score = 35.9 bits (79), Expect = 0.038 Identities = 40/174 (22%), Positives = 48/174 (27%), Gaps = 14/174 (8%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPF--XT 541 K PP + P PPP +PP P+P P PPP T Sbjct: 151 KPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPT 210 Query: 542 PXXXPP--QXPTXPPPXPXFXLP--RPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXX 709 P PP P PP P + P P + P P + Sbjct: 211 PIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTP-IYSPPVK 269 Query: 710 XXXXXXXXXXXXXPPXPPPPXXXPP--------PXPXXAXPXSXSXXPPGAPXP 847 PP PPP PP P P + + PP P P Sbjct: 270 PPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPP 323 Score = 35.5 bits (78), Expect = 0.050 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +2 Query: 410 GGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPP 583 G PPP PP P PP P PP P P PT PP Sbjct: 41 GHAHPPPIYGAPPSYTTPPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPP 98 Score = 35.1 bits (77), Expect = 0.066 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P PP PT +PP P PP PP P P P P Sbjct: 390 PIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSP 434 Score = 35.1 bits (77), Expect = 0.066 Identities = 21/56 (37%), Positives = 23/56 (41%), Gaps = 6/56 (10%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPP-PXXXPP---PXXXRPPXPL--XPXXHPGRHXP 848 P PP PT +PP P PP P PP P +PP P P P H P Sbjct: 557 PIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKP 612 Score = 35.1 bits (77), Expect = 0.066 Identities = 21/56 (37%), Positives = 23/56 (41%), Gaps = 6/56 (10%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPP-PXXXPP---PXXXRPPXPL--XPXXHPGRHXP 848 P PP PT +PP P PP P PP P +PP P P P H P Sbjct: 574 PVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKP 629 Score = 35.1 bits (77), Expect = 0.066 Identities = 21/56 (37%), Positives = 23/56 (41%), Gaps = 6/56 (10%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPP-PXXXPP---PXXXRPPXPL--XPXXHPGRHXP 848 P PP PT +PP P PP P PP P +PP P P P H P Sbjct: 591 PVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKP 646 Score = 35.1 bits (77), Expect = 0.066 Identities = 22/81 (27%), Positives = 25/81 (30%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPX 547 K PP + P PPP +PP P P P PPP P Sbjct: 673 KPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVP- 731 Query: 548 XXPPQXPTXPPPXPXFXLPRP 610 P T PP + P P Sbjct: 732 ---PTPTTPSPPQGGYGTPPP 749 Score = 34.7 bits (76), Expect = 0.087 Identities = 19/70 (27%), Positives = 21/70 (30%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP + P PPP +PP P P P PPP P Sbjct: 85 PPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTP 144 Query: 554 PPQXPTXPPP 583 P PPP Sbjct: 145 SYSPPVKPPP 154 Score = 34.7 bits (76), Expect = 0.087 Identities = 25/99 (25%), Positives = 28/99 (28%), Gaps = 1/99 (1%) Frame = +3 Query: 555 RPXTPLX-PPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPT 731 +P TP PP P P + P P P PP P + Sbjct: 393 KPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPP--PVHKPPTPIYS 450 Query: 732 PPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PP P PP PP P P P P P Sbjct: 451 PPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPP 489 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 4/43 (9%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPP-PXXXPP---PXXXRPPXPL 815 P PP PT +PP P PP P PP P +PP P+ Sbjct: 221 PVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPI 263 Score = 34.3 bits (75), Expect = 0.11 Identities = 23/83 (27%), Positives = 25/83 (30%), Gaps = 4/83 (4%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPF--XT 541 K PP P PP +PP P P P PPP T Sbjct: 286 KPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPT 345 Query: 542 PXXXPP--QXPTXPPPXPXFXLP 604 P PP P PP P + P Sbjct: 346 PIYSPPVKPPPVHKPPTPIYSPP 368 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXP--PPPXXXPPPXXXRPPXPLXPXXHP 833 P P + P PP P PP P P PPP PP PP L P P Sbjct: 377 PPTPIYSPPVKPP-PIQKPPT-PTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPP 428 Score = 33.9 bits (74), Expect = 0.15 Identities = 23/81 (28%), Positives = 26/81 (32%), Gaps = 4/81 (4%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPP--PFXTPX 547 PP P P+ PP P P P+P P PPP TP Sbjct: 52 PPSYTTPPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPT 111 Query: 548 XXPP--QXPTXPPPXPXFXLP 604 PP P PP P + P Sbjct: 112 YSPPIYPPPIQKPPTPTYSPP 132 Score = 33.9 bits (74), Expect = 0.15 Identities = 19/50 (38%), Positives = 22/50 (44%), Gaps = 5/50 (10%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPP-PXXXP---PPXXXRPPXP-LXPXXHP 833 P PP PT +PP P PP P P PP +PP P P +P Sbjct: 86 PIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYP 135 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 6/56 (10%) Frame = +3 Query: 699 PXXPPPXPTPTPP-XXPXXXXPPPPXXXP---PPXXXRPPXPL--XPXXHPGRHXP 848 P PP PT +PP P PP P P PP PP P P P H P Sbjct: 120 PIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKP 175 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +3 Query: 699 PXXPPPXPTPTPP-XXPXXXXPPPPXXXP---PPXXXRPPXP 812 P PP PT +PP P PP P P PP +PP P Sbjct: 103 PIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTP 144 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPP-PXXXPP---PXXXRPPXP 812 P PP PT +PP P PP P PP P +PP P Sbjct: 608 PVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTP 649 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPP-PXXXPP---PXXXRPPXP 812 P PP PT +PP P PP P PP P +PP P Sbjct: 625 PVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTP 666 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXX-PPPPXXXPP---PXXXRPPXPLXPXXHPG 836 P PP PT +PP P PP P PP P PP P P G Sbjct: 693 PVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSPPQG 742 Score = 33.1 bits (72), Expect = 0.26 Identities = 25/89 (28%), Positives = 28/89 (31%), Gaps = 2/89 (2%) Frame = +2 Query: 350 KXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP- 526 K T PP +P P PP PP P PPP P P Sbjct: 476 KPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQK--PPTPTYSPPI-KPPPVKPPTPTY 532 Query: 527 -PPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 PP P P PT PP + +P Sbjct: 533 SPPIKPPPVHKPPTPTYSPPIKPPPIHKP 561 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P PP PT +PP P PP PP PP L P Sbjct: 642 PVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKP-PPVQLPP 681 Score = 32.7 bits (71), Expect = 0.35 Identities = 25/91 (27%), Positives = 29/91 (31%), Gaps = 5/91 (5%) Frame = +3 Query: 555 RPXTPLX-PPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPT 731 +P TP PP P P + P P P PP P + Sbjct: 309 KPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPP--PVHKPPTPIYS 366 Query: 732 PPXXPXXXXPPP-PXXXPP---PXXXRPPXP 812 PP P PP P PP P +PP P Sbjct: 367 PPVKPPPVHKPPTPIYSPPVKPPPIQKPPTP 397 Score = 32.3 bits (70), Expect = 0.46 Identities = 24/82 (29%), Positives = 25/82 (30%), Gaps = 2/82 (2%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXP--PPPXXXPPPXXXRPPXPLXPXXHPGRHXPX 851 P P + P PP P PP P P PPP PP PP P P Sbjct: 360 PPTPIYSPPVKPP-PVHKPPT-PIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYS 417 Query: 852 NTIXXXXXXXXXXXXXPPQKXP 917 I PP K P Sbjct: 418 PPIKLPPVKPPTPIYSPPVKPP 439 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +3 Query: 678 PXLPXFCPXX-PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 P P + P PPP P P PPP P P PP Sbjct: 697 PPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSPP 740 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXP--PPPXXXPPPXXXRPPXPLXPXXHP 833 P P + P PP P PP P P PPP PP PP P P Sbjct: 208 PPTPIYSPPIKPP-PVHKPPT-PTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKP 259 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXP--PPPXXXPPPXXXRPPXPLXPXXHP 833 P P + P PP P PP P P PPP PP PP P P Sbjct: 242 PPTPIYSPPIKPP-PVHKPPT-PIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKP 293 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXP--PPPXXXPPPXXXRPPXPLXPXXHP 833 P P + P PP P PP P P PPP PP PP P P Sbjct: 343 PPTPIYSPPVKPP-PVHKPPT-PIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKP 394 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXP--PPPXXXPPPXXXRPPXPLXPXXHP 833 P P + P PP P PP P P PPP PP PP P P Sbjct: 561 PPTPTYSPPIKPP-PVHKPPT-PTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKP 612 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXP--PPPXXXPPPXXXRPPXPLXPXXHP 833 P P + P PP P PP P P PPP PP PP P P Sbjct: 578 PPTPTYSPPIKPP-PVHKPPT-PTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKP 629 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXP--PPPXXXPPPXXXRPPXPLXPXXHP 833 P P + P PP P PP P P PPP PP PP P P Sbjct: 595 PPTPTYSPPIKPP-PVHKPPT-PTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKP 646 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXP--PPPXXXPPPXXXRPPXPLXPXXHP 833 P P + P PP P PP P P PPP PP PP P P Sbjct: 612 PPTPTYSPPIKPP-PVHKPPT-PTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKP 663 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXP--PPPXXXPPPXXXRPPXPLXPXXHP 833 P P + P PP P PP P P PPP PP PP P P Sbjct: 680 PPTPTYSPPVKPP-PVQVPPT-PTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVP 731 Score = 31.5 bits (68), Expect = 0.81 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPP 583 PPP +PP P P P PPP P P PPP Sbjct: 84 PPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPP 137 Score = 31.5 bits (68), Expect = 0.81 Identities = 25/91 (27%), Positives = 30/91 (32%), Gaps = 5/91 (5%) Frame = +3 Query: 555 RPXTPLX-PPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPT 731 +P TP+ PP P P V P + P PP P + Sbjct: 207 KPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKP-PPVHKPPTPIYS 265 Query: 732 PPXXPXXXXPPP-PXXXPP---PXXXRPPXP 812 PP P PP P PP P +PP P Sbjct: 266 PPVKPPPVQTPPTPIYSPPVKPPPVHKPPTP 296 Score = 31.5 bits (68), Expect = 0.81 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXP--PPPXXXPPPXXXRPPXPLXPXXHP 833 P P + P PP P PP P P PPP PP PP P P Sbjct: 225 PPTPTYSPPVKPP-PVHKPPT-PIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTP 276 Score = 31.5 bits (68), Expect = 0.81 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXP--PPPXXXPPPXXXRPPXPLXPXXHP 833 P P + P PP P PP P P PPP PP PP P P Sbjct: 646 PPTPTYSPPIKPP-PVQKPPT-PTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVP 697 Score = 31.5 bits (68), Expect = 0.81 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXP--PPPXXXPPPXXXRPPXPLXPXXHP 833 P P + P PP P PP P P PPP PP PP P P Sbjct: 663 PPTPTYSPPVKPP-PVQLPPT-PTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVP 714 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/53 (37%), Positives = 23/53 (43%), Gaps = 8/53 (15%) Frame = +3 Query: 699 PXXPPPX---PTPTPPXXPXXXXPPP-PXXXP---PPXXXRPPXP-LXPXXHP 833 P PPP PT +PP P PP P P PP +PP P P +P Sbjct: 66 PIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYP 118 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/72 (29%), Positives = 23/72 (31%), Gaps = 11/72 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXP---------PPXXXRPPXPL--XPX 824 P P + P PP P P PPP P PP +PP P P Sbjct: 175 PPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPV 234 Query: 825 XHPGRHXPXNTI 860 P H P I Sbjct: 235 KPPPVHKPPTPI 246 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXP--PPPXXXPPPXXXRPPXPLXPXXHP 833 P P + P PP P PP P P PPP PP PP P P Sbjct: 629 PPTPTYSPPIKPP-PVHKPPT-PTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLP 680 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 4/42 (9%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXX-PPPPXXXPP---PXXXRPPXP 812 P PP PT +PP P PP P PP P PP P Sbjct: 676 PVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTP 717 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXX--PPPPXXXPPPXXXRPPXPLXPXXHP 833 P PP PT +PP P P P PP P P HP Sbjct: 710 PVQVPPTPTYSPPIKPPPVQVPPTPTTPSPPQGGYGTPPPYAYLSHP 756 Score = 29.9 bits (64), Expect = 2.5 Identities = 29/110 (26%), Positives = 33/110 (30%), Gaps = 9/110 (8%) Frame = +3 Query: 558 PXTPLX-PPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTP 734 P TP PP P P + P P P PP P +P Sbjct: 158 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPP--PVHKPPTPIYSP 215 Query: 735 PXXPXXXXPPP------PXXXPPPXXXRPPXPL--XPXXHPGRHXPXNTI 860 P P PP P PP +PP P+ P P H P I Sbjct: 216 PIKPPPVHKPPTPTYSPPVKPPP--VHKPPTPIYSPPIKPPPVHKPPTPI 263 Score = 29.5 bits (63), Expect = 3.3 Identities = 18/50 (36%), Positives = 20/50 (40%), Gaps = 8/50 (16%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPP----PPXXXP---PPXXXRPPXP-LXPXXHP 833 PP TP PP PP PP P PP +PP P P +P Sbjct: 52 PPSYTTPPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYP 101 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 41.5 bits (93), Expect = 8e-04 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXP-TXPPPXPXFXLPRP 610 P P + P PP P PPPP +P PP P P P P P P Sbjct: 25 PPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHP 74 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = +3 Query: 678 PXLPXFCPXX-PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXH 830 P P F P PPP P P P P P P PPP PP P H Sbjct: 44 PPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPPTPAPGH 95 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/53 (35%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPP---PXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P P+P PP PPP P PPP PP P +P H P Sbjct: 14 PSHQHPLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPP 66 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/59 (37%), Positives = 23/59 (38%), Gaps = 5/59 (8%) Frame = +3 Query: 687 PXFCPXXPPPX--PTPTPPXXPXXXXPPP---PXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P PPP P PP P PPP P PPP P P P +P H P Sbjct: 19 PLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQP 77 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/69 (31%), Positives = 23/69 (33%), Gaps = 1/69 (1%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPX-PXXRATXPSPPPXXPXXPPPPFXTPXXXPPQ 562 P P P PPP PP PSP P PP P+ P PP Sbjct: 21 PSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPP 80 Query: 563 XPTXPPPXP 589 PPP P Sbjct: 81 PHVLPPPPP 89 Score = 38.7 bits (86), Expect = 0.005 Identities = 26/80 (32%), Positives = 26/80 (32%), Gaps = 5/80 (6%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQX 565 P PL PPP PP P P PP P PPP P PP Sbjct: 14 PSHQHPLPSPVPPPPSHI-----SPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPP 68 Query: 566 -----PTXPPPXPXFXLPRP 610 P PPP P P P Sbjct: 69 SPYPHPHQPPPPPHVLPPPP 88 Score = 38.3 bits (85), Expect = 0.007 Identities = 23/70 (32%), Positives = 23/70 (32%), Gaps = 1/70 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPP-XXPXXPPPPFXTPXX 550 PP P P PP PP P P P P P PPPP P Sbjct: 27 PPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPP---PHV 83 Query: 551 XPPQXPTXPP 580 PP PT P Sbjct: 84 LPPPPPTPAP 93 Score = 37.5 bits (83), Expect = 0.012 Identities = 23/64 (35%), Positives = 24/64 (37%), Gaps = 9/64 (14%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXP-----XXXXPPPPXXXPPPXXXRPP----XPLXPXXH 830 P P F P PP P +PP P PPPP P P PP P P Sbjct: 33 PPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPPTPA 92 Query: 831 PGRH 842 PG H Sbjct: 93 PGHH 96 Score = 37.1 bits (82), Expect = 0.016 Identities = 20/55 (36%), Positives = 23/55 (41%), Gaps = 4/55 (7%) Frame = +2 Query: 458 APPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPP----QXPTXPPPXPXFXLPRP 610 +PP P PPP PPPP +P PP P PPP P + P P Sbjct: 12 SPPSHQHPLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSP-YPHPHP 65 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PPP P P P PP P P P P P HP + P Sbjct: 33 PPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPP 79 Score = 31.9 bits (69), Expect = 0.61 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXKH 856 PP PPP PP P PP +P P H Sbjct: 40 PPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPH 75 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/42 (35%), Positives = 17/42 (40%), Gaps = 7/42 (16%) Frame = +2 Query: 752 PXPPPPXXXPPPXPXXAXPX-------SXSXXPPGAPXPXKH 856 P PPPP PP P + P S PP +P P H Sbjct: 23 PVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPH 64 Score = 27.9 bits (59), Expect = 10.0 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 752 PXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXKH 856 P PPPP P P P PP P P H Sbjct: 63 PHPPPPSPYPHPHQPPPPPHVLPPPPP-TPAPGHH 96 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 41.5 bits (93), Expect = 8e-04 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +2 Query: 455 GAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT---XPPP 583 G+PP P + PSPPP P PPPP P P P+ PPP Sbjct: 1124 GSPPLP--HESPPSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPP 1167 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P LP P PPP P +PP PP PPP P P P Sbjct: 1126 PPLPHESPPSPPPQPPSSPPPPSS---PPQLAPAPPPSDHCLPPPTAP 1170 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = +3 Query: 684 LPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRH 842 LP F P PP P +PP P P PP PPP P L P P H Sbjct: 1118 LPSF-PAGSPPLPHESPPSPP----PQPPSSPPPP---SSPPQLAPAPPPSDH 1162 Score = 31.5 bits (68), Expect = 0.81 Identities = 13/28 (46%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +2 Query: 503 PXXPXXPPP-PFXTPXXXPPQXPTXPPP 583 P P PP P +P PPQ P+ PPP Sbjct: 1119 PSFPAGSPPLPHESPPSPPPQPPSSPPP 1146 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/51 (31%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXX-PXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 PP P PS PP P PP P P P P + RP Sbjct: 1137 PPQPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAPLAPAQSIALPPSSITRP 1187 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAP 841 PP PPP PP P PP AP Sbjct: 1140 PPSSPPPPSSPPQLAPAPPPSDHCLPPPTAP 1170 Score = 27.9 bits (59), Expect = 10.0 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +2 Query: 425 PPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPP 580 PP PP P+PPP PPP T P Q PP Sbjct: 1133 PPSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPP---TAPLAPAQSIALPP 1181 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 41.5 bits (93), Expect = 8e-04 Identities = 18/42 (42%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +2 Query: 497 PPPXXPXXPPPPFXTPXXXPPQXPTXP-PPXPXFXLPRPXXG 619 PPP P PPPP P PP P P PP P F + + G Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPPPAFAVGKTPEG 105 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 PPP PT PP P PPPP PPP PP Sbjct: 65 PPPPPTSPPPPSPPPPSPPPP--SPPPPSPPPP 95 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 752 PXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 P PPPP PPP P P S PP P P Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +3 Query: 720 PTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGR 839 P P PP P PPPP PPP PP P P G+ Sbjct: 64 PPPPPPTSPPPPSPPPP--SPPPPSPPPPSPPPPAFAVGK 101 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPP 785 P PP P+P PP P PPPP PP Sbjct: 68 PPTSPPPPSP-PPPSPPPPSPPPPSPPPP 95 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPP 583 PP P PSPPP P P PP P PP P Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPP--PPSPPPPAFAVGKTP 103 Score = 33.5 bits (73), Expect = 0.20 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPP 832 PP PPP PPP P P S PP Sbjct: 68 PPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 32.7 bits (71), Expect = 0.35 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPP 767 P P P PP P+P PP P PPP Sbjct: 66 PPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 32.3 bits (70), Expect = 0.46 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPP 770 P P P P P P PP P PPPP Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 458 APPXPXXRATXPSPPPXXPXXPPPP 532 +PP P P PP P PPPP Sbjct: 71 SPPPPSPPPPSPPPPSPPPPSPPPP 95 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 40.7 bits (91), Expect = 0.001 Identities = 30/90 (33%), Positives = 33/90 (36%), Gaps = 4/90 (4%) Frame = -2 Query: 630 PXPXPXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXX-GXXGGGEGXVARXXGXGGAP 454 P P G G G GG G GG +GGGG G GGG + G GG P Sbjct: 307 PFPVQMGGGGGGPGGKKGGP-GGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGP 365 Query: 453 ---XPXXXXXXGGGXXPPKRGXXGXGRXGG 373 GG K+G G G GG Sbjct: 366 NGNKGGGGVQMNGGPNGGKKGGGGGGGGGG 395 Score = 35.1 bits (77), Expect = 0.066 Identities = 26/80 (32%), Positives = 29/80 (36%), Gaps = 1/80 (1%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXX 430 G+G GG G GG G GGG GG G + G GG P Sbjct: 303 GKGMPFPVQMGGGGGGPGGKKGGPGGGGGNMGNQNQGGGG---KNGGKGGGGHPLDGKMG 359 Query: 429 GGGXXP-PKRGXXGXGRXGG 373 GGG P +G G GG Sbjct: 360 GGGGGPNGNKGGGGVQMNGG 379 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G +G GG G GGGG G GG GV GG G K G Sbjct: 341 GGKNGGKGGGGHPLDG---KMGGGGGGPNGNKGGGGVQMNGGPNGGKKG 386 Score = 33.9 bits (74), Expect = 0.15 Identities = 28/72 (38%), Positives = 28/72 (38%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPP 409 G GGG G GG GV GG G GGG G G GG P GG P Sbjct: 360 GGGGGPNGNKGGG--GVQMNGGPNGGKKGGGGGG-----GGGGGP-------MSGGLPPG 405 Query: 408 KRGXXGXGRXGG 373 R G G GG Sbjct: 406 FRPMGGGGGGGG 417 Score = 32.7 bits (71), Expect = 0.35 Identities = 26/79 (32%), Positives = 28/79 (35%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXX 430 G G GGG V GG G GGGG GGG G ++ G P Sbjct: 361 GGGGPNGNKGGGGVQMNGGPNGGKKGGGGGG----GGGGGPMSGGLPPGFRP---MGGGG 413 Query: 429 GGGXXPPKRGXXGXGRXGG 373 GGG P G GG Sbjct: 414 GGGGGPQSMSMPMGGAMGG 432 Score = 31.9 bits (69), Expect = 0.61 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 4/58 (6%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGG----RXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G PG G G GG GGG GG G G +G G GGG G K G Sbjct: 315 GGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMG-GGGGGPNGNKGG 371 Score = 31.5 bits (68), Expect = 0.81 Identities = 27/83 (32%), Positives = 27/83 (32%), Gaps = 6/83 (7%) Frame = -2 Query: 603 GRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGG-GEGXVARXXGXGGAPXPXXXXXXG 427 G G GG G GG K GGG G G G G V G G G Sbjct: 334 GNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGG 393 Query: 426 G-----GXXPPKRGXXGXGRXGG 373 G G PP G G GG Sbjct: 394 GGGPMSGGLPPGFRPMGGGGGGG 416 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -2 Query: 603 GRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGG 496 G+ G GGG G G GGGG G GGG Sbjct: 103 GKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGG 138 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G +G GG GGG G G GG G G GGG G Sbjct: 102 GGKGGGG---GGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 831 GGXXXXEXGXAXXGXGGGXXXGGGGXGG 748 GG G G GGG GGGG GG Sbjct: 111 GGPANNNKGQKIGGGGGGGGGGGGGGGG 138 Score = 29.5 bits (63), Expect = 3.3 Identities = 21/69 (30%), Positives = 24/69 (34%) Frame = -2 Query: 618 PXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXX 439 P G+ G GGG GG G GGG G GGG ++ G Sbjct: 380 PNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGG--GGGGGGPQSMSMPMGGAMGGPMGSL 437 Query: 438 XXXGGGXXP 412 GGG P Sbjct: 438 PQMGGGPGP 446 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 582 GGGXVGXWGGXXXGVXKGGGGXXGXXGGGEG 490 GGG G G GGGG G GGG G Sbjct: 106 GGGGGGGPANNNKGQKIGGGGGGGGGGGGGG 136 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGV-GVGXGGGXXG 698 G G GGG GGGG G G +G GGG G Sbjct: 379 GPNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGGGGG 417 Score = 27.9 bits (59), Expect = 10.0 Identities = 22/73 (30%), Positives = 23/73 (31%), Gaps = 2/73 (2%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXP- 412 G GG + G GGGG G GG G G GGG P Sbjct: 295 GPAGGKIEGKGMPFPVQMGGGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPL 354 Query: 411 -PKRGXXGXGRXG 376 K G G G G Sbjct: 355 DGKMGGGGGGPNG 367 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G G G GGG GG GG G G GGG Sbjct: 359 GGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGG 396 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 40.7 bits (91), Expect = 0.001 Identities = 28/81 (34%), Positives = 32/81 (39%), Gaps = 2/81 (2%) Frame = -2 Query: 606 RGRXKXGXGGGXVGXWGGXXXGVXKG--GGGXXGXXGGGEGXVARXXGXGGAPXPXXXXX 433 + R G GGG G GG G G GGG G GGG G R G G+ Sbjct: 83 QSRGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRG 142 Query: 432 XGGGXXPPKRGXXGXGRXGGF 370 GGG + G G G G + Sbjct: 143 YGGGGR-REGGGYGGGDGGSY 162 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G GGR GGG GGGG G GG G GGG + G Sbjct: 90 GGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGG 131 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = -1 Query: 847 GXWRPGWXXGXR--GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G R G G R G GG GGG GGGG GG G G GGG G G Sbjct: 91 GGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGG 146 Score = 34.7 bits (76), Expect = 0.087 Identities = 23/57 (40%), Positives = 24/57 (42%), Gaps = 8/57 (14%) Frame = -1 Query: 832 GWXXGXRGWGG---RXXXGGGXXXGGGGXXXXGXXGGV-----GVGXGGGXXGQKXG 686 G G RG G R GGG GGGG G GG G G GGG G+ G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYG 144 Score = 34.7 bits (76), Expect = 0.087 Identities = 28/81 (34%), Positives = 28/81 (34%), Gaps = 3/81 (3%) Frame = -2 Query: 609 GRGRXKXGXG---GGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXX 439 G GR G G GG G GG G GGGG GG G G GG Sbjct: 91 GGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYG---SGGGGGGRGYGGGG 147 Query: 438 XXXGGGXXPPKRGXXGXGRXG 376 GGG G G G G Sbjct: 148 RREGGGYGGGDGGSYGGGGGG 168 Score = 31.5 bits (68), Expect = 0.81 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGG----RXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G + G G G GG R G G GGGG G G G GGG G G Sbjct: 107 GGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGG 164 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/52 (32%), Positives = 20/52 (38%) Frame = -1 Query: 853 FXGXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 + G G+ G+G GG GGG G GG G GGG G Sbjct: 117 YSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 168 Score = 29.5 bits (63), Expect = 3.3 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 814 RGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 RG GG GGG G GG G GG G GGG G G Sbjct: 85 RGSGG---GGGGRG-GSGGGYRSGGGGGYSGGGGGGYSGGGGG 123 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G GGG GGGG G GG G GG G G Sbjct: 130 GGYGSGGGGGGRGYGGGGRREGGGYGG---GDGGSYGGGGGG 168 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/83 (28%), Positives = 29/83 (34%), Gaps = 3/83 (3%) Frame = +2 Query: 371 KPPXR---PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXT 541 KPP P P + PPP PP P ++ P PP PPPP+ Sbjct: 41 KPPTHIYSSPPPPPYVYSSPPPPPYIYK---SPPPPPYVYSSPPPPPYIYKSPPPPPYVY 97 Query: 542 PXXXPPQXPTXPPPXPXFXLPRP 610 PP PP P + P Sbjct: 98 SSPPPPPYIYKSPPPPPYVYSSP 120 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/73 (28%), Positives = 26/73 (35%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PPP PP P ++ P PP PPPP+ PP Sbjct: 131 PPPPYVYNSPPPPPYVYK---SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY 187 Query: 572 XPPPXPXFXLPRP 610 PP P + P Sbjct: 188 KSPPPPPYVYSSP 200 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/73 (28%), Positives = 26/73 (35%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PPP PP P ++ P PP PPPP+ PP Sbjct: 151 PPPPYVYSSPPPPPYVYK---SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY 207 Query: 572 XPPPXPXFXLPRP 610 PP P + P Sbjct: 208 KSPPPPPYVYSSP 220 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/73 (28%), Positives = 26/73 (35%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PPP PP P ++ P PP PPPP+ PP Sbjct: 171 PPPPYVYSSPPPPPYVYK---SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY 227 Query: 572 XPPPXPXFXLPRP 610 PP P + P Sbjct: 228 KSPPPPPYVYSSP 240 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/73 (28%), Positives = 26/73 (35%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PPP PP P ++ P PP PPPP+ PP Sbjct: 191 PPPPYVYSSPPPPPYVYK---SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY 247 Query: 572 XPPPXPXFXLPRP 610 PP P + P Sbjct: 248 KSPPPPPYVYSSP 260 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/73 (28%), Positives = 26/73 (35%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PPP PP P ++ P PP PPPP+ PP Sbjct: 211 PPPPYVYSSPPPPPYVYK---SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY 267 Query: 572 XPPPXPXFXLPRP 610 PP P + P Sbjct: 268 KSPPPPPYVYSSP 280 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/73 (28%), Positives = 26/73 (35%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PPP PP P ++ P PP PPPP+ PP Sbjct: 231 PPPPYVYSSPPPPPYVYK---SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY 287 Query: 572 XPPPXPXFXLPRP 610 PP P + P Sbjct: 288 KSPPPPPYVYSSP 300 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/73 (28%), Positives = 26/73 (35%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PPP PP P ++ P PP PPPP+ PP Sbjct: 251 PPPPYVYSSPPPPPYVYK---SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY 307 Query: 572 XPPPXPXFXLPRP 610 PP P + P Sbjct: 308 KSPPPPPYVYSSP 320 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/73 (28%), Positives = 26/73 (35%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PPP PP P ++ P PP PPPP+ PP Sbjct: 371 PPPPYVYSSPPPPPYVYK---SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY 427 Query: 572 XPPPXPXFXLPRP 610 PP P + P Sbjct: 428 KSPPPPPYVYSSP 440 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/73 (28%), Positives = 26/73 (35%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PPP PP P ++ P PP PPPP+ PP Sbjct: 71 PPPPYVYSSPPPPPYIYK---SPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVY 127 Query: 572 XPPPXPXFXLPRP 610 PP P + P Sbjct: 128 KSPPPPPYVYNSP 140 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/86 (29%), Positives = 29/86 (33%), Gaps = 5/86 (5%) Frame = +2 Query: 368 KKPPXRPX-----PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP 532 K PP P P P + PPP PP P + P PP PPPP Sbjct: 88 KSPPPPPYVYSSPPPPPYIYKSPPPPPYVYS---SPPPPPYVYKSPPPPPYVYNSPPPPP 144 Query: 533 FXTPXXXPPQXPTXPPPXPXFXLPRP 610 + PP PP P + P Sbjct: 145 YVYKSPPPPPYVYSSPPPPPYVYKSP 170 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/73 (28%), Positives = 26/73 (35%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PPP PP P ++ P PP PPPP+ PP Sbjct: 271 PPPPYVYSSPPPPPYVYK---SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY 327 Query: 572 XPPPXPXFXLPRP 610 PP P + P Sbjct: 328 KSPPPPPYVYNSP 340 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/73 (28%), Positives = 26/73 (35%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PPP PP P ++ P PP PPPP+ PP Sbjct: 291 PPPPYVYSSPPPPPYVYK---SPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVY 347 Query: 572 XPPPXPXFXLPRP 610 PP P + P Sbjct: 348 KSPPPPPYVYSSP 360 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/86 (29%), Positives = 29/86 (33%), Gaps = 5/86 (5%) Frame = +2 Query: 368 KKPPXRPX-----PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP 532 K PP P P P + PPP PP P + P PP PPPP Sbjct: 368 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYS---SPPPPPYVYKSPPPPPYVYSSPPPPP 424 Query: 533 FXTPXXXPPQXPTXPPPXPXFXLPRP 610 + PP PP P + P Sbjct: 425 YVYKSPPPPPYVYSSPPPPPYVYKSP 450 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/76 (30%), Positives = 29/76 (38%), Gaps = 3/76 (3%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP---FXTPXXXPPQ 562 P P + PPP +PP P P PPP PPPP + +P P Sbjct: 111 PPPPYVYSSPPPPPYVYK----SPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYV 166 Query: 563 XPTXPPPXPXFXLPRP 610 + PPP + P P Sbjct: 167 YKSPPPPPYVYSSPPP 182 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/76 (30%), Positives = 29/76 (38%), Gaps = 3/76 (3%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP---FXTPXXXPPQ 562 P P + PPP +PP P P PPP PPPP + +P P Sbjct: 311 PPPPYVYSSPPPPPYVYK----SPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYV 366 Query: 563 XPTXPPPXPXFXLPRP 610 + PPP + P P Sbjct: 367 YKSPPPPPYVYSSPPP 382 Score = 38.7 bits (86), Expect = 0.005 Identities = 27/82 (32%), Positives = 32/82 (39%), Gaps = 8/82 (9%) Frame = +2 Query: 368 KKPPXRPX-----PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP 532 K PP P P P + PPP +PP P P PPP PPPP Sbjct: 108 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVY----NSPPPPPYVYKSPPPPPYVYSSPPPP 163 Query: 533 ---FXTPXXXPPQXPTXPPPXP 589 + +P PP + PPP P Sbjct: 164 PYVYKSPPP-PPYVYSSPPPPP 184 Score = 38.7 bits (86), Expect = 0.005 Identities = 27/82 (32%), Positives = 32/82 (39%), Gaps = 8/82 (9%) Frame = +2 Query: 368 KKPPXRPX-----PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP 532 K PP P P P + PPP +PP P P PPP PPPP Sbjct: 128 KSPPPPPYVYNSPPPPPYVYKSPPPPPYVY----SSPPPPPYVYKSPPPPPYVYSSPPPP 183 Query: 533 ---FXTPXXXPPQXPTXPPPXP 589 + +P PP + PPP P Sbjct: 184 PYVYKSPPP-PPYVYSSPPPPP 204 Score = 38.7 bits (86), Expect = 0.005 Identities = 27/82 (32%), Positives = 32/82 (39%), Gaps = 8/82 (9%) Frame = +2 Query: 368 KKPPXRPX-----PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP 532 K PP P P P + PPP +PP P P PPP PPPP Sbjct: 148 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVY----SSPPPPPYVYKSPPPPPYVYSSPPPP 203 Query: 533 ---FXTPXXXPPQXPTXPPPXP 589 + +P PP + PPP P Sbjct: 204 PYVYKSPPP-PPYVYSSPPPPP 224 Score = 38.7 bits (86), Expect = 0.005 Identities = 27/82 (32%), Positives = 32/82 (39%), Gaps = 8/82 (9%) Frame = +2 Query: 368 KKPPXRPX-----PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP 532 K PP P P P + PPP +PP P P PPP PPPP Sbjct: 168 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVY----SSPPPPPYVYKSPPPPPYVYSSPPPP 223 Query: 533 ---FXTPXXXPPQXPTXPPPXP 589 + +P PP + PPP P Sbjct: 224 PYVYKSPPP-PPYVYSSPPPPP 244 Score = 38.7 bits (86), Expect = 0.005 Identities = 27/82 (32%), Positives = 32/82 (39%), Gaps = 8/82 (9%) Frame = +2 Query: 368 KKPPXRPX-----PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP 532 K PP P P P + PPP +PP P P PPP PPPP Sbjct: 188 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVY----SSPPPPPYVYKSPPPPPYVYSSPPPP 243 Query: 533 ---FXTPXXXPPQXPTXPPPXP 589 + +P PP + PPP P Sbjct: 244 PYVYKSPPP-PPYVYSSPPPPP 264 Score = 38.7 bits (86), Expect = 0.005 Identities = 27/82 (32%), Positives = 32/82 (39%), Gaps = 8/82 (9%) Frame = +2 Query: 368 KKPPXRPX-----PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP 532 K PP P P P + PPP +PP P P PPP PPPP Sbjct: 208 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVY----SSPPPPPYVYKSPPPPPYVYSSPPPP 263 Query: 533 ---FXTPXXXPPQXPTXPPPXP 589 + +P PP + PPP P Sbjct: 264 PYVYKSPPP-PPYVYSSPPPPP 284 Score = 38.7 bits (86), Expect = 0.005 Identities = 27/82 (32%), Positives = 32/82 (39%), Gaps = 8/82 (9%) Frame = +2 Query: 368 KKPPXRPX-----PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP 532 K PP P P P + PPP +PP P P PPP PPPP Sbjct: 228 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVY----SSPPPPPYVYKSPPPPPYVYSSPPPP 283 Query: 533 ---FXTPXXXPPQXPTXPPPXP 589 + +P PP + PPP P Sbjct: 284 PYVYKSPPP-PPYVYSSPPPPP 304 Score = 38.7 bits (86), Expect = 0.005 Identities = 27/82 (32%), Positives = 32/82 (39%), Gaps = 8/82 (9%) Frame = +2 Query: 368 KKPPXRPX-----PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP 532 K PP P P P + PPP +PP P P PPP PPPP Sbjct: 248 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVY----SSPPPPPYVYKSPPPPPYVYSSPPPP 303 Query: 533 ---FXTPXXXPPQXPTXPPPXP 589 + +P PP + PPP P Sbjct: 304 PYVYKSPPP-PPYVYSSPPPPP 324 Score = 38.7 bits (86), Expect = 0.005 Identities = 27/84 (32%), Positives = 32/84 (38%), Gaps = 8/84 (9%) Frame = +2 Query: 368 KKPPXRPX-----PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP 532 K PP P P P + PPP +PP P P PPP PPPP Sbjct: 388 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVY----SSPPPPPYVYKSPPPPPYVYSSPPPP 443 Query: 533 ---FXTPXXXPPQXPTXPPPXPXF 595 + +P PP PPP P + Sbjct: 444 PYVYKSPSP-PPYVYKSPPPPPSY 466 Score = 38.3 bits (85), Expect = 0.007 Identities = 19/63 (30%), Positives = 23/63 (36%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXL 601 PPP PP P ++ P PP PPPP+ PP PP P + Sbjct: 360 PPPSPYVYKSP--PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 417 Query: 602 PRP 610 P Sbjct: 418 SSP 420 Score = 37.9 bits (84), Expect = 0.009 Identities = 23/69 (33%), Positives = 28/69 (40%), Gaps = 3/69 (4%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP---FXTPXXXPPQ 562 P P + PPP +PP P P PPP PPPP + +P PP Sbjct: 61 PPPPYIYKSPPPPPYVY----SSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPP-PPY 115 Query: 563 XPTXPPPXP 589 + PPP P Sbjct: 116 VYSSPPPPP 124 Score = 37.9 bits (84), Expect = 0.009 Identities = 25/80 (31%), Positives = 29/80 (36%), Gaps = 6/80 (7%) Frame = +2 Query: 368 KKPPXRPX-----PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP 532 K PP P P P + PPP PP P + P PP PPPP Sbjct: 288 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYS---SPPPPPYVYKSPPPPPYVYNSPPPPP 344 Query: 533 F-XTPXXXPPQXPTXPPPXP 589 + PP + PPP P Sbjct: 345 YVYKSPPPPPYVYSSPPPSP 364 Score = 37.5 bits (83), Expect = 0.012 Identities = 20/73 (27%), Positives = 25/73 (34%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PPP PP P ++ P P PPPP+ PP Sbjct: 331 PPPPYVYNSPPPPPYVYK---SPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVY 387 Query: 572 XPPPXPXFXLPRP 610 PP P + P Sbjct: 388 KSPPPPPYVYSSP 400 Score = 37.5 bits (83), Expect = 0.012 Identities = 20/73 (27%), Positives = 25/73 (34%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PPP PP P ++ P PP PPPP+ PP Sbjct: 391 PPPPYVYSSPPPPPYVYK---SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY 447 Query: 572 XPPPXPXFXLPRP 610 P P + P Sbjct: 448 KSPSPPPYVYKSP 460 Score = 36.7 bits (81), Expect = 0.022 Identities = 27/89 (30%), Positives = 33/89 (37%), Gaps = 8/89 (8%) Frame = +2 Query: 368 KKPPXRPX-----PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP 532 K PP P P P + PPP PP P + P PPP PPPP Sbjct: 328 KSPPPPPYVYNSPPPPPYVYKSPPPPPYVYS---SPPPSPYVYKSPP-PPPYVYSSPPPP 383 Query: 533 ---FXTPXXXPPQXPTXPPPXPXFXLPRP 610 + +P P + PPP + P P Sbjct: 384 PYVYKSPPPPPYVYSSPPPPPYVYKSPPP 412 Score = 35.5 bits (78), Expect = 0.050 Identities = 26/89 (29%), Positives = 32/89 (35%), Gaps = 8/89 (8%) Frame = +2 Query: 368 KKPPXRPX-----PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPP- 529 K PP P P P + PPP +PP P P PPP PPP Sbjct: 268 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVY----SSPPPPPYVYKSPPPPPYVYSSPPPP 323 Query: 530 --PFXTPXXXPPQXPTXPPPXPXFXLPRP 610 + +P P + PPP + P P Sbjct: 324 PYVYKSPPPPPYVYNSPPPPPYVYKSPPP 352 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/55 (32%), Positives = 22/55 (40%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPPX----XXPPPXXXRPPXP 812 + P P + PPP P +P PP PPPP PPP + P P Sbjct: 408 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPP 462 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP + P P Sbjct: 100 PPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPP 152 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP + P P Sbjct: 120 PPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 172 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP + P P Sbjct: 140 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 192 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP + P P Sbjct: 160 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 212 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP + P P Sbjct: 180 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 232 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP + P P Sbjct: 200 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 252 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP + P P Sbjct: 220 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 272 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP + P P Sbjct: 240 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 292 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP + P P Sbjct: 260 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 312 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP + P P Sbjct: 280 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 332 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP + P P Sbjct: 300 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPP 352 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP + P P Sbjct: 380 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 432 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP + P P Sbjct: 400 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSP 452 Score = 31.5 bits (68), Expect = 0.81 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP + P P Sbjct: 60 PPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPP 112 Score = 31.5 bits (68), Expect = 0.81 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP PPP + P P Sbjct: 80 PPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPP 132 Score = 31.5 bits (68), Expect = 0.81 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 + P P + PPP P +P PP PPPP PPP P P Sbjct: 88 KSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPP 142 Score = 31.5 bits (68), Expect = 0.81 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 + P P + PPP P +P PP PPPP PPP P P Sbjct: 288 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPP 342 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 + P P + PPP P +P PP PPPP PPP P P Sbjct: 68 KSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPP 122 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPPX----XXPPPXXXRPPXP 812 + P P + PPP P +P PP PPPP PPP P P Sbjct: 108 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPP 162 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 + P P + PPP P +P PP PPPP PPP P P Sbjct: 128 KSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 182 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 + P P + PPP P +P PP PPPP PPP P P Sbjct: 148 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 202 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 + P P + PPP P +P PP PPPP PPP P P Sbjct: 168 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 222 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 + P P + PPP P +P PP PPPP PPP P P Sbjct: 188 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 242 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 + P P + PPP P +P PP PPPP PPP P P Sbjct: 208 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 262 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 + P P + PPP P +P PP PPPP PPP P P Sbjct: 228 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 282 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 + P P + PPP P +P PP PPPP PPP P P Sbjct: 248 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 302 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 + P P + PPP P +P PP PPPP PPP P P Sbjct: 268 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 322 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 + P P + PPP P +P PP PPPP PPP P P Sbjct: 308 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPP 362 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPPX----XXPPPXXXRPPXP 812 + P P + PPP P +P PP PPPP PPP P P Sbjct: 348 KSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 402 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 + P P + PPP P +P PP PPPP PPP P P Sbjct: 368 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 422 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP----XXXPPPXXXRPPXP 812 + P P + PPP P +P PP PPPP PPP P P Sbjct: 388 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 442 Score = 31.1 bits (67), Expect = 1.1 Identities = 23/73 (31%), Positives = 26/73 (35%), Gaps = 6/73 (8%) Frame = +2 Query: 368 KKPPXRPX-----PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXX-PXXPPP 529 K PP P P P + PPP +PP P PSPPP PPP Sbjct: 408 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVY----SSPPPPPYVYKSPSPPPYVYKSPPPP 463 Query: 530 PFXTPXXXPPQXP 568 P + P P Sbjct: 464 PSYSYSYSSPPPP 476 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP--TPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P + PPP P +PP P PPP PP PP P Sbjct: 340 PPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPP---PPYVYSSPPPP 383 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P + PPP +PP P PPP PP PP P Sbjct: 42 PPTHIYSSPPPPPYVYSSPPPPPYIYKSPPP---PPYVYSSPPPP 83 Score = 29.5 bits (63), Expect = 3.3 Identities = 19/54 (35%), Positives = 21/54 (38%), Gaps = 9/54 (16%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPP--XXXPPP---XXXRPPXP 812 P P + PPP P +P PP PPPP PPP PP P Sbjct: 320 PPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPP 373 Score = 29.5 bits (63), Expect = 3.3 Identities = 19/69 (27%), Positives = 25/69 (36%), Gaps = 3/69 (4%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXX---PXXPPPPFXTPXXXPPQ 562 P P + PPP +PP P + P PPP P PP + +P P Sbjct: 411 PPPPYVYSSPPPPPYVYK----SPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPPSY 466 Query: 563 XPTXPPPXP 589 + P P Sbjct: 467 SYSYSSPPP 475 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/45 (33%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +2 Query: 458 APPXPXXRATXPSPPPXXPXXPPPPFX-TPXXXPPQXPTXPPPXP 589 +PP P P P PPPP+ + PP PPP P Sbjct: 31 SPPSPPSYVYKP-PTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPP 74 Score = 27.9 bits (59), Expect = 10.0 Identities = 17/55 (30%), Positives = 20/55 (36%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPT--PTPPXXPXXXXPPPP------XXXPPPXXXRPPXP 812 + P P + PPP P +PP P PPP PPP P P Sbjct: 328 KSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPP 382 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/61 (39%), Positives = 24/61 (39%), Gaps = 7/61 (11%) Frame = +2 Query: 458 APPXPXXRATXPS---PPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXL----PRPXX 616 APP P PS PP P PPP P PP P P P P L PRP Sbjct: 369 APPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPS 428 Query: 617 G 619 G Sbjct: 429 G 429 Score = 37.1 bits (82), Expect = 0.016 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 PPP P P P PPPP P +PP P P Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGP 408 Score = 36.7 bits (81), Expect = 0.022 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAP-PXPXXRATXPSPPPXXPXXPPPP 532 PP P P P G PP G G P P P P PPP P P Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAP 424 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPL 815 PP P P PP PPPP P P RPP P+ Sbjct: 385 PPRPPPPAPPPGSGGPKPPPP---PGPKGPRPPPPM 417 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PP P P P P PP PPP P P P R P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +3 Query: 699 PXXPPPX---PTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P PPP P P PP P PPPP P P P Sbjct: 390 PPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +2 Query: 458 APPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPP 583 +P P R+ P PP P PPP PP PPP Sbjct: 149 SPSRPPKRSRGPPRPPTRPKSPPP---RKSSFPPSRSPPPPP 187 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 6/42 (14%) Frame = +3 Query: 699 PXXPPPXPT-----PTPPXXPXXXXP-PPPXXXPPPXXXRPP 806 P PPP P P PP P P PPP P RPP Sbjct: 386 PRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPP 427 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = +2 Query: 749 PPXPPP----PXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP PPP P PPP P P P AP P Sbjct: 390 PPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRP 426 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/58 (29%), Positives = 18/58 (31%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGG 634 PP P S P P P P P P P P P P+P G G Sbjct: 353 PPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKG 410 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P P+ P P PPP P P PP P P P Sbjct: 373 PVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPP--PPGPKGPRPPP 415 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXKHNSS 865 PP PP PPP + P S S PP A NS+ Sbjct: 160 PPRPPTRPKSPPPR-KSSFPPSRSPPPPPAKKNASKNST 197 Score = 27.9 bits (59), Expect = 10.0 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPP 502 PP P P P G PP G PP P PP Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPP 427 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/61 (39%), Positives = 24/61 (39%), Gaps = 7/61 (11%) Frame = +2 Query: 458 APPXPXXRATXPS---PPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXL----PRPXX 616 APP P PS PP P PPP P PP P P P P L PRP Sbjct: 369 APPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPS 428 Query: 617 G 619 G Sbjct: 429 G 429 Score = 37.1 bits (82), Expect = 0.016 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 PPP P P P PPPP P +PP P P Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGP 408 Score = 36.7 bits (81), Expect = 0.022 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAP-PXPXXRATXPSPPPXXPXXPPPP 532 PP P P P G PP G G P P P P PPP P P Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAP 424 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPL 815 PP P P PP PPPP P P RPP P+ Sbjct: 385 PPRPPPPAPPPGSGGPKPPPP---PGPKGPRPPPPM 417 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PP P P P P PP PPP P P P R P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +3 Query: 699 PXXPPPX---PTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P PPP P P PP P PPPP P P P Sbjct: 390 PPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +2 Query: 458 APPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPP 583 +P P R+ P PP P PPP PP PPP Sbjct: 149 SPSRPPKRSRGPPRPPTRPKSPPP---RKSSFPPSRSPPPPP 187 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 6/42 (14%) Frame = +3 Query: 699 PXXPPPXPT-----PTPPXXPXXXXP-PPPXXXPPPXXXRPP 806 P PPP P P PP P P PPP P RPP Sbjct: 386 PRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPP 427 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = +2 Query: 749 PPXPPP----PXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP PPP P PPP P P P AP P Sbjct: 390 PPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRP 426 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/58 (29%), Positives = 18/58 (31%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGG 634 PP P S P P P P P P P P P P+P G G Sbjct: 353 PPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKG 410 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P P+ P P PPP P P PP P P P Sbjct: 373 PVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPP--PPGPKGPRPPP 415 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXKHNSS 865 PP PP PPP + P S S PP A NS+ Sbjct: 160 PPRPPTRPKSPPPR-KSSFPPSRSPPPPPAKKNASKNST 197 Score = 27.9 bits (59), Expect = 10.0 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPP 502 PP P P P G PP G PP P PP Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPP 427 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 5/55 (9%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTX-----PPPXPXFXLPRP 610 PP P R P PPP PPPP PP P PPP P LPRP Sbjct: 18 PPPPLMRRRAPLPPP-----PPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRP 67 Score = 37.5 bits (83), Expect = 0.012 Identities = 22/66 (33%), Positives = 27/66 (40%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTP 544 +++ P P P PL+ PPP PP P R P PP PPPP P Sbjct: 24 RRRAPLPPPPPPPLMRRRAPPP----------PPPPLMRRRAPPPP------PPPPLPRP 67 Query: 545 XXXPPQ 562 PP+ Sbjct: 68 CSRPPK 73 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +3 Query: 714 PXPTPTPPXXPXXXXPPPPXXXPPPXXXR---PPXPLXPXXHPGRHXP 848 P P P PP PPPP PPP R PP P P P P Sbjct: 28 PLPPPPPPPLMRRRAPPPP---PPPLMRRRAPPPPPPPPLPRPCSRPP 72 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = +3 Query: 699 PXXPPP-----XPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P PPP P P PP P PP PP R P P P P Sbjct: 16 PPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLP 65 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +3 Query: 714 PXPTPTPPXXPXXXXPPPPXXXPPPXXXR--PPXPLXP 821 P P P PP PPP PPP R PP P P Sbjct: 14 PLPPPPPPLMRRRAPLPPP--PPPPLMRRRAPPPPPPP 49 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/68 (32%), Positives = 24/68 (35%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P L PPP PP P + P PP PPPPF PP Sbjct: 56 PPSPYLYSSPPPPPYVY--NSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTYIY 113 Query: 572 XPPPXPXF 595 PP P + Sbjct: 114 NSPPPPPY 121 Score = 37.1 bits (82), Expect = 0.016 Identities = 25/86 (29%), Positives = 30/86 (34%), Gaps = 5/86 (5%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXX----PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP-PP 532 + PP +P P L PPP PP P + P PPP PP PP Sbjct: 33 QSPPPQPYVYSPPLPSPYVYKSPPPSPYLYSSP--PPPPYVYNSPPPPPPYIYNSPPRPP 90 Query: 533 FXTPXXXPPQXPTXPPPXPXFXLPRP 610 + PP PP P + P Sbjct: 91 YVYKSPPPPPFVYSSPPPPTYIYNSP 116 Score = 30.3 bits (65), Expect = 1.9 Identities = 24/87 (27%), Positives = 27/87 (31%), Gaps = 6/87 (6%) Frame = +2 Query: 368 KKPPXRPX-----PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXX-PXXPPP 529 K PP P P P + PPP +PP P P PPP PPP Sbjct: 53 KSPPPSPYLYSSPPPPPYVYNSPPPPPPYIY---NSPPRPPYVYKSPPPPPFVYSSPPPP 109 Query: 530 PFXTPXXXPPQXPTXPPPXPXFXLPRP 610 + PP P F P Sbjct: 110 TYIYNSPPPPPYVYKSVPRITFIYSSP 136 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P PPP +PP P PPP PP PP P Sbjct: 75 PPPPPPYIYNSPPRPPYVYKSPPP---PPFVYSSPPPP 109 Score = 29.1 bits (62), Expect = 4.3 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +3 Query: 678 PXLPX-FCPXXPPPXPT--PTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P LP + PPP P +PP P PPP PP PP P Sbjct: 44 PPLPSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPP--PPYIYNSPPRP 89 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 40.3 bits (90), Expect = 0.002 Identities = 26/79 (32%), Positives = 28/79 (35%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP + PL PPP PP P R+ S PP PPP P Sbjct: 43 PPPQVFVPEPLFSEPPPPPKAPVNVSLSPPPPP--RSPSTSTPPRLGNRNPPP---PASP 97 Query: 554 PPQXPTXPPPXPXFXLPRP 610 Q PT P P F L P Sbjct: 98 SGQEPTTPTMTPGFSLSPP 116 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 40.3 bits (90), Expect = 0.002 Identities = 40/147 (27%), Positives = 40/147 (27%) Frame = -2 Query: 831 GGXXXXEXGXAXXGXGGGXXXGGGGXGGXXXXXXXXXXXXXXXXGKKXEGXGXXRXXXXX 652 GG G G GGG GG G GG G G Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNRS 61 Query: 651 XXXXGRPPXPXPXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXX 472 P G G G GGG G GG G GGG G GGG Sbjct: 62 SYISRDNFESDPKGGSGGGGKGGGGGG-GISGGGAGGKSGCGGGKSGGGGGGGKNGGGCG 120 Query: 471 GXGGAPXPXXXXXXGGGXXPPKRGXXG 391 G GG GGG G G Sbjct: 121 GGGGGKGGKSGGGSGGGGYMVAPGSNG 147 Score = 39.9 bits (89), Expect = 0.002 Identities = 27/77 (35%), Positives = 28/77 (36%) Frame = -2 Query: 603 GRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGG 424 G K G GGG G GG G KGG G G GGG G G Sbjct: 11 GGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGS--NRSSYISRDN 68 Query: 423 GXXPPKRGXXGXGRXGG 373 PK G G G+ GG Sbjct: 69 FESDPKGGSGGGGKGGG 85 Score = 38.3 bits (85), Expect = 0.007 Identities = 40/145 (27%), Positives = 41/145 (28%) Frame = -2 Query: 807 GXAXXGXGGGXXXGGGGXGGXXXXXXXXXXXXXXXXGKKXEGXGXXRXXXXXXXXXGRPP 628 G G GGG GGGG G G G G R Sbjct: 3 GKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNRSS 62 Query: 627 XPXPXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXP 448 K G GGG G GG GGGG G GG+ GG Sbjct: 63 YISRDNFESDPKGGSGGGGKG--GG-------GGGGISGGGAGGKSGCGGGKSGGGGGGG 113 Query: 447 XXXXXXGGGXXPPKRGXXGXGRXGG 373 GGG K G G G GG Sbjct: 114 KNGGGCGGGGG-GKGGKSGGGSGGG 137 Score = 37.1 bits (82), Expect = 0.016 Identities = 38/144 (26%), Positives = 40/144 (27%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXGRXXXXXXXXXX 653 G G +G GG GGG GGGG G GG G GGG G Sbjct: 8 GSGGGGKGGGG-GGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNRSSYISR 66 Query: 652 XXXXGETPXPXXPXGXGXXKXGXXGGXSGVLGRXXXXXXXXXXXXXXXXXXXXXGCXXXX 473 + P G G G GG SG GC Sbjct: 67 DNFESD---PKGGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGG 123 Query: 472 GGWGGXPPXGXXXXGGGXXPPQKG 401 GG GG G G P G Sbjct: 124 GGKGGKSGGGSGGGGYMVAPGSNG 147 Score = 36.7 bits (81), Expect = 0.022 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G G G GG GG GGGG G GG G GGG G Sbjct: 6 GSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGG 50 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G GG GGG GGGG GG G GG G K G Sbjct: 3 GKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSG 44 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G G GGG GGGG G GG G G GG G Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGG 39 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 787 GGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 GG G GG G GG G G GGG G G Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKG 35 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -1 Query: 838 RPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 + G G G GG GG GGGG G G G G GGG Sbjct: 98 KSGCGGGKSGGGGGGGKNGGGCGGGGG----GKGGKSGGGSGGG 137 Score = 29.5 bits (63), Expect = 3.3 Identities = 20/53 (37%), Positives = 23/53 (43%) Frame = -2 Query: 531 GGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPPKRGXXGXGRXGG 373 GG G G GGG+G G GG+ GGG K G G G+ GG Sbjct: 2 GGKGGSGSGGGGKGG-----GGGGS----GGGRGGGGGGGAKGGCGGGGKSGG 45 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 40.3 bits (90), Expect = 0.002 Identities = 29/86 (33%), Positives = 30/86 (34%), Gaps = 4/86 (4%) Frame = -2 Query: 618 PXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXX----GXXGGGEGXVARXXGXGGAPX 451 P G G G GGG V GG G G GG G GGG G + G GG Sbjct: 112 PGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGG 171 Query: 450 PXXXXXXGGGXXPPKRGXXGXGRXGG 373 GGG G G GG Sbjct: 172 IGGGVIIGGGGGGCGGSCSGGGGGGG 197 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/50 (42%), Positives = 22/50 (44%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G PG+ G G GG GGG GGGG G G G G GG G Sbjct: 153 GGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHG 202 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 GW G G G GGG GGGG GG G G GG G G Sbjct: 147 GWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGG 195 Score = 37.1 bits (82), Expect = 0.016 Identities = 26/72 (36%), Positives = 26/72 (36%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPP 409 G GGG G GG G GGGG GGG G A GG G G Sbjct: 106 GYGGGGPGYGGG---GYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSG 162 Query: 408 KRGXXGXGRXGG 373 G G G GG Sbjct: 163 GGGIGGGGGIGG 174 Score = 35.9 bits (79), Expect = 0.038 Identities = 20/43 (46%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -1 Query: 820 GXRGWGGRXXXGG-GXXXGGGG-XXXXGXXGGVGVGXGGGXXG 698 G GW G GG G GGGG G GGV +G GGG G Sbjct: 144 GGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCG 186 Score = 35.9 bits (79), Expect = 0.038 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVX-KGGGGXXGXXGGGEGXVARXXGXGG 460 G G G GGG +G GG GV GGGG G G G G GG Sbjct: 153 GGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHGG 203 Score = 34.7 bits (76), Expect = 0.087 Identities = 21/54 (38%), Positives = 23/54 (42%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G PG+ G G GG GGG GGG G G G+G GG G G Sbjct: 108 GGGGPGYGGGGYGPGG---GGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPG 158 Score = 33.9 bits (74), Expect = 0.15 Identities = 27/84 (32%), Positives = 29/84 (34%), Gaps = 1/84 (1%) Frame = -2 Query: 618 PXXGRGRXKXGXG-GGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXX 442 P G G G G GG G G G G GG G G G + G GG Sbjct: 121 PGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGG---VI 177 Query: 441 XXXXGGGXXPPKRGXXGXGRXGGF 370 GGG G G G GG+ Sbjct: 178 IGGGGGGCGGSCSGGGGGG--GGY 199 Score = 32.7 bits (71), Expect = 0.35 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXX 430 G G G GGG G GG V GGG G G G G G G P Sbjct: 106 GYGGGGPGYGGGGYGPGGGGGGVVI--GGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGG 163 Query: 429 GG 424 GG Sbjct: 164 GG 165 Score = 32.3 bits (70), Expect = 0.46 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXG-----GGGXXXXGXXGGVGVGXGGGXXG 698 G G G GG GGG G GGG G GG G G G G G Sbjct: 116 GGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGG 165 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXX-XGGGG--XXXXGXXGGVGVGXGGG 707 G G GG GGG GGGG G GG G G GGG Sbjct: 105 GGYGGGGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGG 145 Score = 31.1 bits (67), Expect = 1.1 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 3/65 (4%) Frame = -2 Query: 558 GGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGA---PXPXXXXXXGGGXXPPKRGXXGX 388 GG G GGG G GGG G V GGA G G P G G Sbjct: 105 GGYGGGGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGG 164 Query: 387 GRXGG 373 G GG Sbjct: 165 GIGGG 169 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G G G+G G GGGG GG G+G GGG G Sbjct: 132 GGFGGGAGYGSGGGLGWDGGNGGGGPGYGS--GGGGIGGGGGIGG 174 Score = 30.3 bits (65), Expect = 1.9 Identities = 20/51 (39%), Positives = 22/51 (43%), Gaps = 5/51 (9%) Frame = -2 Query: 618 PXXGRGRXKXGXGGGX-----VGXWGGXXXGVXKGGGGXXGXXGGGEGXVA 481 P G G G GGG +G GG G GGGG G G G G V+ Sbjct: 157 PGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGG--GGGGYGHGGVS 205 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 PPP P P PP PPPP PPP R P P P Sbjct: 24 PPPPPPPPPPMRRRAPLPPPP---PPPMRRRAPLPPPP 58 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 7/52 (13%) Frame = +2 Query: 461 PPXPXXRATXPSPPP-------XXPXXPPPPFXTPXXXPPQXPTXPPPXPXF 595 PP P R P PPP P PPPP P+ P PPP P F Sbjct: 29 PPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPPLPMF 80 Score = 36.7 bits (81), Expect = 0.022 Identities = 23/63 (36%), Positives = 24/63 (38%), Gaps = 9/63 (14%) Frame = +2 Query: 449 GXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPP------QXPTXPPPXPXF---XL 601 G A P R P PPP P PP P PP + P PPP P L Sbjct: 8 GADAVVSPPMRGRVPLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVL 67 Query: 602 PRP 610 PRP Sbjct: 68 PRP 70 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 729 TPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 +PP PPPP PPP R P P P R P Sbjct: 14 SPPMRGRVPLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAP 53 Score = 32.7 bits (71), Expect = 0.35 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 5/60 (8%) Frame = +3 Query: 669 GRXPXLPXFCPXXPP-----PXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 GR P P P PP P P P PP PPP PPP R P P P Sbjct: 19 GRVPLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPP---PPPAMRRRVLPRPPPPPP 75 Score = 27.9 bits (59), Expect = 10.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP PPPP P P P P P P Sbjct: 27 PPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPP 59 Score = 27.9 bits (59), Expect = 10.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP PPPP P P P P P P Sbjct: 41 PPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPP 73 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 39.9 bits (89), Expect = 0.002 Identities = 24/91 (26%), Positives = 26/91 (28%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPP 737 P TP PP P P P + P P PPP P +P Sbjct: 85 PSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSPS 144 Query: 738 XXPXXXXPPPPXXXPPPXXXRPPXPLXPXXH 830 P P P PPP P P H Sbjct: 145 T-PSLPPPTPKKSPPPPPSHHSSSPSNPPHH 174 Score = 37.1 bits (82), Expect = 0.016 Identities = 25/78 (32%), Positives = 28/78 (35%), Gaps = 7/78 (8%) Frame = +2 Query: 377 PXRPXPXXPLLGGXXPPPXXXXXXGXGA----PPXPXXRATXPSPPPXXPXXPPPPFX-- 538 P P P P PPP + P P + + PSPPP PP P Sbjct: 85 PSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKS-PSPPPTPSLPPPAPKKSP 143 Query: 539 -TPXXXPPQXPTXPPPXP 589 TP PP PPP P Sbjct: 144 STPSLPPPTPKKSPPPPP 161 Score = 37.1 bits (82), Expect = 0.016 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXP-XXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P A SPPP P P PP TP P P P P LP P Sbjct: 88 PSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPP 137 Score = 34.7 bits (76), Expect = 0.087 Identities = 18/58 (31%), Positives = 20/58 (34%), Gaps = 1/58 (1%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPP-PXXXPPPXXXRPPXPLXPXXHPGRH 842 + P P P P P P +P P PPP P P PP P P H Sbjct: 106 KSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPPPSH 163 Score = 33.9 bits (74), Expect = 0.15 Identities = 24/77 (31%), Positives = 25/77 (32%), Gaps = 2/77 (2%) Frame = +2 Query: 365 KKKPPXRPX--PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFX 538 K PP P P P L P P PP P P P P PPP Sbjct: 97 KSPPPPTPKKSPSPPSLTPFVPHPTPKK--SPSPPPTPSLPPPAPKKSPSTPSLPPP--- 151 Query: 539 TPXXXPPQXPTXPPPXP 589 TP PP P+ P Sbjct: 152 TPKKSPPPPPSHHSSSP 168 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQ-XPTXPPPXP 589 P P +T PPP PPPP PP P P P P Sbjct: 80 PIPSTPSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTP 122 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P P PP PTP P P P P PP P P P Sbjct: 88 PSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAP 139 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/59 (28%), Positives = 21/59 (35%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGL 637 PP P + PS PP P PPP + P P P + R G G+ Sbjct: 136 PPAPKKSPSTPSLPPPTPKKSPPPPPSHHSSSPSNPPHHQQNPWEHIERCMINMGPVGM 194 Score = 31.5 bits (68), Expect = 0.81 Identities = 18/51 (35%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXR-PPXPLXPXXHPGRHXP 848 P P P PTP P PPP PPP + P P P P + P Sbjct: 111 PSLTPFVPHPTPKKSPS---PPPTPSLPPPAPKKSPSTPSLPPPTPKKSPP 158 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P P+ P P P P PPP + P P Sbjct: 77 PSTPIPSTPSTPSPPPPAPKKSPPPPTPKKSPSP 110 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -2 Query: 603 GRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGG 460 G + G GG G WGG G GGGG G GGEG G GG Sbjct: 30 GEEEWGGAGG--GEWGGAEGGGAWGGGGGGGGAWGGEGEGGGEWGGGG 75 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -2 Query: 603 GRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEG 490 G G GGG G WGG G + GGG G GG G Sbjct: 47 GGGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGGGGRRG 84 Score = 35.5 bits (78), Expect = 0.050 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G W G G WGG GGG GG G GG G G GGG G Sbjct: 40 GEW--GGAEGGGAWGG---GGGGGGAWGGEGEGGGEWGGGGEGGGGGRRG 84 Score = 33.1 bits (72), Expect = 0.26 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXGR 683 G WGG GG GGGG G G G GGG G GR Sbjct: 38 GGGEWGGAEG-GGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGGGGR 82 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGV--GVGXGGGXXG 698 G WGG G GGG G GG G G GGG G Sbjct: 30 GEEEWGGAGGGEWGGAEGGGAWGGGGGGGGAWGGEGEGGGEWG 72 Score = 29.1 bits (62), Expect = 4.3 Identities = 20/58 (34%), Positives = 21/58 (36%) Frame = -2 Query: 543 GVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPPKRGXXGXGRXGGF 370 G + GG G GG EG A G GG GGG G GR G F Sbjct: 30 GEEEWGGAGGGEWGGAEGGGA-WGGGGGGGGAWGGEGEGGGEWGGGGEGGGGGRRGWF 86 Score = 29.1 bits (62), Expect = 4.3 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = -2 Query: 588 GXGGGXVGXW-GGXXXGVXKGGGGXXG--XXGGGEGXVARXXGXGG 460 G GGG G GG G GGGG G GGGE G GG Sbjct: 36 GAGGGEWGGAEGGGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGGGG 81 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +3 Query: 696 CPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP 788 C PPP P+P PP P PPPP PPP Sbjct: 55 CIQNPPP-PSPPPPSPPPPACPPPPALPPPP 84 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXP 589 PP P PSPPP P PPPP P PPP P Sbjct: 59 PPPPSP--PPPSPPP--PACPPPPALPPPPPKKVSSYCPPPPP 97 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXR---PPXP 812 P PP P+P PP P PPP PPP PP P Sbjct: 60 PPPSPPPPSPPPPACP----PPPALPPPPPKKVSSYCPPPP 96 Score = 31.9 bits (69), Expect = 0.61 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +2 Query: 494 SPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXP 589 +PPP P P PP P PP P PPP P Sbjct: 58 NPPPPSPPPPSPP---PPACPP-PPALPPPPP 85 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 P P PP P PPPP PPP PP Sbjct: 53 PSCIQNPPPPSPPP-PSPPPPACPPPPALPPPP 84 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAP 841 PP PPPP PPP P S P P Sbjct: 66 PPSPPPPACPPPPALPPPPPKKVSSYCPPPP 96 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +2 Query: 758 PPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXKHNSSF 868 PPPP PP P A P + PP P K SS+ Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPP----PPKKVSSY 91 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPP----XXXPPP 788 P P P PPP P PP P PPPP PPP Sbjct: 59 PPPPSPPPPSPPPPACPPPPALP----PPPPKKVSSYCPPP 95 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 458 APPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXP 568 +PP P PPP P PPPP PP P Sbjct: 63 SPPPPSPPPPACPPPPALP--PPPPKKVSSYCPPPPP 97 Score = 27.9 bits (59), Expect = 10.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPP 770 P CP PP P P P PPPP Sbjct: 71 PPACPP-PPALPPPPPKKVSSYCPPPPP 97 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G+ G G+GG GGG GG G GG G GGG G G Sbjct: 129 GYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAG 177 Score = 35.5 bits (78), Expect = 0.050 Identities = 27/82 (32%), Positives = 28/82 (34%), Gaps = 2/82 (2%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVA--RXXGXGGAPXPXXXX 436 G G G GGG G G G GG G G GGG G G GG Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGG 181 Query: 435 XXGGGXXPPKRGXXGXGRXGGF 370 GG G G G GG+ Sbjct: 182 SGAGGYGGDATGHGGAG--GGY 201 Score = 34.7 bits (76), Expect = 0.087 Identities = 28/80 (35%), Positives = 30/80 (37%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXX 430 G G G GG G +GG G G GG G GGG G A G GG+ Sbjct: 134 GGGYGGSGGYGGGAGGYGG-SGGYGGGAGGYGGNSGGGYGGNA-AGGYGGS----GAGGY 187 Query: 429 GGGXXPPKRGXXGXGRXGGF 370 GG G G GGF Sbjct: 188 GGDATGHGGAGGGYGSSGGF 207 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G+GG GG GGG G GG G G GG G G Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYG-GGAGGYGGNSGG 169 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G G G+GG GG GG G G GG G G GG Sbjct: 148 GGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGG 189 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGG-GGXXXXGXXGGVGVGXGGGXXGQKXG 686 G+ G G GG G G GG GG G GG G GG G G Sbjct: 124 GFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGG 173 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/52 (34%), Positives = 20/52 (38%), Gaps = 3/52 (5%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGG---GXXXXGXXGGVGVGXGGGXXGQKXG 686 G+ G G+GG GGG GG G GG G GG G G Sbjct: 142 GYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATG 193 Score = 29.5 bits (63), Expect = 3.3 Identities = 21/77 (27%), Positives = 21/77 (27%) Frame = -2 Query: 603 GRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGG 424 G G G G G GG G GG G GG G GG G Sbjct: 139 GSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAG 198 Query: 423 GXXPPKRGXXGXGRXGG 373 G G G G Sbjct: 199 GGYGSSGGFGSSGNTYG 215 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G G G GG G GG G GG G G Sbjct: 141 GGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAG 185 Score = 27.9 bits (59), Expect = 10.0 Identities = 19/51 (37%), Positives = 21/51 (41%), Gaps = 6/51 (11%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXG-GGXXXGGGGXXXXGXXGGV-----GVGXGGGXXG 698 G+ G G+GG G GG GG G G GG G G G G G Sbjct: 155 GYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGGGYGSSG 205 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/70 (30%), Positives = 25/70 (35%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXX 550 +PP +P P P PPP G P + + P PP P PPP P Sbjct: 325 QPPYQPPPQQPQYP-QQPPPQLQHPSGYNPEEPPYPQQSYPPNPPRQPPSHPPPGSAPSQ 383 Query: 551 XPPQXPTXPP 580 P PP Sbjct: 384 QYYNAPPTPP 393 Score = 30.7 bits (66), Expect = 1.4 Identities = 20/81 (24%), Positives = 21/81 (25%), Gaps = 1/81 (1%) Frame = +3 Query: 678 PXLPXFCPXXPPPX-PTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXPXN 854 P P PPP P P P PP PP P P HP + P Sbjct: 296 PYFPPSGQSQPPPTIQPPYQPPPPTQSLHQPPYQPPPQQPQYPQQPPPQLQHPSGYNPEE 355 Query: 855 TIXXXXXXXXXXXXXPPQKXP 917 PP P Sbjct: 356 PPYPQQSYPPNPPRQPPSHPP 376 Score = 30.7 bits (66), Expect = 1.4 Identities = 24/75 (32%), Positives = 25/75 (33%), Gaps = 9/75 (12%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXP--SPPPXX---PXXPPPPFXTPXXXP 556 P P G PPP PP P P PPP P PPP P Sbjct: 296 PYFPPSGQSQPPPTIQPPY---QPPPPTQSLHQPPYQPPPQQPQYPQQPPPQLQHPSGYN 352 Query: 557 PQXPTXP----PPXP 589 P+ P P PP P Sbjct: 353 PEEPPYPQQSYPPNP 367 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G GGR GGG GGGG G GG G GGG Sbjct: 90 GGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGG 460 G GGG G GG G GGGG G GGG G + G GG Sbjct: 86 GSGGGGGGR-GGSGGGYRSGGGG--GYSGGGGGGYSGGGGGGG 125 Score = 33.1 bits (72), Expect = 0.26 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 814 RGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 RG GG GGG G GG G GG G GGG G G Sbjct: 85 RGSGG----GGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGG 123 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = -2 Query: 606 RGRXKXGXGGGXVGXWGGXXXGVXKG--GGGXXGXXGGGEG 490 + R G GGG G GG G G GGG G GGG G Sbjct: 83 QSRGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGG 123 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEG 490 G G G GG G G G GGGG GGG G Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGG 125 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGG 731 G G G G R GGG GGGG G GG Sbjct: 91 GGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 831 GGXXXXEXGXAXXGXGGGXXXGGGGXGG 748 GG G G GGG GGGG GG Sbjct: 98 GGGYRSGGGGGYSGGGGGGYSGGGGGGG 125 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 39.5 bits (88), Expect = 0.003 Identities = 25/79 (31%), Positives = 27/79 (34%), Gaps = 2/79 (2%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P G PP G+PP + PP P PP P Sbjct: 481 PPSSPTTPTP---GGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVP--S 535 Query: 554 PPQXPTXP--PPXPXFXLP 604 PP PT P PP P P Sbjct: 536 PPSTPTSPGSPPSPSSPTP 554 Score = 37.9 bits (84), Expect = 0.009 Identities = 35/146 (23%), Positives = 39/146 (26%), Gaps = 4/146 (2%) Frame = +3 Query: 423 PPPXXXXPXGGXPPXPPXXXXXXXXXXXXXXXXXXXXXXXXXXXRPXTPLXPPXXPXXXX 602 P P GG PP P P +P P P Sbjct: 437 PSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPT--PGGSP 494 Query: 603 PXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXP 782 P G S G P P P PP P+PP P PP P Sbjct: 495 PSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPS--PPITVPSPPSTPTSPGSPPSPSSP 552 Query: 783 PP--XXXRPPXPLXP--XXHPGRHXP 848 P PP P P PG++ P Sbjct: 553 TPSSPIPSPPTPSTPPTPISPGQNSP 578 Score = 37.9 bits (84), Expect = 0.009 Identities = 29/80 (36%), Positives = 30/80 (37%), Gaps = 8/80 (10%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXR----ATXPSPP--PXXPXXPP-PP 532 PP P P G PP G+PP P T PSPP P P PP P Sbjct: 494 PPSSPTTPTP---GGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPS 550 Query: 533 FXTPXXXPPQXPT-XPPPXP 589 TP P PT PP P Sbjct: 551 SPTPSSPIPSPPTPSTPPTP 570 Score = 37.5 bits (83), Expect = 0.012 Identities = 26/74 (35%), Positives = 28/74 (37%), Gaps = 9/74 (12%) Frame = +2 Query: 377 PXRPXPXXPLLGGXXPP-PXXXXXXGXGAPPX-PXXRATXPSP-----PPXXPXXPPPPF 535 P P P P+ P P G +PP P T PSP PP P P PP Sbjct: 549 PSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPPI 608 Query: 536 --XTPXXXPPQXPT 571 TP PP PT Sbjct: 609 VGPTPSSPPPSTPT 622 Score = 37.1 bits (82), Expect = 0.016 Identities = 26/82 (31%), Positives = 26/82 (31%), Gaps = 7/82 (8%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX--PP 559 P P PPP PP P P PPP PPP P PP Sbjct: 703 PPPAPYYYSSPQPPPPPHYSL---PPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPP 759 Query: 560 QXPTX-----PPPXPXFXLPRP 610 PT PPP P P P Sbjct: 760 PPPTVHYNPPPPPSPAHYSPPP 781 Score = 36.7 bits (81), Expect = 0.022 Identities = 25/68 (36%), Positives = 25/68 (36%), Gaps = 4/68 (5%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSP---PPXXPXXPPPPFXTPXXX-PP 559 P P GG P P P P T PSP PP P PP TP PP Sbjct: 414 PTTPSPGGSPPSPSISPSPPITVPSPP----TTPSPGGSPPSPSIVPSPPSTTPSPGSPP 469 Query: 560 QXPTXPPP 583 PT P P Sbjct: 470 TSPTTPTP 477 Score = 36.7 bits (81), Expect = 0.022 Identities = 21/70 (30%), Positives = 23/70 (32%), Gaps = 2/70 (2%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP--FXTPXXXPPQX 565 P P PPP PP P + P PP PPPP + P P Sbjct: 769 PPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPPIPGI 828 Query: 566 PTXPPPXPXF 595 PP P F Sbjct: 829 SYASPPPPPF 838 Score = 35.9 bits (79), Expect = 0.038 Identities = 21/63 (33%), Positives = 23/63 (36%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXL 601 PPP PP P + P P PPPP TP PP P PP + Sbjct: 702 PPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPP-PTPIHSPP--PQSHPPCIEYSP 758 Query: 602 PRP 610 P P Sbjct: 759 PPP 761 Score = 35.9 bits (79), Expect = 0.038 Identities = 23/72 (31%), Positives = 24/72 (33%), Gaps = 4/72 (5%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQX 565 P P P PP PP P S PP PPPP T PP Sbjct: 713 PQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPP-PTVHYNPPPP 771 Query: 566 PT----XPPPXP 589 P+ PPP P Sbjct: 772 PSPAHYSPPPSP 783 Score = 35.9 bits (79), Expect = 0.038 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P PPP P P P PPP PPPP PP P Sbjct: 758 PPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPPI 817 Query: 572 XPPPXP 589 P P Sbjct: 818 YEGPLP 823 Score = 35.1 bits (77), Expect = 0.066 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 2/66 (3%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPX--PXXRATXPSPPPXXPXXPPPPFXTPXXXPPQX 565 P P GG P P P P T P+P P P P TP PP Sbjct: 440 PTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTP--TPGGSPPSS 497 Query: 566 PTXPPP 583 PT P P Sbjct: 498 PTTPTP 503 Score = 34.3 bits (75), Expect = 0.11 Identities = 21/70 (30%), Positives = 22/70 (31%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 P P P PP G+PP T PP P P TP Sbjct: 452 PSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTP-----TPGGS 506 Query: 554 PPQXPTXPPP 583 PP PT P P Sbjct: 507 PPSSPTTPSP 516 Score = 34.3 bits (75), Expect = 0.11 Identities = 24/82 (29%), Positives = 25/82 (30%), Gaps = 9/82 (10%) Frame = +2 Query: 371 KPPXRPX----PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFX 538 +PP P P P PPP P P PPP PPPP Sbjct: 714 QPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPS 773 Query: 539 TPXXXPPQXP-----TXPPPXP 589 PP P PPP P Sbjct: 774 PAHYSPPPSPPVYYYNSPPPPP 795 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +3 Query: 708 PPPXPTP---TPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 PPP PT +PP P PPP PP PP P Sbjct: 724 PPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPP 761 Score = 33.1 bits (72), Expect = 0.26 Identities = 20/72 (27%), Positives = 24/72 (33%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P + PP +P P + PSPP P PP P Sbjct: 520 PPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPT--PSTPPTPISPGQNS 577 Query: 554 PPQXPTXPPPXP 589 PP P+ P P Sbjct: 578 PPIIPSPPFTGP 589 Score = 32.7 bits (71), Expect = 0.35 Identities = 35/160 (21%), Positives = 40/160 (25%), Gaps = 2/160 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P G PP G+PP T PP P P +P Sbjct: 468 PPTSPTTPTP---GGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTP-----SPGGS 519 Query: 554 PPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXX 733 PP P+ P P P G P+ Sbjct: 520 PPS-PSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSP 578 Query: 734 XXXXXPP--XPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP P PP PP P P +P P Sbjct: 579 PIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPPP 618 Score = 32.7 bits (71), Expect = 0.35 Identities = 20/53 (37%), Positives = 22/53 (41%), Gaps = 5/53 (9%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTP--TPP---XXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P P + PPP PTP +PP P PPP PP PP P P Sbjct: 725 PPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPP---PPTVHYNPPPPPSP 774 Score = 31.9 bits (69), Expect = 0.61 Identities = 20/66 (30%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = +3 Query: 711 PPXPTPTPPXXP-XXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXPXNTIXXXXXXXXX 887 PP P+PP P PP P P P P P P PG P +I Sbjct: 406 PPVVVPSPPTTPSPGGSPPSPSISPSPPITVPSPPTTP--SPGGSPPSPSIVPSPPSTTP 463 Query: 888 XXXXPP 905 PP Sbjct: 464 SPGSPP 469 Score = 31.5 bits (68), Expect = 0.81 Identities = 18/60 (30%), Positives = 19/60 (31%) Frame = +3 Query: 669 GRXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 G P P P PP P+PP P PP P P P P P P Sbjct: 420 GGSPPSPSISPS--PPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTP 477 Score = 30.7 bits (66), Expect = 1.4 Identities = 25/93 (26%), Positives = 28/93 (30%), Gaps = 5/93 (5%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRX--PXLPX--FCPXXPPPXP- 722 P TP P P P P + G+ P +P F PP P Sbjct: 537 PSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPS 596 Query: 723 TPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P PP P P PPP P L P Sbjct: 597 PPLPPVIPSPPIVGPTPSSPPPSTPTPGTLLHP 629 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/61 (29%), Positives = 20/61 (32%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQX 565 P P P+ PPP PP P + P PPP PP PP Sbjct: 779 PPPSPPVYYYNSPPPPPAVH--YSPPPPPVIHHSQPPPPPIYEGPLPPIPGISYASPPPP 836 Query: 566 P 568 P Sbjct: 837 P 837 Score = 30.3 bits (65), Expect = 1.9 Identities = 19/54 (35%), Positives = 22/54 (40%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPP 583 P P G G+PP P + PSPP P P P +P PP P P Sbjct: 411 PSPPTTPSPG-GSPPSP---SISPSPPITVPSPPTTP--SPGGSPPSPSIVPSP 458 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = +3 Query: 708 PPPXP----TPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 PPP P +P PP P PPP P PP P P P Sbjct: 703 PPPAPYYYSSPQPPPPPHYSLPPP---TPTYHYISPPPPPTPIHSP 745 Score = 29.5 bits (63), Expect = 3.3 Identities = 19/76 (25%), Positives = 22/76 (28%), Gaps = 1/76 (1%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQX 565 P P + PPP +PP + P P PPP PP Sbjct: 758 PPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPPI 817 Query: 566 PTXP-PPXPXFXLPRP 610 P PP P P Sbjct: 818 YEGPLPPIPGISYASP 833 Score = 29.1 bits (62), Expect = 4.3 Identities = 27/109 (24%), Positives = 28/109 (25%), Gaps = 5/109 (4%) Frame = +2 Query: 482 ATXPSPPPXXPXXPPPPFXTPXXXPPQXPT-----XPPPXPXFXLPRPXXGXGXGGLXXX 646 A+ P P P P PP PP PT PPP P P Sbjct: 700 ASPPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPP 759 Query: 647 XXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXPPPXP 793 P PS PP PP PPP P Sbjct: 760 PPPTVHYNPPPPPS---PAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPP 805 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 5/53 (9%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXP-----XXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRH 842 P PPP PP P PP P PPP P P P H Sbjct: 713 PQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVH 765 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +2 Query: 485 TXPSP---PPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 T PSP PP P PP P P PP P +P P Sbjct: 415 TTPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSPSI-VPSP 458 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/49 (34%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +3 Query: 678 PXLPXFCPXXPPPXP----TPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P + PPP P +P PP PPPP P PP P Sbjct: 781 PSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPPIYEGPL---PPIP 826 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = +2 Query: 425 PPXXXXXXGXGAPPXPXXRATXPSPPPXXP---XXPPPPFXTPXXXPPQXPTXPPPXP 589 PP PP P SPPP P PPPP +P P PPP P Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P PPP + PP P PPP PPP PP P P Sbjct: 67 PANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATP 111 Score = 38.7 bits (86), Expect = 0.005 Identities = 25/86 (29%), Positives = 25/86 (29%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPP 737 P TP PP P P S P P PP TP P Sbjct: 33 PPTPTTPP--PAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPV 90 Query: 738 XXPXXXXPPPPXXXPPPXXXRPPXPL 815 P PP PPP PP PL Sbjct: 91 ASPPPPVASPPPATPPPVATPPPAPL 116 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +3 Query: 669 GRXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 G+ P P PP TP P P PPP PP P P P Sbjct: 20 GQAPTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANP 70 Score = 37.5 bits (83), Expect = 0.012 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P PPP +P PP PPP PPP P P P Sbjct: 84 PATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAP 128 Score = 37.1 bits (82), Expect = 0.016 Identities = 24/83 (28%), Positives = 26/83 (31%), Gaps = 4/83 (4%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXP----PPPFXT 541 PP P P PPP +PP P +PPP P PP Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVA--SPPPPVASPPPATPPPVATPPPAPLASPPAQV 123 Query: 542 PXXXPPQXPTXPPPXPXFXLPRP 610 P P P P P P P P Sbjct: 124 PAPAPTTKPDSPSPSPSSSPPLP 146 Score = 36.7 bits (81), Expect = 0.022 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +3 Query: 699 PXXPPPXPTPTP--PXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P PPP TP P P PPP PPP PP P P Sbjct: 36 PTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASP 82 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P PP P +PP PPP PPP PP P Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPP 106 Score = 36.3 bits (80), Expect = 0.028 Identities = 24/80 (30%), Positives = 25/80 (31%), Gaps = 7/80 (8%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXX----PXXPPPPFXTPXXXPP 559 P P PP PP SPPP P PPPP +P P Sbjct: 23 PTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASP 82 Query: 560 QXPTXPP---PXPXFXLPRP 610 T PP P P P P Sbjct: 83 PPATPPPVASPPPPVASPPP 102 Score = 36.3 bits (80), Expect = 0.028 Identities = 23/69 (33%), Positives = 26/69 (37%) Frame = +2 Query: 377 PXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXP 556 P P P P PPP +PP P A P+ PP PPP P P Sbjct: 31 PAPPTPTTPPPAAT-PPPVSAPPPVTTSPP-PVTTAPPPANPPPPVSSPPPA-SPPPATP 87 Query: 557 PQXPTXPPP 583 P + PPP Sbjct: 88 PPVASPPPP 96 Score = 36.3 bits (80), Expect = 0.028 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P PP +P P P PPPP PPP PP P P Sbjct: 73 PVSSPPPASPPPATPPPVASPPPPVASPPPAT--PPPVATPPPAP 115 Score = 35.9 bits (79), Expect = 0.038 Identities = 24/79 (30%), Positives = 25/79 (31%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P P PPP P A SPP P P P P Sbjct: 78 PPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPA--PAPTTKPDSP 135 Query: 554 PPQXPTXPPPXPXFXLPRP 610 P P+ PP P P P Sbjct: 136 SPS-PSSSPPLPSSDAPGP 153 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P PPP +P P P PPP PP P P P Sbjct: 84 PATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSP 135 Score = 32.7 bits (71), Expect = 0.35 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P P P PP P PPP PP PP P Sbjct: 72 PPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPP 112 Score = 32.3 bits (70), Expect = 0.46 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +3 Query: 708 PPPXPTPTP--PXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 PPP P P P PPP PPP PP P P Sbjct: 45 PPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPP 88 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +3 Query: 711 PPXPTPTPPXX--PXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PP TP PP P PPP PPP P P+ P P Sbjct: 26 PPTATPAPPTPTTPPPAATPPPVSAPPPVTT-SPPPVTTAPPPANPPP 72 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +3 Query: 708 PPPX---PTPTPPXXPXXXXPP--PPXXXPPPXXXRPPXPLXP 821 PPP P P P P PP PP PPP PP P Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASP 100 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 PP P PP PPP PP PP P P Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATP 105 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 708 PPPXPTPTPPXX--PXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 PPP T PP P PPPP PP PP P P Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVS-SPPPASPPPATPPPVASP 93 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 749 PPXPPPPXXXPPPX--PXXAXPXSXSXXPPGAPXP 847 P PPPP PPP P P S PP A P Sbjct: 67 PANPPPPVSSPPPASPPPATPPPVASPPPPVASPP 101 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/69 (27%), Positives = 20/69 (28%) Frame = +2 Query: 377 PXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXP 556 P P P PP APP + P PPP P P Sbjct: 23 PTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASP 82 Query: 557 PQXPTXPPP 583 P P PPP Sbjct: 83 P--PATPPP 89 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +2 Query: 749 PPXPPPPXXXPP---PXPXXAXPXSXSXXPPGAPXP 847 PP PPP PP P P A P + P P P Sbjct: 78 PPASPPPATPPPVASPPPPVASPPPATPPPVATPPP 113 Score = 28.7 bits (61), Expect = 5.7 Identities = 20/82 (24%), Positives = 21/82 (25%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPP 737 P PP P P P V+ P P P P P PT Sbjct: 72 PPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPT-- 129 Query: 738 XXPXXXXPPPPXXXPPPXXXRP 803 P P P P P P Sbjct: 130 TKPDSPSPSPSSSPPLPSSDAP 151 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/33 (33%), Positives = 13/33 (39%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 P PPP PPP P + + P P P Sbjct: 41 PAATPPPVSAPPPVTTSPPPVTTAPPPANPPPP 73 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = +2 Query: 425 PPXXXXXXGXGAPPXPXXRATXPSPPPXXP---XXPPPPFXTPXXXPPQXPTXPPPXP 589 PP PP P SPPP P PPPP +P P PPP P Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P PPP + PP P PPP PPP PP P P Sbjct: 67 PANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATP 111 Score = 38.7 bits (86), Expect = 0.005 Identities = 25/86 (29%), Positives = 25/86 (29%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPP 737 P TP PP P P S P P PP TP P Sbjct: 33 PPTPTTPP--PAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPV 90 Query: 738 XXPXXXXPPPPXXXPPPXXXRPPXPL 815 P PP PPP PP PL Sbjct: 91 ASPPPPVASPPPATPPPVATPPPAPL 116 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +3 Query: 669 GRXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 G+ P P PP TP P P PPP PP P P P Sbjct: 20 GQAPTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANP 70 Score = 37.5 bits (83), Expect = 0.012 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P PPP +P PP PPP PPP P P P Sbjct: 84 PATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAP 128 Score = 37.1 bits (82), Expect = 0.016 Identities = 24/83 (28%), Positives = 26/83 (31%), Gaps = 4/83 (4%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXP----PPPFXT 541 PP P P PPP +PP P +PPP P PP Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVA--SPPPPVASPPPATPPPVATPPPAPLASPPAQV 123 Query: 542 PXXXPPQXPTXPPPXPXFXLPRP 610 P P P P P P P P Sbjct: 124 PAPAPTTKPDSPSPSPSSSPPLP 146 Score = 36.7 bits (81), Expect = 0.022 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +3 Query: 699 PXXPPPXPTPTP--PXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P PPP TP P P PPP PPP PP P P Sbjct: 36 PTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASP 82 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P PP P +PP PPP PPP PP P Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPP 106 Score = 36.3 bits (80), Expect = 0.028 Identities = 24/80 (30%), Positives = 25/80 (31%), Gaps = 7/80 (8%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXX----PXXPPPPFXTPXXXPP 559 P P PP PP SPPP P PPPP +P P Sbjct: 23 PTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASP 82 Query: 560 QXPTXPP---PXPXFXLPRP 610 T PP P P P P Sbjct: 83 PPATPPPVASPPPPVASPPP 102 Score = 36.3 bits (80), Expect = 0.028 Identities = 23/69 (33%), Positives = 26/69 (37%) Frame = +2 Query: 377 PXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXP 556 P P P P PPP +PP P A P+ PP PPP P P Sbjct: 31 PAPPTPTTPPPAAT-PPPVSAPPPVTTSPP-PVTTAPPPANPPPPVSSPPPA-SPPPATP 87 Query: 557 PQXPTXPPP 583 P + PPP Sbjct: 88 PPVASPPPP 96 Score = 36.3 bits (80), Expect = 0.028 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P PP +P P P PPPP PPP PP P P Sbjct: 73 PVSSPPPASPPPATPPPVASPPPPVASPPPAT--PPPVATPPPAP 115 Score = 35.9 bits (79), Expect = 0.038 Identities = 24/79 (30%), Positives = 25/79 (31%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P P PPP P A SPP P P P P Sbjct: 78 PPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPA--PAPTTKPDSP 135 Query: 554 PPQXPTXPPPXPXFXLPRP 610 P P+ PP P P P Sbjct: 136 SPS-PSSSPPLPSSDAPGP 153 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P PPP +P P P PPP PP P P P Sbjct: 84 PATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSP 135 Score = 32.7 bits (71), Expect = 0.35 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P P P PP P PPP PP PP P Sbjct: 72 PPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPP 112 Score = 32.3 bits (70), Expect = 0.46 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +3 Query: 708 PPPXPTPTP--PXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 PPP P P P PPP PPP PP P P Sbjct: 45 PPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPP 88 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +3 Query: 711 PPXPTPTPPXX--PXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PP TP PP P PPP PPP P P+ P P Sbjct: 26 PPTATPAPPTPTTPPPAATPPPVSAPPPVTT-SPPPVTTAPPPANPPP 72 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +3 Query: 708 PPPX---PTPTPPXXPXXXXPP--PPXXXPPPXXXRPPXPLXP 821 PPP P P P P PP PP PPP PP P Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASP 100 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 PP P PP PPP PP PP P P Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATP 105 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 708 PPPXPTPTPPXX--PXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 PPP T PP P PPPP PP PP P P Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVS-SPPPASPPPATPPPVASP 93 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 749 PPXPPPPXXXPPPX--PXXAXPXSXSXXPPGAPXP 847 P PPPP PPP P P S PP A P Sbjct: 67 PANPPPPVSSPPPASPPPATPPPVASPPPPVASPP 101 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/69 (27%), Positives = 20/69 (28%) Frame = +2 Query: 377 PXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXP 556 P P P PP APP + P PPP P P Sbjct: 23 PTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASP 82 Query: 557 PQXPTXPPP 583 P P PPP Sbjct: 83 P--PATPPP 89 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +2 Query: 749 PPXPPPPXXXPP---PXPXXAXPXSXSXXPPGAPXP 847 PP PPP PP P P A P + P P P Sbjct: 78 PPASPPPATPPPVASPPPPVASPPPATPPPVATPPP 113 Score = 28.7 bits (61), Expect = 5.7 Identities = 20/82 (24%), Positives = 21/82 (25%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPP 737 P PP P P P V+ P P P P P PT Sbjct: 72 PPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPT-- 129 Query: 738 XXPXXXXPPPPXXXPPPXXXRP 803 P P P P P P Sbjct: 130 TKPDSPSPSPSSSPPLPSSDAP 151 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/33 (33%), Positives = 13/33 (39%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 P PPP PPP P + + P P P Sbjct: 41 PAATPPPVSAPPPVTTSPPPVTTAPPPANPPPP 73 >At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 359 Score = 39.5 bits (88), Expect = 0.003 Identities = 26/84 (30%), Positives = 28/84 (33%), Gaps = 5/84 (5%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXP---PPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP--PPF 535 KPP P P+ P PP PP SPP P PP PP Sbjct: 141 KPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPT 200 Query: 536 XTPXXXPPQXPTXPPPXPXFXLPR 607 P P PT PP P P+ Sbjct: 201 KAPVKPPVSPPTKPPVTPPVYPPK 224 Score = 38.7 bits (86), Expect = 0.005 Identities = 24/80 (30%), Positives = 27/80 (33%), Gaps = 2/80 (2%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP--PPFXTP 544 KPP +P P P PP +PP PP P PP PP P Sbjct: 85 KPPVKP-PVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPP 143 Query: 545 XXXPPQXPTXPPPXPXFXLP 604 P + P PP P P Sbjct: 144 VYPPTKAPVKPPTKPPVKPP 163 Score = 37.1 bits (82), Expect = 0.016 Identities = 24/83 (28%), Positives = 28/83 (33%), Gaps = 5/83 (6%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPS---PPPXXPXXPP--PPF 535 KPP +P P+ PP AP P + PP P PP PP Sbjct: 101 KPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPV 160 Query: 536 XTPXXXPPQXPTXPPPXPXFXLP 604 P P + P PP P P Sbjct: 161 KPPVYPPTKAPVKPPTKPPVKPP 183 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/57 (31%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXP-PPPXXXPPPXXXRPP--XPLXPXXHPGRHXP 848 P P PP P PP P P PP P +PP P+ P +P P Sbjct: 95 PTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAP 151 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/58 (32%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP--PPFXTPXXXPPQXPTXPPPXP 589 P P +P P +A SPP P PP PP P P + P PP P Sbjct: 58 PHPHPHPHPPAKSPVKPPVKAPV-SPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVSP 114 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +2 Query: 464 PXPXXRATXP-SPPPXXPXXPP--PPFXTPXXXPPQXPTXPPPXPXFXLP 604 P P A P PP P PP PP P P + P PP P P Sbjct: 62 PHPHPPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPP 111 Score = 32.3 bits (70), Expect = 0.46 Identities = 23/73 (31%), Positives = 24/73 (32%), Gaps = 2/73 (2%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP--PPFXTP 544 KPP + P P PP PP SPP P PP PP P Sbjct: 73 KPPVKA-PVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAP 131 Query: 545 XXXPPQXPTXPPP 583 PP P PP Sbjct: 132 VK-PPTKPPVKPP 143 Score = 31.9 bits (69), Expect = 0.61 Identities = 21/71 (29%), Positives = 25/71 (35%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXX 550 KPP +P P+ P P P +A P PP P PP +P Sbjct: 133 KPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKA--PVKPPTKPPVKPP--VSPPA 188 Query: 551 XPPQXPTXPPP 583 PP P PP Sbjct: 189 KPPVKPPVYPP 199 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +2 Query: 449 GXGAPPXPXXRATXPSPPPXXPXXPP--PPFXTPXXXPPQXPTXPPPXPXFXLP 604 G P P P P P P P PP P P + P PP P P Sbjct: 46 GHHHPHPPHHHHPHPHPHPHPPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAP 99 Score = 31.5 bits (68), Expect = 0.81 Identities = 21/78 (26%), Positives = 23/78 (29%), Gaps = 1/78 (1%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXPXNT-IX 863 P P PP P PP P P P PP P P P P + P + Sbjct: 75 PVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVSP-PAKPPVKPPVYPPTKAPVK 133 Query: 864 XXXXXXXXXXXXPPQKXP 917 PP K P Sbjct: 134 PPTKPPVKPPVYPPTKAP 151 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/73 (30%), Positives = 24/73 (32%), Gaps = 2/73 (2%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPP--PFXTP 544 KPP P P+ PP AP P + P PP P P P P Sbjct: 121 KPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKP--PVKPPVYPPTKAPVKPPTKP 178 Query: 545 XXXPPQXPTXPPP 583 PP P PP Sbjct: 179 PVKPPVSPPAKPP 191 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/57 (29%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXP---PPXXXRPPXPLXPXXHPGRHXP 848 P P PP P PP P P P P PP P+ P +P P Sbjct: 147 PTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAP 203 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/77 (24%), Positives = 21/77 (27%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXPXNTIXX 866 P P PP P PP P P P PP P P P + + Sbjct: 127 PTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSP 186 Query: 867 XXXXXXXXXXXPPQKXP 917 PP K P Sbjct: 187 PAKPPVKPPVYPPTKAP 203 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P PP P PP P P P PP P P+ P P Sbjct: 167 PTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKP-PVSPPTKP 214 Score = 29.1 bits (62), Expect = 4.3 Identities = 35/160 (21%), Positives = 39/160 (24%), Gaps = 4/160 (2%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSP--PPXXPXXPPPPFXTPX 547 P P P P PP P P +P PP P PP +P Sbjct: 58 PHPHPHPHPPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPP--VSPP 115 Query: 548 XXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXX 727 PP P PP P P + P + Sbjct: 116 AKPPVKPPVYPPTKAPVKP-PTKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKP 174 Query: 728 XXXXXXXPPXPPP--PXXXPPPXPXXAXPXSXSXXPPGAP 841 PP PP P PP P P PP P Sbjct: 175 PTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPVSPPTKP 214 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/54 (25%), Positives = 17/54 (31%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 + P P P PP P P PP PP P+ P +P Sbjct: 169 KAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPVSPPTKPPVTPPVYP 222 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/54 (25%), Positives = 16/54 (29%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 + P P P PP P P PP PP P+ P P Sbjct: 105 KPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKP 158 Score = 28.3 bits (60), Expect = 7.5 Identities = 22/87 (25%), Positives = 26/87 (29%), Gaps = 5/87 (5%) Frame = +3 Query: 672 RXPXLPXFCPXXPPP--XPTPTPPXXPXXXXPPPPXXXPPPXXXRPP--XPLXPXXHPGR 839 + P P P PP PT P P PP P +PP P+ P P Sbjct: 129 KAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPA 188 Query: 840 HXPXN-TIXXXXXXXXXXXXXPPQKXP 917 P + PP K P Sbjct: 189 KPPVKPPVYPPTKAPVKPPVSPPTKPP 215 Score = 27.9 bits (59), Expect = 10.0 Identities = 17/55 (30%), Positives = 20/55 (36%), Gaps = 3/55 (5%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPP-PPXXXPPPXXXRPP--XPLXPXXHP 833 P P P PP +PP P P PP P +PP P+ P P Sbjct: 64 PHPPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKP 118 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/48 (43%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGG--GXXXXGXXGGVGVGXGGGXXGQKXGR 683 G G GG GGG GGG G G GG+G G GGG G G+ Sbjct: 54 GDLGGGGGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAGK 101 Score = 31.5 bits (68), Expect = 0.81 Identities = 29/88 (32%), Positives = 31/88 (35%), Gaps = 2/88 (2%) Frame = -2 Query: 630 PXPXPXXGRGRXKXGXG--GGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGA 457 P P P + K G GG G GG G GGG G GG G + G GG Sbjct: 38 PHPHPLLHKKGFKKEFGDLGGGGGISGGGGFGA--GGGWIGGSVGGFGGGIGGGFGGGG- 94 Query: 456 PXPXXXXXXGGGXXPPKRGXXGXGRXGG 373 GGG G G G GG Sbjct: 95 --------FGGGAGKGVDGGFGKGVDGG 114 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G+ G G G GGG G G G GG G G GG Sbjct: 81 GFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGAGKGVDGG 122 Score = 29.1 bits (62), Expect = 4.3 Identities = 24/72 (33%), Positives = 25/72 (34%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPP 409 G GGG +G G G GG G G GGG G G G GG Sbjct: 69 GAGGGWIGGSVGGFGGGIGGGFGGGG-FGGGAGK-GVDGGFGKGVDGGAGKGVDGGAGKG 126 Query: 408 KRGXXGXGRXGG 373 G G G GG Sbjct: 127 FDGGVGKGVDGG 138 Score = 28.3 bits (60), Expect = 7.5 Identities = 28/84 (33%), Positives = 30/84 (35%), Gaps = 5/84 (5%) Frame = -2 Query: 609 GRGRXKXGXGGG-XVGXWGGXXXGVXKGGG-GXXGXXGGG-EGXVARXXGXGGAPXPXXX 439 G G G GGG G GG GV G G G G G G +G V + G Sbjct: 87 GGGFGGGGFGGGAGKGVDGGFGKGVDGGAGKGVDGGAGKGFDGGVGKGVDGGAGKGFDGG 146 Query: 438 XXXG--GGXXPPKRGXXGXGRXGG 373 G GG G G G GG Sbjct: 147 VGKGFEGGIGKGIEGGVGKGFDGG 170 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 39.1 bits (87), Expect = 0.004 Identities = 26/79 (32%), Positives = 27/79 (34%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P G PPP G PP + PP PPPP Sbjct: 176 PPMGRGPPPPY--GMRPPPQQFS----GPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGP 229 Query: 554 PPQXPTXPPPXPXFXLPRP 610 PP P PP F PRP Sbjct: 230 PPPRPGMPPAPGGFAPPRP 248 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 4/45 (8%) Frame = +3 Query: 699 PXXPPPXPT----PTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P PPP P PP PP P P P PP P P Sbjct: 207 PMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMP 251 Score = 29.1 bits (62), Expect = 4.3 Identities = 35/151 (23%), Positives = 39/151 (25%), Gaps = 7/151 (4%) Frame = +2 Query: 428 PXXXXXXGXGAPPXPXXRATXP-SPPPXXPXXPPPPFXTPXXXPPQXPTXPP--PXPXFX 598 P G G P P +A S P P P P P + PP P Sbjct: 106 PGIGRAAGRGVPTGPLVQAQPGLSGPVRGVGGPAPGMMQPQISRPPQLSAPPIIRPPGQM 165 Query: 599 LPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXP----PXPPP 766 LP P G + R P P F P PPP Sbjct: 166 LPPPPFGGQGPPMGRGPPPPYGMR--PPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPP 223 Query: 767 PXXXPPPXPXXAXPXSXSXXPPGAPXPXKHN 859 PP P P + P P HN Sbjct: 224 HGMQGPPPPRPGMPPAPGGFAPPRPGMPPHN 254 Score = 27.9 bits (59), Expect = 10.0 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 PPP PP P PP P PP PP Sbjct: 221 PPPHGMQGPPP-PRPGMPPAPGGFAPPRPGMPP 252 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 39.1 bits (87), Expect = 0.004 Identities = 26/79 (32%), Positives = 27/79 (34%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P G PPP G PP + PP PPPP Sbjct: 176 PPMGRGPPPPY--GMRPPPQQFS----GPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGP 229 Query: 554 PPQXPTXPPPXPXFXLPRP 610 PP P PP F PRP Sbjct: 230 PPPRPGMPPAPGGFAPPRP 248 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 4/45 (8%) Frame = +3 Query: 699 PXXPPPXPT----PTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P PPP P PP PP P P P PP P P Sbjct: 207 PMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMP 251 Score = 29.1 bits (62), Expect = 4.3 Identities = 35/151 (23%), Positives = 39/151 (25%), Gaps = 7/151 (4%) Frame = +2 Query: 428 PXXXXXXGXGAPPXPXXRATXP-SPPPXXPXXPPPPFXTPXXXPPQXPTXPP--PXPXFX 598 P G G P P +A S P P P P P + PP P Sbjct: 106 PGIGRAAGRGVPTGPLVQAQPGLSGPVRGVGGPAPGMMQPQISRPPQLSAPPIIRPPGQM 165 Query: 599 LPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXP----PXPPP 766 LP P G + R P P F P PPP Sbjct: 166 LPPPPFGGQGPPMGRGPPPPYGMR--PPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPP 223 Query: 767 PXXXPPPXPXXAXPXSXSXXPPGAPXPXKHN 859 PP P P + P P HN Sbjct: 224 HGMQGPPPPRPGMPPAPGGFAPPRPGMPPHN 254 Score = 27.9 bits (59), Expect = 10.0 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 PPP PP P PP P PP PP Sbjct: 221 PPPHGMQGPPP-PRPGMPPAPGGFAPPRPGMPP 252 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 39.1 bits (87), Expect = 0.004 Identities = 25/85 (29%), Positives = 30/85 (35%), Gaps = 3/85 (3%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP--XXXRPPXPLXPXXHP-GRH 842 + P P + PPP +P PP PPPP PPP PP P+ P H Sbjct: 66 KSPPPPYYYHSPPPPVKSPPPPY--VYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYH 123 Query: 843 XPXNTIXXXXXXXXXXXXXPPQKXP 917 P + PP K P Sbjct: 124 SPPPPVKSPPPPYYYHSPPPPVKSP 148 Score = 39.1 bits (87), Expect = 0.004 Identities = 25/85 (29%), Positives = 30/85 (35%), Gaps = 3/85 (3%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP--XXXRPPXPLXPXXHP-GRH 842 + P P + PPP +P PP PPPP PPP PP P+ P H Sbjct: 98 KSPPPPYYYHSPPPPVKSPPPPY--YYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYH 155 Query: 843 XPXNTIXXXXXXXXXXXXXPPQKXP 917 P + PP K P Sbjct: 156 SPPPPVKSPPPPYYYHSPPPPVKSP 180 Score = 37.5 bits (83), Expect = 0.012 Identities = 40/174 (22%), Positives = 47/174 (27%), Gaps = 10/174 (5%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGX--GAPPXPXXRATXP---SPPPXXPXXPPP 529 K PP P P PPP +PP P P S PP PPP Sbjct: 43 KSPPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPP 102 Query: 530 PFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXX 709 P+ P P PP P + P + P P + Sbjct: 103 PY---YYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPP 159 Query: 710 XXXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPP-----GAPXPXKH 856 P PPP PPP + P PP +P P H Sbjct: 160 PVKSPPPPYYYHSP--PPPVKSPPPPYLYSSPPPPVKSPPPPVYIYASPPPPTH 211 Score = 37.5 bits (83), Expect = 0.012 Identities = 22/72 (30%), Positives = 25/72 (34%), Gaps = 3/72 (4%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPPXXXPPP--XXXRPPXPLXPXXHP-GRHXPXNTIXXXXXXX 881 PP P +PP PPPP PPP PP P+ P H P + Sbjct: 61 PPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPY 120 Query: 882 XXXXXXPPQKXP 917 PP K P Sbjct: 121 YYHSPPPPVKSP 132 Score = 36.3 bits (80), Expect = 0.028 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP--XXXRPPXPLXPXXHP 833 + P P + PPP +P PP PPPP PPP PP P+ P Sbjct: 130 KSPPPPYYYHSPPPPVKSPPPPY--YYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 183 Score = 36.3 bits (80), Expect = 0.028 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP--XXXRPPXPLXPXXHP 833 + P P + PPP +P PP PPPP PPP PP P+ P Sbjct: 146 KSPPPPYYYHSPPPPVKSPPPPY--YYHSPPPPVKSPPPPYLYSSPPPPVKSPPPP 199 Score = 34.7 bits (76), Expect = 0.087 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 3/50 (6%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP---XXXRPPXP 812 + P P + PPP +P PP PPPP PPP PP P Sbjct: 162 KSPPPPYYYHSPPPPVKSPPPPY--LYSSPPPPVKSPPPPVYIYASPPPP 209 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXX--PPPXXXRPPXP 812 P + PPP +PP P PPPP PPP PP P Sbjct: 30 PYYYSSPPPPYEYKSPP--PPVKSPPPPYEYKSPPPPVKSPPPP 71 Score = 33.9 bits (74), Expect = 0.15 Identities = 19/54 (35%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP--XXXRPPXPLXPXXHP 833 P P PPP +P PP PPPP PPP PP P+ P Sbjct: 36 PPPPYEYKSPPPPVKSPPPPY--EYKSPPPPVKSPPPPYYYHSPPPPVKSPPPP 87 Score = 31.1 bits (67), Expect = 1.1 Identities = 30/118 (25%), Positives = 31/118 (26%), Gaps = 5/118 (4%) Frame = +2 Query: 494 SPPPXXP-XXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXR 670 SPPP PPPP +P PP PP P P P Sbjct: 35 SPPPPYEYKSPPPPVKSP---PPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYS 91 Query: 671 XXPXPSXFLXXXXXXXXXXXXXXXXXPP----XPPPPXXXPPPXPXXAXPXSXSXXPP 832 P P PP PPPP PPP P PP Sbjct: 92 SPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPP 149 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 39.1 bits (87), Expect = 0.004 Identities = 24/52 (46%), Positives = 24/52 (46%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAP 454 G GR G GGG G GG G GG G G GGG G A G GG P Sbjct: 581 GSGRGGYGGGGGGYGGGGGYGGG---GGYGGGGGYGGGYGG-ASSGGYGGEP 628 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/46 (41%), Positives = 21/46 (45%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGG 710 G R G+ G G+GG GGG GGGG G G G GG Sbjct: 581 GSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYGG 626 Score = 35.1 bits (77), Expect = 0.066 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GGG GGGG G G G G GGG G G Sbjct: 578 GSFGSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSG 622 Score = 32.7 bits (71), Expect = 0.35 Identities = 20/51 (39%), Positives = 22/51 (43%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGA 457 GR + G G G +GG G GGGG G GG G G GGA Sbjct: 571 GRDFRREGSFGSGRGGYGGGGGGY--GGGGGYGGGGGYGGGGGYGGGYGGA 619 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -1 Query: 838 RPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 R G G R + G G GGG G GG G G G G G G Sbjct: 564 RSGGRFGGRDFRREGSFGSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGG 614 Score = 28.3 bits (60), Expect = 7.5 Identities = 25/72 (34%), Positives = 27/72 (37%), Gaps = 5/72 (6%) Frame = -2 Query: 609 GRGRXKXGXGGGX----VGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXX 442 G+ R G GG G +G G GGGG G GGG G G GG Sbjct: 560 GKNRRSGGRFGGRDFRREGSFGSGRGGYG-GGGGGYG-GGGGYGGGGGYGGGGGYGGGYG 617 Query: 441 XXXXGG-GXXPP 409 GG G PP Sbjct: 618 GASSGGYGGEPP 629 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 39.1 bits (87), Expect = 0.004 Identities = 24/74 (32%), Positives = 28/74 (37%), Gaps = 2/74 (2%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXP--PPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPX 547 PP + P L P P APP P + + P PPP P PP P Sbjct: 344 PPGQYMPGNAALSASTPLTPGQFTTANAPPAPPGPANQTSPPPPPP--PSAAAPP---PP 398 Query: 548 XXPPQXPTXPPPXP 589 P + P PPP P Sbjct: 399 PPPKKGPAAPPPPP 412 Score = 37.5 bits (83), Expect = 0.012 Identities = 22/65 (33%), Positives = 23/65 (35%), Gaps = 2/65 (3%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPP--XXPXXPPPPFXTPXXXPPQXPTXPPPXPXF 595 P P PP P A P PPP P PPPP P P PPP Sbjct: 373 PAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPP--PPPGKKGAGPPPPPPMSKK 430 Query: 596 XLPRP 610 P+P Sbjct: 431 GPPKP 435 Score = 37.1 bits (82), Expect = 0.016 Identities = 21/67 (31%), Positives = 22/67 (32%), Gaps = 3/67 (4%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP---XXPPPPFXTPXXXP 556 P P P PPP PP P P PPP PPPP P Sbjct: 373 PAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGP 432 Query: 557 PQXPTXP 577 P+ P P Sbjct: 433 PKPPGNP 439 Score = 35.1 bits (77), Expect = 0.066 Identities = 22/70 (31%), Positives = 23/70 (32%), Gaps = 2/70 (2%) Frame = +2 Query: 386 PXPXXPLLG-GXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTP-XXXPP 559 P P P G PPP G G PP P P PP P P T Sbjct: 396 PPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNPKGPTKSGETSLAVGKT 455 Query: 560 QXPTXPPPXP 589 + PT P P Sbjct: 456 EDPTQPKLKP 465 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 726 PTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P PP PPPP PPP PP P P P P Sbjct: 373 PAPPGPANQTSPPPP---PPPSAAAPPPPPPPKKGPAAPPP 410 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXK 853 PP PPPP PP P P PP P P K Sbjct: 384 PPPPPPPSAAAPPPPPP--PKKGPAAPPPPPPPGK 416 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P PP P PP P PP PP P P P G P Sbjct: 386 PPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKP 435 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXK 853 PP PPPP P P P PP P K Sbjct: 395 PPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSK 429 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P P +PP P PP PP P P P G P Sbjct: 373 PAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPP 422 Score = 27.9 bits (59), Expect = 10.0 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P P PPP P P PP PP P P Sbjct: 398 PPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNPKGP 442 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PP P P P PPPP PP PP P +PG P Sbjct: 32 PPQGAYPPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGPSGP 78 Score = 37.9 bits (84), Expect = 0.009 Identities = 26/69 (37%), Positives = 27/69 (39%), Gaps = 6/69 (8%) Frame = +2 Query: 449 GXGAPPX---PXXRATXPSPPPXXPXX-PPPPFXTPXXXPPQXPTXPPP--XPXFXLPRP 610 G G PP P + P P P PPPP P P P PP P PRP Sbjct: 21 GHGYPPGAYPPPPQGAYPPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGPSGPRP 80 Query: 611 XXGXGXGGL 637 G G GGL Sbjct: 81 GFGGGVGGL 89 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +3 Query: 699 PXXPPPXPTPTPP-XXPXXXXPPPPXXXPPPXXXRPPXP 812 P PP P PP P PPPP PP P P Sbjct: 40 PGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGPSGP 78 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPP---PPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PP P PP PP PP PPP PP P PG + P Sbjct: 25 PPGAYPPPPQGAYP--PPGGYPPQGYPPPPHGYPPAAYPPP--PGAYPP 69 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = +2 Query: 458 APPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPP 583 +PP P T SPPP PPP PP P+ PPP Sbjct: 47 SPPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPP 88 Score = 37.1 bits (82), Expect = 0.016 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPP-PXXXPPPXXXRPPXPLXPXXHP 833 P P PP PP P PPP P PPP PP P P P Sbjct: 51 PPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPP 103 Score = 33.9 bits (74), Expect = 0.15 Identities = 24/70 (34%), Positives = 27/70 (38%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXX 550 +PP P P PP A P P + +PPP P PPP TP Sbjct: 42 QPPATSPPSPPSPDTQTSPPP-----ATAAQPPPN-QPPNTTPPPTPP-SSPPPSITPPP 94 Query: 551 XPPQXPTXPP 580 PPQ P PP Sbjct: 95 SPPQ-PQPPP 103 Score = 33.5 bits (73), Expect = 0.20 Identities = 27/88 (30%), Positives = 27/88 (30%), Gaps = 9/88 (10%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPS-------PPPXXPXXPPPP 532 PP P P PPP PP T PS PPP P PPP Sbjct: 48 PPSPPSPDTQT----SPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPP 103 Query: 533 FXTPXXXPPQXPTXPPP--XPXFXLPRP 610 TP P P P P P P Sbjct: 104 QSTPTGDSPVVIPFPKPQLPPPSLFPPP 131 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/49 (30%), Positives = 17/49 (34%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXPXNT 857 PP +P P P PPP P +PP P P P T Sbjct: 43 PPATSPPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSIT 91 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP PP PPP P + P S + PP P P Sbjct: 68 PPPNQPPNTTPPPTPPSSPPPSITP-PPSPPQP 99 Score = 31.5 bits (68), Expect = 0.81 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +2 Query: 482 ATXPSPPPXXPXXPPPPFXTPXXXPPQXP--TXPPPXP 589 AT P PP PP T PP P T PPP P Sbjct: 45 ATSPPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTP 82 Score = 30.3 bits (65), Expect = 1.9 Identities = 21/76 (27%), Positives = 22/76 (28%) Frame = +2 Query: 383 RPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQ 562 +P P P P P PP P P P PF P PP Sbjct: 67 QPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPPS 126 Query: 563 XPTXPPPXPXFXLPRP 610 PPP LP P Sbjct: 127 --LFPPPSLVNQLPDP 140 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 10/51 (19%) Frame = +3 Query: 699 PXXPPPXPTP--TPPXXPXXXXPPP--------PXXXPPPXXXRPPXPLXP 821 P PP P P TPP P PPP P P P PP L P Sbjct: 79 PPTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPPSLFP 129 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRP 803 PPP P +PP P PP P PP P Sbjct: 78 PPPTPPSSPP--PSITPPPSPPQPQPPPQSTP 107 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAP 841 PP PPP PPP P P S +P Sbjct: 82 PPSSPPPSITPPPSPPQPQPPPQSTPTGDSP 112 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 P P P P P TP P P PPP PP Sbjct: 92 PPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPPSLFPPP 131 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +3 Query: 699 PXXPP-PXPTPTPPXXPXXXXPPPPX-XXPPPXXXRPPXPLXPXXHP 833 P PP P PTPP P PPP P P P P P Sbjct: 70 PNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVIP 116 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/49 (42%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +2 Query: 491 PSP--PPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXG 631 PSP PP P PPP +P PP+ P+ PPP P P G G G Sbjct: 160 PSPDFPPFSPSIPPP---SPPYFPPEPPSIPPPPPPSP-PSAASGRGSG 204 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPP 770 P P F P PPP P PP P PPPP Sbjct: 162 PDFPPFSPSIPPPSPPYFPPEPPSIPPPPPP 192 Score = 36.3 bits (80), Expect = 0.028 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXP-PPXXXRPPXPLXPXXHPGR 839 PPP P PP P P PP P PP PP P P GR Sbjct: 158 PPPSPD-FPPFSPSIPPPSPPYFPPEPPSIPPPPPPSPPSAASGR 201 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +2 Query: 461 PPXPXXRATXPS-PPPXXPXXPPPPFXTPXXXPPQXPTXP 577 PP P PS PPP P PP P P PP P+ P Sbjct: 159 PPSPDFPPFSPSIPPPSPPYFPPEP---PSIPPPPPPSPP 195 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 684 LPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP 788 LP P PP P+ PP P PP PPP Sbjct: 157 LPPPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPP 191 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 500 PPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 PP P PP P PP P PP P P P Sbjct: 158 PPPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPPPSP 194 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 P PP PPP P P S PP P P Sbjct: 162 PDFPPFSPSIPPPSPPYFPPEPPSIPPPPPPSP 194 Score = 27.9 bits (59), Expect = 10.0 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXP 746 P P + P PP P P PP P Sbjct: 173 PPSPPYFPPEPPSIPPPPPPSPP 195 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 38.7 bits (86), Expect = 0.005 Identities = 25/82 (30%), Positives = 28/82 (34%), Gaps = 4/82 (4%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPP----PFXT 541 PP + P P + PPP P P PPP PPP P Sbjct: 217 PPKKEVP--PPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPPV 274 Query: 542 PXXXPPQXPTXPPPXPXFXLPR 607 P PP PPP P LP+ Sbjct: 275 PVYKPPPKIEHPPPVPVHKLPK 296 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/49 (40%), Positives = 23/49 (46%), Gaps = 6/49 (12%) Frame = +3 Query: 678 PXLPXFCPXX----PPPXPT-PTPPXXPXXXXPPP-PXXXPPPXXXRPP 806 P +P + P PPP P P PP P PPP P PPP +PP Sbjct: 224 PPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPP 272 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/51 (35%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +3 Query: 684 LPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP-XXHP 833 +P P PP PP P PPP PPP +P P P HP Sbjct: 207 IPPPVPVYDPPPKKEVPPPVPV-YKPPPKVELPPPIPKKPCPPKPPKIEHP 256 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PPP P PP P PPP PPP P P HP + P Sbjct: 327 PPPVPVHKPP--PKIVIPPPKIEHPPPVPVYKPPP--KIEHPPIYIP 369 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 PPP P PP P PP PP PP P HP Sbjct: 395 PPPVPVYKPPVVVIPKKPCPPLPQLPPLPKFPPLPPKYIHHP 436 Score = 33.9 bits (74), Expect = 0.15 Identities = 19/48 (39%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +3 Query: 672 RXPXLPXFCPXX--PPPXPTPTPPXXPXXXXPPP-PXXXPPPXXXRPP 806 + P P + P PPP P PP P PPP P PPP PP Sbjct: 179 KKPCPPKYSPPVEVPPPVPVYEPP--PKKEIPPPVPVYDPPPKKEVPP 224 Score = 33.9 bits (74), Expect = 0.15 Identities = 19/52 (36%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPP-PXXXPPPXXXRPPXPLXPXXHPGRHXPXNTI 860 PPP P PP P PPP P PPP PP P+ P + P + Sbjct: 256 PPPVPVYKPP--PKIEKPPPVPVYKPPPKIEHPP-PVPVHKLPKKPCPPKKV 304 Score = 33.1 bits (72), Expect = 0.26 Identities = 21/71 (29%), Positives = 26/71 (36%), Gaps = 8/71 (11%) Frame = +3 Query: 672 RXPXLPXFCPXX----PPPXPT---PTPPXXPXXXXPPP-PXXXPPPXXXRPPXPLXPXX 827 + P +P + P PPP P P P P PPP P PP PP + P Sbjct: 270 KPPPVPVYKPPPKIEHPPPVPVHKLPKKPCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPP 329 Query: 828 HPGRHXPXNTI 860 P P + Sbjct: 330 VPVHKPPPKIV 340 Score = 32.7 bits (71), Expect = 0.35 Identities = 23/80 (28%), Positives = 27/80 (33%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTP 544 K+ PP P P PP P P + P PP PP P P Sbjct: 205 KEIPPPVPVYDPPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPVYKP 264 Query: 545 XXXPPQXPTXPPPXPXFXLP 604 PP+ PPP P + P Sbjct: 265 ---PPKI-EKPPPVPVYKPP 280 Score = 31.5 bits (68), Expect = 0.81 Identities = 19/64 (29%), Positives = 20/64 (31%), Gaps = 4/64 (6%) Frame = +2 Query: 425 PPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPP----PFXTPXXXPPQXPTXPPPXPX 592 PP P P PPP PPP P P PP PPP P Sbjct: 169 PPPLELPPFLKKPCPPKYSPPVEVPPPVPVYEPPPKKEIPPPVPVYDPPPKKEVPPPVPV 228 Query: 593 FXLP 604 + P Sbjct: 229 YKPP 232 Score = 31.5 bits (68), Expect = 0.81 Identities = 26/115 (22%), Positives = 29/115 (25%), Gaps = 4/115 (3%) Frame = +2 Query: 500 PPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXP 679 PP PP + P PP P PP P +P P + P Sbjct: 175 PPFLKKPCPPKYSPPVEVPPPVPVYEPP-PKKEIPPPVPVYDPPPKKEVPPPVPVYKPPP 233 Query: 680 XPSXFLXXXXXXXXXXXXXXXXXPP----XPPPPXXXPPPXPXXAXPXSXSXXPP 832 PP PPP PPP P P PP Sbjct: 234 KVELPPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPPVPVYKPPPKIEHPPP 288 Score = 30.7 bits (66), Expect = 1.4 Identities = 26/93 (27%), Positives = 30/93 (32%), Gaps = 7/93 (7%) Frame = +2 Query: 347 KKXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP 526 KK K PP P P+ PPP P + PPP PP Sbjct: 179 KKPCPPKYSPPVEVPPPVPVY---EPPPKKEIPPPVPVYDPPPKKEV---PPPVPVYKPP 232 Query: 527 PPFXTP-----XXXPPQXP--TXPPPXPXFXLP 604 P P PP+ P PPP P + P Sbjct: 233 PKVELPPPIPKKPCPPKPPKIEHPPPVPVYKPP 265 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +3 Query: 708 PPPXPTPTPPXX-PXXXXPPPPXXXPPPXXXRPPXPLXP 821 PPP P PP P PPP PP P P P Sbjct: 377 PPPVPIYKPPVVIPKKPCPPPVPVYKPPVVVIPKKPCPP 415 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +3 Query: 684 LPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 +P P PP PP P PPP PPP P P Sbjct: 192 VPPPVPVYEPPPKKEIPPPVPV-YDPPPKKEVPPPVPVYKPPP 233 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = +3 Query: 708 PPPXPTPTPPXX----PXXXXPPP-PXXXPPPXXXRPP 806 PPP P PP P PPP P PPP PP Sbjct: 306 PPPVPVHKPPTKKPCPPKKVDPPPVPVHKPPPKIVIPP 343 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPL 815 P LP F P P P P P P P PP PP P+ Sbjct: 154 PKLPPF-KGFDHPFPLPPPLELPPFLKKPCPPKYSPPVEVPPPVPV 198 Score = 29.9 bits (64), Expect = 2.5 Identities = 24/81 (29%), Positives = 26/81 (32%), Gaps = 2/81 (2%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPX 547 K PP P P + PPP PP P + PP PP P P Sbjct: 263 KPPPKIEKP--PPVPVYKPPPKIEHP-----PPVPVHKLPKKPCPPKKVDPPPVPVHKPP 315 Query: 548 XXPPQXP--TXPPPXPXFXLP 604 P P PPP P P Sbjct: 316 TKKPCPPKKVDPPPVPVHKPP 336 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPT--PPXXPXXXXPPPPXXXPPPXXXRPP 806 P +P P P P PP P PPP PPP PP Sbjct: 307 PPVPVHKPPTKKPCPPKKVDPPPVPV-HKPPPKIVIPPPKIEHPP 350 Score = 29.1 bits (62), Expect = 4.3 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPP-PXXXRPPXPLXPXXHP 833 P L CP P P PP P PP PP P PP P P Sbjct: 176 PFLKKPCPPKYSP-PVEVPPPVPVYEPPPKKEIPPPVPVYDPPPKKEVPPPVP 227 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P P PP P PPP PPP P P Sbjct: 245 PCPPKPPKIEHPPPVPV-YKPPPKIEKPPPVPVYKPPP 281 Score = 29.1 bits (62), Expect = 4.3 Identities = 18/71 (25%), Positives = 20/71 (28%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXX 550 KPP + P + P P PP PP P PP Sbjct: 334 KPPPKIVIPPPKIEHPPPVPVYKPPPKIEHPPIYIPPIVKKPCPPPVPIYKPPVVIPKKP 393 Query: 551 XPPQXPTXPPP 583 PP P PP Sbjct: 394 CPPPVPVYKPP 404 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +3 Query: 708 PPPXPTPTPP--XXPXXXXPPPPXXXPPPXXXRPP 806 PP P PP P PP P PPP PP Sbjct: 175 PPFLKKPCPPKYSPPVEVPPPVPVYEPPPKKEIPP 209 Score = 27.9 bits (59), Expect = 10.0 Identities = 26/92 (28%), Positives = 27/92 (29%), Gaps = 5/92 (5%) Frame = +2 Query: 344 KKKXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPS---PPPXXP 514 KK K PP P P P PP P P PPP Sbjct: 296 KKPCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKPP-PKIVIPPPKIEHPPPVPV 354 Query: 515 XXPPPPF-XTPXXXPP-QXPTXPPPXPXFXLP 604 PPP P PP PPP P + P Sbjct: 355 YKPPPKIEHPPIYIPPIVKKPCPPPVPIYKPP 386 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 38.3 bits (85), Expect = 0.007 Identities = 23/63 (36%), Positives = 24/63 (38%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXX 430 G G G G G G GG G+ GGG G GGG G G GG Sbjct: 51 GGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYGGGGHH 110 Query: 429 GGG 421 GGG Sbjct: 111 GGG 113 Score = 35.9 bits (79), Expect = 0.038 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G GG GGG GGGG G GG G GGG Sbjct: 80 GHGGHYGGGGGHYGGGGGHGGGGHYGGGGHHGGGG 114 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -1 Query: 805 GGRXXXGGGXXXGGGGXXXXGXXGGVGVGX---GGGXXGQKXG 686 GG GGG GGGG G GG G G GGG G G Sbjct: 45 GGHGGHGGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGG 87 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEG 490 G GGG G GG G GGGG G GGG G Sbjct: 86 GGGGGHYGGGGGHGGGGHYGGGGHHG--GGGHG 116 Score = 32.7 bits (71), Expect = 0.35 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 5/50 (10%) Frame = -1 Query: 820 GXRGWGGRXXXGG---GXXXGGGGXXXXGXXGGVG--VGXGGGXXGQKXG 686 G G GG GG G GGGG G GG G G GGG G G Sbjct: 48 GGHGGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGG 97 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G G G GGG GGGG G G G GGG G Sbjct: 76 GYGGGHGGHYGGGGGHYGGGGGHGGGGHYGGGGHHGGGGHG 116 Score = 30.7 bits (66), Expect = 1.4 Identities = 25/72 (34%), Positives = 25/72 (34%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPP 409 G GG G GG G G GG G GGG G G GG GGG Sbjct: 45 GGHGGHGG--GGHYGGGGHGHGGHNG--GGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGG 100 Query: 408 KRGXXGXGRXGG 373 G G GG Sbjct: 101 GGHYGGGGHHGG 112 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVG 719 G G G GG GGG GGG G GG G G Sbjct: 79 GGHGGHYGGGGGHYGGGGGHGGGGHYGGGGHHGGGGHG 116 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G G GG GG G GG GG G GGG G Sbjct: 59 GGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHG 99 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G G GG G G GG G GG G GGG G Sbjct: 65 GHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYG 105 Score = 28.3 bits (60), Expect = 7.5 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G G G G+GG GG GGGG G G G GGG Sbjct: 64 GGHNGGGGHGLDGYGGGH---GGHYGGGGGHYGGGGGHGGGGHYGGG 107 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 38.3 bits (85), Expect = 0.007 Identities = 27/78 (34%), Positives = 27/78 (34%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXX 430 G G G GGG G GG G GG G GGG G G GG Sbjct: 69 GHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGG---HYGGGGGGHGGGGHYGG 125 Query: 429 GGGXXPPKRGXXGXGRXG 376 GGG G G G G Sbjct: 126 GGGGYGGGGGHHGGGGHG 143 Score = 37.5 bits (83), Expect = 0.012 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVG--XGGGXXGQKXG 686 G G G GG GGG GGGG G GG G G GGG G G Sbjct: 83 GGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGG 133 Score = 37.1 bits (82), Expect = 0.016 Identities = 27/82 (32%), Positives = 29/82 (35%), Gaps = 2/82 (2%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXK--GGGGXXGXXGGGEGXVARXXGXGGAPXPXXXX 436 G G G G G G GG G+ GGGG G GG G G GG Sbjct: 49 GHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGG 108 Query: 435 XXGGGXXPPKRGXXGXGRXGGF 370 GGG G G GG+ Sbjct: 109 HYGGGGGGHGGGGHYGGGGGGY 130 Score = 37.1 bits (82), Expect = 0.016 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GG GGG GGGG G G G G GG G G Sbjct: 76 GGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYG 124 Score = 35.9 bits (79), Expect = 0.038 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXG----XXGGVGVGXGGGXXG 698 G G G GG GGG GGGG G GG G G GGG G Sbjct: 90 GGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHG 138 Score = 35.5 bits (78), Expect = 0.050 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVG-VGXGGGXXGQKXG 686 G G G GG G G GGGG G GG G G GGG G G Sbjct: 45 GGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGG 94 Score = 34.7 bits (76), Expect = 0.087 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGG--XXXXGXXGGVGVGXGGGXXGQKXG 686 G G GG GGG GGGG G GG G GGG G G Sbjct: 74 GYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGG 120 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G G G GG GGG GGGG G GG G GGG Sbjct: 104 GGGGGHYGGGGGGHGGGGHYGGGGG----GYGGGGGHHGGGG 141 Score = 31.5 bits (68), Expect = 0.81 Identities = 28/77 (36%), Positives = 28/77 (36%), Gaps = 5/77 (6%) Frame = -2 Query: 588 GXGG-GXVGXWGGXXXGVXKGGGGXX--GXXGGG--EGXVARXXGXGGAPXPXXXXXXGG 424 G GG G G GG G GGGG G GGG G G GG GG Sbjct: 46 GHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGG 105 Query: 423 GXXPPKRGXXGXGRXGG 373 G G G G GG Sbjct: 106 GGG--HYGGGGGGHGGG 120 Score = 31.5 bits (68), Expect = 0.81 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G G GGG GGGG G GG G GGG G G Sbjct: 62 GGHNGGGGHGLDGYGGGGGHYGGGGGHYGG--GGGHYGGGGGHYGGGGG 108 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G GG GG G GG GG G GGG G G Sbjct: 57 GGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGG 101 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXG 734 G G G GG GGG GGGG G G Sbjct: 111 GGGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 143 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 805 GGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 GG GGG GGGG G GG G GGG G Sbjct: 112 GGGGGHGGGGHYGGGG----GGYGGGGGHHGGGGHG 143 Score = 29.1 bits (62), Expect = 4.3 Identities = 23/74 (31%), Positives = 24/74 (32%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPP 409 G GGG G G GGG G GG G G GG GGG Sbjct: 42 GYGGGH-----GGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHY 96 Query: 408 KRGXXGXGRXGGFF 367 G G GG + Sbjct: 97 GGGGGHYGGGGGHY 110 Score = 29.1 bits (62), Expect = 4.3 Identities = 23/75 (30%), Positives = 24/75 (32%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXX 430 G G G G G G +GG GGG G G G G GG Sbjct: 60 GHGGHNGGGGHGLDG-YGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHG 118 Query: 429 GGGXXPPKRGXXGXG 385 GGG G G G Sbjct: 119 GGGHYGGGGGGYGGG 133 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 38.3 bits (85), Expect = 0.007 Identities = 27/91 (29%), Positives = 31/91 (34%), Gaps = 6/91 (6%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRA-TXPSPPPXXP-----XXPPPP 532 +PP P P P PPP PP P + + P PPP P P P Sbjct: 5 RPPYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYP 64 Query: 533 FXTPXXXPPQXPTXPPPXPXFXLPRPXXGXG 625 PP P PP P +P P G Sbjct: 65 QFNQLQAPP--PPPPPSAPPPLVPDPPRHQG 93 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 5/59 (8%) Frame = +3 Query: 687 PXFCPXXPPPX-----PTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P + P PP P P PP P PPPP P PP P G H P Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYP 64 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 12/63 (19%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTP-------PXXPXXXX-----PPPPXXXPPPXXXRPPXPLXP 821 P P P PP P P P P P PPPP PPP PP P Sbjct: 35 PPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPPPPPPPSAPPPLVPDPPRHQGP 94 Query: 822 XXH 830 H Sbjct: 95 NDH 97 Score = 30.3 bits (65), Expect = 1.9 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = +3 Query: 678 PXLPXFCPXXPPP-XPTPTPPXXP---XXXXPPPPXXXPPPXXXRPPXPLXP 821 P P PPP P P PP P PPPP PPP P P Sbjct: 15 PSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPP--PPPPHAYYQQGPHYP 64 >At1g70250.1 68414.m08082 receptor serine/threonine kinase, putative similar to to receptor serine/threonine kinase PR5K gi|1235680|gb|AAC49208 Length = 799 Score = 38.3 bits (85), Expect = 0.007 Identities = 23/54 (42%), Positives = 25/54 (46%) Frame = +2 Query: 449 GXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 G GAPP P PPP PPPP +P PP P+ P P LPRP Sbjct: 97 GSGAPPPPPDLF----PPPSAQMLPPPPASSP--APPSPPSSSRPRP---LPRP 141 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPP---PXXXPPPXXXRP-PXP 812 PPP P PP PPP P PP RP P P Sbjct: 101 PPPPPDLFPPPSAQMLPPPPASSPAPPSPPSSSRPRPLP 139 Score = 27.9 bits (59), Expect = 10.0 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 732 PPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PP P PP PPP P P P R P Sbjct: 101 PPPPPDLFPPPSAQMLPPPPASSPAPPSPPSSSRPRPLP 139 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P PP PTP P PPP PP PP P+ P Sbjct: 51 PADLPPPPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYP 91 Score = 37.1 bits (82), Expect = 0.016 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 P P + P P PTP P PPP PPP PP Sbjct: 57 PPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPPVAFPPP 99 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXT-PXXXPPQXPTXPPP 583 P P PP P SPPP PP P+ + P PP P PPP Sbjct: 44 PSPVYSSPADLPPPPTPVY-----SPPPADLPPPPTPYYSPPADLPPPTPIYPPP 93 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +2 Query: 491 PSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLP 604 PSP P PPP TP PP PPP P + P Sbjct: 44 PSPVYSSPADLPPP-PTPVYSPPPADLPPPPTPYYSPP 80 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 5/52 (9%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXP-XXPP----PPFXTPXXXPPQXPTXPPPXPXFXLP 604 P P + PPP P PP PP TP PP PPP P + P Sbjct: 44 PSPVYSSPADLPPPPTPVYSPPPADLPPPPTPYYSPP--ADLPPPTPIYPPP 93 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPX-XXPPPXXXRPPXPLXPXXHPGRHXPXNT 857 P P P+P PPPP PP PP P P P P T Sbjct: 38 PQHSPLPSPVYSSPADLPPPPTPVYSPPPADLPPPP-TPYYSPPADLPPPT 87 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P + P P P PTP P PPP PP P Sbjct: 72 PPTPYYSP--PADLPPPTPIYPPPVAFPPPQAYQAYYYRKSPPPP 114 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 37.9 bits (84), Expect = 0.009 Identities = 24/77 (31%), Positives = 26/77 (33%) Frame = -2 Query: 603 GRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGG 424 G K G G GG G GGG G +G G GG P GG Sbjct: 251 GPAKNGGKGAPAAGGGGAGGGKGAGGGAKGGPGNQNQG--GGKNGGGGHPQDGKNGGGGG 308 Query: 423 GXXPPKRGXXGXGRXGG 373 G K+G G G G Sbjct: 309 GPNAGKKGNGGGGPMAG 325 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 6/55 (10%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXG------GGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G +G GG G GG GGGG G GG G G G G G Sbjct: 266 GGAGGGKGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGGGGGPNAGKKGNGGG 320 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G G GG G GGGG G GG GGG Sbjct: 301 GKNGGGGGGPNAGKKGNGGGGPMAGGVSGGFRPMGGGG 338 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/69 (27%), Positives = 21/69 (30%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXPXNTIXXXXXXXXXX 890 PP P P P PPP PPP PP P H P Sbjct: 53 PPKPPPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPPIK 112 Query: 891 XXXPPQKXP 917 PP++ P Sbjct: 113 KYPPPEQYP 121 Score = 37.1 bits (82), Expect = 0.016 Identities = 23/82 (28%), Positives = 25/82 (30%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTP 544 KK PP P P + PP PP PPP PP + P Sbjct: 164 KKYPPQEQYP--PPIKKYPPPEKYPPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEEYPPP 221 Query: 545 XXXPPQXPTXPPPXPXFXLPRP 610 P P PP P P P Sbjct: 222 IKTYPHPPVKYPPPPYKTYPHP 243 Score = 32.3 bits (70), Expect = 0.46 Identities = 21/72 (29%), Positives = 23/72 (31%), Gaps = 1/72 (1%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPP-PFXTPX 547 K P P P+ PPP PP P PPP PP + P Sbjct: 48 KFPYSPPKPPPI--EKYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPPE 105 Query: 548 XXPPQXPTXPPP 583 PP PPP Sbjct: 106 QYPPPIKKYPPP 117 Score = 31.5 bits (68), Expect = 0.81 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = +3 Query: 708 PPPX---PTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 PPP P P P PPP P P PP P HP Sbjct: 199 PPPIKKYPPPIKKYPPPEEYPPPIKTYPHPPVKYPPPPYKTYPHP 243 Score = 31.5 bits (68), Expect = 0.81 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 1/58 (1%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXP-PPXXXRPPXPLXPXXHPGRHXP 848 P + + P P P T P P PPP P PP PP P P H P Sbjct: 207 PPIKKYPPPEEYPPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPP--PPEHYP 262 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +3 Query: 729 TPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 +PP P PPP PPP PP P Sbjct: 52 SPPKPPPIEKYPPPVQYPPPIKKYPPPP 79 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +3 Query: 708 PPPXPT-PTPP--XXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 PPP T P PP P PPP PPP PP P Sbjct: 88 PPPIKTYPHPPVKYPPPEQYPPPIKKYPPPEQYPPPIKKYP 128 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +3 Query: 708 PPPX--PTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 PPP P P P PPP PPP PP P Sbjct: 102 PPPEQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKYP 141 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/51 (35%), Positives = 21/51 (41%), Gaps = 4/51 (7%) Frame = +3 Query: 708 PPPXPT-PTPPXX---PXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PPP T P PP P PPPP P P + P P+ P + P Sbjct: 234 PPPYKTYPHPPIKTYPPPKECPPPPEHYPWPPKKKYPPPVEYPSPPYKKYP 284 Score = 30.3 bits (65), Expect = 1.9 Identities = 19/64 (29%), Positives = 21/64 (32%), Gaps = 4/64 (6%) Frame = +2 Query: 425 PPXXXXXXGXGAPPXPXXRATXPSP----PPXXPXXPPPPFXTPXXXPPQXPTXPPPXPX 592 PP +PP P P P PP PPP P PP T P P Sbjct: 41 PPFKWGPKFPYSPPKPPPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVK 100 Query: 593 FXLP 604 + P Sbjct: 101 YPPP 104 Score = 30.3 bits (65), Expect = 1.9 Identities = 21/80 (26%), Positives = 25/80 (31%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTP 544 K PP + P P+ PPP PP PPP PP + P Sbjct: 86 KYPPPIKTYPHPPV---KYPPPEQYP------PPIKKYPPPEQYPPPIKKYPPPEQYSPP 136 Query: 545 XXXPPQXPTXPPPXPXFXLP 604 P PPP + P Sbjct: 137 FKKYPPPEQYPPPIKKYPPP 156 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +3 Query: 708 PPPX--PTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 PPP P P P PPP PPP PP P Sbjct: 154 PPPEHYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYP 193 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 + P P P P P T P P PPP PPP PP P Sbjct: 74 KYPPPPYEHPPVKYPPPIKTYPHPPVKY--PPPEQYPPPIKKYPPPEQYP 121 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +3 Query: 708 PPPX--PTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 PPP P P P PPP PPP PP P Sbjct: 180 PPPEKYPPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEEYP 219 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/49 (32%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +3 Query: 708 PPPX--PTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PPP P P P PPP PPP P P+ P + P Sbjct: 193 PPPEQYPPPIKKYPPPIKKYPPPEEYPPPIKTYPHPPVKYPPPPYKTYP 241 Score = 28.7 bits (61), Expect = 5.7 Identities = 22/80 (27%), Positives = 26/80 (32%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTP 544 KK PP P P+ PPP +PP PPP PP + P Sbjct: 112 KKYPPPEQYPP-PIK--KYPPPEQY------SPPFKKYPPPEQYPPPIKKYPPPEHYPPP 162 Query: 545 XXXPPQXPTXPPPXPXFXLP 604 P PPP + P Sbjct: 163 IKKYPPQEQYPPPIKKYPPP 182 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/48 (33%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +3 Query: 708 PPPXPTPTP-PXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PPP P P P PPP PP PP P+ P ++ P Sbjct: 141 PPPEQYPPPIKKYPPPEHYPPPIKKYPPQEQYPP-PIKKYPPPEKYPP 187 Score = 28.7 bits (61), Expect = 5.7 Identities = 26/73 (35%), Positives = 28/73 (38%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTP 544 KK PP P P+ PPP PP P T P PP PPPP+ T Sbjct: 190 KKYPPPEQYPP-PIK--KYPPPIKKYPPPEEYPP-PIK--TYPHPPVK---YPPPPYKT- 239 Query: 545 XXXPPQXPTXPPP 583 P T PPP Sbjct: 240 -YPHPPIKTYPPP 251 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = +3 Query: 708 PPPX--PTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PPP P P P PP PPP PP P P H P Sbjct: 115 PPPEQYPPPIKKYPPPEQYSPPFKKYPPPEQYPPPIKKYP---PPEHYP 160 Score = 28.3 bits (60), Expect = 7.5 Identities = 22/80 (27%), Positives = 25/80 (31%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTP 544 KK PP P P+ PPP PP PPP PP + P Sbjct: 138 KKYPPPEQYPP-PIK--KYPPPEHYP------PPIKKYPPQEQYPPPIKKYPPPEKYPPP 188 Query: 545 XXXPPQXPTXPPPXPXFXLP 604 P PPP + P Sbjct: 189 IKKYPPPEQYPPPIKKYPPP 208 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/49 (32%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +3 Query: 708 PPPXPTPTPPXX--PXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PPP PP P PPP PPP + P P+ P + P Sbjct: 173 PPPIKKYPPPEKYPPPIKKYPPPEQYPPPIK-KYPPPIKKYPPPEEYPP 220 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 4/37 (10%) Frame = +3 Query: 708 PPPXPTPTPPXX----PXXXXPPPPXXXPPPXXXRPP 806 PPP P PP P PPP PP PP Sbjct: 249 PPPKECPPPPEHYPWPPKKKYPPPVEYPSPPYKKYPP 285 Score = 27.9 bits (59), Expect = 10.0 Identities = 25/87 (28%), Positives = 29/87 (33%), Gaps = 2/87 (2%) Frame = +2 Query: 350 KXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPX--PXXRATXPSPPPXXPXXP 523 K +K PP P P + PPP PP P T P PP P P Sbjct: 55 KPPPIEKYPP--PVQYPPPIKKYPPPPYEH-------PPVKYPPPIKTYPHPPVKYP--P 103 Query: 524 PPPFXTPXXXPPQXPTXPPPXPXFXLP 604 P + P P PPP + P Sbjct: 104 PEQYPPPIKKYPPPEQYPPPIKKYPPP 130 Score = 27.9 bits (59), Expect = 10.0 Identities = 21/83 (25%), Positives = 26/83 (31%), Gaps = 1/83 (1%) Frame = +2 Query: 344 KKKXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXP 523 KK + PP + P P+ PPP P + P PP P P Sbjct: 210 KKYPPPEEYPPPIKTYPHPPV---KYPPPPYKTYPHPPIKTYPPPKECPP-PPEHYPWPP 265 Query: 524 PPPFXTPXXXP-PQXPTXPPPXP 589 + P P P PP P Sbjct: 266 KKKYPPPVEYPSPPYKKYPPADP 288 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 37.5 bits (83), Expect = 0.012 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G GGR G G GGGG G GG G G GGG Sbjct: 106 GSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGG 140 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 814 RGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 RG GG GGG GGG G G G G GGG G G Sbjct: 117 RGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGG 159 Score = 34.7 bits (76), Expect = 0.087 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -1 Query: 832 GWXXGXRGWGGRX-XXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G G G GG GGG GGGG G G G G GGG G Sbjct: 114 GRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGG 159 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/50 (42%), Positives = 22/50 (44%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGG 460 G GR + GGG G GG G GGGG G GEG G GG Sbjct: 112 GSGRGRGSGGGGGHGGGGGGGGG-RGGGGGSGNGEGYGEGG-GYGGGYGG 159 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G R G G GG G G G G G GG G G GGG Sbjct: 114 GRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGGG 160 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G G G GGG GGGG G GG G G G G Sbjct: 109 GRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEG 146 Score = 33.1 bits (72), Expect = 0.26 Identities = 22/79 (27%), Positives = 22/79 (27%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXX 430 G G G G GGGG G G G GG Sbjct: 60 GAGSGSGGGGSSSSSSSSSSSSSSSGGGGGDAGSEAGSYAGSHAGSGSGGRSGSGRGRGS 119 Query: 429 GGGXXPPKRGXXGXGRXGG 373 GGG G G GR GG Sbjct: 120 GGGGGHGGGGGGGGGRGGG 138 Score = 32.7 bits (71), Expect = 0.35 Identities = 23/73 (31%), Positives = 24/73 (32%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPP 409 G GGG G G G G G G G G G R G GG G G Sbjct: 85 GGGGGDAGSEAGSYAG-SHAGSGSGGRSGSGRG---RGSGGGGGHGGGGGGGGGRGGGGG 140 Query: 408 KRGXXGXGRXGGF 370 G G GG+ Sbjct: 141 SGNGEGYGEGGGY 153 Score = 32.7 bits (71), Expect = 0.35 Identities = 20/72 (27%), Positives = 22/72 (30%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPP 409 G G G + G G GG G G G G GG G G Sbjct: 89 GDAGSEAGSYAGSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYG 148 Query: 408 KRGXXGXGRXGG 373 + G G G GG Sbjct: 149 EGGGYGGGYGGG 160 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -2 Query: 603 GRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGG 424 G G G G G GGGG G GGG G G G GG Sbjct: 96 GSYAGSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGG 155 Query: 423 G 421 G Sbjct: 156 G 156 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = -2 Query: 603 GRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGG 424 G G G G G +G G G GG G G GG GG Sbjct: 92 GSEAGSYAGSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGG 151 Query: 423 G 421 G Sbjct: 152 G 152 Score = 28.3 bits (60), Expect = 7.5 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGG 460 G G G G GG G GGGG G GGG G G GG Sbjct: 104 GSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRG-GGGGSGN-GEGYGEGG 151 Score = 27.9 bits (59), Expect = 10.0 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXG--VXKGGGGXXGXXGGGE 493 G G G GGG G GG G +GGG G GG + Sbjct: 122 GGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGGGDD 162 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 37.5 bits (83), Expect = 0.012 Identities = 34/129 (26%), Positives = 39/129 (30%), Gaps = 1/129 (0%) Frame = +2 Query: 458 APPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT-XPPPXPXFXLPRPXXGXGXGG 634 +PP P +T +PPP PPP TP PP T P P LP Sbjct: 14 SPPSPPTNSTTTTPPPAA--SSPPPTTTPSSPPPSPSTNSTSPPPSSPLP--------PS 63 Query: 635 LXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXS 814 L P PS P PP P PP P + P + Sbjct: 64 LPPPSPPGSLTPPLPQPS---PSAPITPSPPSPTTPSNPRSPPSPNQGPPNTPSGSTPRT 120 Query: 815 XSXXPPGAP 841 S P P Sbjct: 121 PSNTKPSPP 129 Score = 33.9 bits (74), Expect = 0.15 Identities = 24/78 (30%), Positives = 25/78 (32%), Gaps = 1/78 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP-PPFXTPXX 550 PP P PPP PP P +T SPPP P P PP P Sbjct: 18 PPTNSTTTTPPPAASSPPPTTTPS---SPPPSPSTNST--SPPPSSPLPPSLPPPSPPGS 72 Query: 551 XPPQXPTXPPPXPXFXLP 604 P P P P P Sbjct: 73 LTPPLPQPSPSAPITPSP 90 Score = 33.1 bits (72), Expect = 0.26 Identities = 22/70 (31%), Positives = 24/70 (34%), Gaps = 4/70 (5%) Frame = +2 Query: 413 GXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQX----PTXPP 580 G P P P A+ P PP P PPP T PP P+ PP Sbjct: 8 GTTPSPSPPSPPTNSTTTTPPPAASSP-PPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPP 66 Query: 581 PXPXFXLPRP 610 P P L P Sbjct: 67 PSPPGSLTPP 76 Score = 32.7 bits (71), Expect = 0.35 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +3 Query: 708 PPPXPTPT-PPXXPXXXXPPPPXXXPPPXXXRPPXP 812 PPP TP+ PP P PP P P PP P Sbjct: 34 PPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSP 69 Score = 32.3 bits (70), Expect = 0.46 Identities = 23/83 (27%), Positives = 25/83 (30%), Gaps = 1/83 (1%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQX 565 P P PL PP P P T P P P P P +P PP Sbjct: 54 PPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSP-PSPNQGPPNT 112 Query: 566 PTXPPP-XPXFXLPRPXXGXGXG 631 P+ P P P P G Sbjct: 113 PSGSTPRTPSNTKPSPPSDSSDG 135 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPG 836 PPP P P+PP P PPP P+ P PG Sbjct: 217 PPPKP-PSPPRKPPPPPPPPAFMSSSGGSDYSDLPVLPPPSPG 258 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/70 (27%), Positives = 20/70 (28%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P PPP P P PPP P PP P Sbjct: 27 PPPAASSPPPTTTPSSPPPSPSTN---STSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPS 83 Query: 554 PPQXPTXPPP 583 P P+ P P Sbjct: 84 APITPSPPSP 93 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/64 (31%), Positives = 23/64 (35%), Gaps = 8/64 (12%) Frame = +3 Query: 687 PXFCPXXPPPXPT-------PTPPXXPXXXXPPPPXXXPPP-XXXRPPXPLXPXXHPGRH 842 P P PPP P+ P+ P P P PP PP P P+ P P Sbjct: 36 PTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSP-PSPT 94 Query: 843 XPXN 854 P N Sbjct: 95 TPSN 98 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 491 PSPPPXXPXXPPPP-FXTPXXXP--PQXPTXPPPXPXFXL 601 PSPP P PPPP F + P PPP P L Sbjct: 222 PSPPRKPPPPPPPPAFMSSSGGSDYSDLPVLPPPSPGLVL 261 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P P P P+PP PPP PPP P P Sbjct: 11 PSPSP-PSPPTNSTTTTPPPAASSPPPTTTPSSPPPSP 47 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 37.5 bits (83), Expect = 0.012 Identities = 26/80 (32%), Positives = 28/80 (35%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXX 430 G G + G GGG GG G GGG G G EG G GG Sbjct: 91 GGGGHRGGGGGGYRSGGGGGYSG---GGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 147 Query: 429 GGGXXPPKRGXXGXGRXGGF 370 GG G G G GG+ Sbjct: 148 YGGGRREGGGGYGGGEGGGY 167 Score = 37.5 bits (83), Expect = 0.012 Identities = 21/50 (42%), Positives = 22/50 (44%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G +R G G G GG GGG GGGG G G G GGG G Sbjct: 101 GGYRSGGGGGYSGGGGSYGGGGGRREGGGG-YSGGGGGYSSRGGGGGSYG 149 Score = 37.1 bits (82), Expect = 0.016 Identities = 25/78 (32%), Positives = 26/78 (33%) Frame = -2 Query: 606 RGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXG 427 + R G GG G GG G G G G GGG G G G G Sbjct: 85 QSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGG 144 Query: 426 GGXXPPKRGXXGXGRXGG 373 GG R G G GG Sbjct: 145 GGSYGGGRREGGGGYGGG 162 Score = 37.1 bits (82), Expect = 0.016 Identities = 27/80 (33%), Positives = 32/80 (40%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXX 430 G G + G GGG G G G + GG G GGG G +R G GG+ Sbjct: 99 GGGGYRSGGGGGYSGGGGSYGGGGGRREGGG-GYSGGGGGYSSRGGG-GGSYGGGRREGG 156 Query: 429 GGGXXPPKRGXXGXGRXGGF 370 GG G G G GG+ Sbjct: 157 GGYGGGEGGGYGGSGGGGGW 176 Score = 36.3 bits (80), Expect = 0.028 Identities = 22/54 (40%), Positives = 23/54 (42%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G R G G R GG GGG GGGG G GG G GGG + G Sbjct: 93 GGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREG--GGGYSGGGGGYSSRGGG 144 Score = 34.7 bits (76), Expect = 0.087 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G R G G GG GGG GGG G GG G G GGG G G Sbjct: 122 GGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGG--GGYGGGEGGGYGGSGGG 173 Score = 32.7 bits (71), Expect = 0.35 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 5/54 (9%) Frame = -1 Query: 832 GWXXGXRGWGG---RXXXGGGXXXGGGGXXXXG--XXGGVGVGXGGGXXGQKXG 686 G G RG GG R GGG GGG G GG G GGG + G Sbjct: 90 GGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGG 143 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G G GG GGG GGG G GG G GGG Sbjct: 88 GSGGGGGHRGGGGGGYRSGGGGGYSG--GGGSYGGGGG 123 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 799 RXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXGR 683 R GGG GGGG GG G GGG G GR Sbjct: 87 RGSGGGGGHRGGGGGGYRSGGGG-GYSGGGGSYGGGGGR 124 Score = 31.5 bits (68), Expect = 0.81 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G RG GG GGG GGGG G GG G GGG Sbjct: 135 GGGYSSRGGGG-GSYGGGRREGGGGYGG-GEGGGYGGSGGGG 174 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G G GG GGG GGGG GG G GGG Sbjct: 116 GSYGGGGGRREGGGGYSGGGG--GYSSRGGGGGSYGGG 151 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 37.5 bits (83), Expect = 0.012 Identities = 35/162 (21%), Positives = 41/162 (25%), Gaps = 6/162 (3%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPS-PPPXXPXXPPPPFXTPXX 550 PP P + PPP P + T S PPP PPPP+ +P Sbjct: 166 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSP 225 Query: 551 XPPQXPTXPP-----PXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXX 715 P PP P P + P P P P Sbjct: 226 KPVYKSPPPPYVYSSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPIYKSPPPP 285 Query: 716 XXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPPGAP 841 P P P PPP + P P P Sbjct: 286 YVYNSPPPPYYSPSPKPAYKSPPPPYVYSFPPPPYYSPSPKP 327 Score = 37.1 bits (82), Expect = 0.016 Identities = 35/143 (24%), Positives = 41/143 (28%), Gaps = 3/143 (2%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPX--PXXRATXPSPPPXXP-XXPPPPFXTP 544 PP P L PPP PP P + SPPP PPPP+ +P Sbjct: 442 PPPYYSPSPKLTYKSSPPPYVYSSP---PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP 498 Query: 545 XXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXX 724 P + PPP P P + P P + Sbjct: 499 -SPKPSYKSPPPPYVYNSPPPPYYSPSPKVIYKSPPHPHVCVCPPPPPCYSHSPKIEYKS 557 Query: 725 XXXXXXXXPPXPPPPXXXPPPXP 793 P PPPP P P P Sbjct: 558 PPTPYVYHSP-PPPPYYSPSPKP 579 Score = 35.5 bits (78), Expect = 0.050 Identities = 33/141 (23%), Positives = 39/141 (27%), Gaps = 11/141 (7%) Frame = +2 Query: 458 APPXPXXRATXP------SPPPXXPXXPPPPFXTPXXXPPQXPTXPP-----PXPXFXLP 604 +PP P + P SPPP PPPP+ +P P PP P P + P Sbjct: 566 SPPPPPYYSPSPKPAYKSSPPPYVYSSPPPPYYSPAPKPVYKSPPPPYVYNSPPPPYYSP 625 Query: 605 RPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXPP 784 P P P P P P PP Sbjct: 626 SPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPP 685 Query: 785 PXPXXAXPXSXSXXPPGAPXP 847 P + P P AP P Sbjct: 686 PPYVYSSPPPPYYSP--APKP 704 Score = 35.1 bits (77), Expect = 0.066 Identities = 23/84 (27%), Positives = 27/84 (32%), Gaps = 5/84 (5%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P+ PP P P P PPP PPPP+ +P Sbjct: 318 PPYYSPSPKPVYKSPPPPYVYNSPPPPYYSPSPKPAYKSP-PPPYVYSSPPPPYYSPSPK 376 Query: 554 PPQXPTXPP-----PXPXFXLPRP 610 P PP P P + P P Sbjct: 377 PTYKSPPPPYVYSSPPPPYYSPSP 400 Score = 35.1 bits (77), Expect = 0.066 Identities = 23/84 (27%), Positives = 27/84 (32%), Gaps = 5/84 (5%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P+ PP P P P PPP PPPP+ +P Sbjct: 595 PPYYSPAPKPVYKSPPPPYVYNSPPPPYYSPSPKPTYKSP-PPPYVYSSPPPPYYSPTPK 653 Query: 554 PPQXPTXPP-----PXPXFXLPRP 610 P PP P P + P P Sbjct: 654 PTYKSPPPPYVYSSPPPPYYSPSP 677 Score = 34.3 bits (75), Expect = 0.11 Identities = 24/85 (28%), Positives = 28/85 (32%), Gaps = 6/85 (7%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P PPP P + T SPPP PPPP+ +P Sbjct: 341 PPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSP 400 Query: 551 XPPQXPTXPP-----PXPXFXLPRP 610 P PP P P + P P Sbjct: 401 KPVYKSPPPPYIYNSPPPPYYSPSP 425 Score = 34.3 bits (75), Expect = 0.11 Identities = 33/144 (22%), Positives = 40/144 (27%) Frame = +2 Query: 377 PXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXP 556 P P P + PPP P P ++ PPP PPPP+ +P P Sbjct: 377 PTYKSPPPPYVYSSPPPPYY------SPSPKPVYKSP---PPPYIYNSPPPPYYSPSPKP 427 Query: 557 PQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXX 736 PPP + P P L P P + Sbjct: 428 SY--KSPPPPYVYSSPPPPYYSPSPKLTYKSSPPPYVYSSPPPPYYSPSPKVVYKSPPPP 485 Query: 737 XXXXPPXPPPPXXXPPPXPXXAXP 808 PPPP P P P P Sbjct: 486 YVY--SSPPPPYYSPSPKPSYKSP 507 Score = 34.3 bits (75), Expect = 0.11 Identities = 34/161 (21%), Positives = 38/161 (23%), Gaps = 5/161 (3%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P PP P P P PPP PPPP+ +P Sbjct: 570 PPYYSPSPKPAYKSSPPPYVYSSPPPPYYSPAPKPVYKSP-PPPYVYNSPPPPYYSPSPK 628 Query: 554 PPQXPTXPP-----PXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXX 718 P PP P P + P P P P Sbjct: 629 PTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPY 688 Query: 719 XXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPPGAP 841 P P P PPP + P P P Sbjct: 689 VYSSPPPPYYSPAPKPTYKSPPPPYVYSSPPPPYYSPSPKP 729 Score = 34.3 bits (75), Expect = 0.11 Identities = 35/162 (21%), Positives = 42/162 (25%), Gaps = 7/162 (4%) Frame = +2 Query: 377 PXRPXPXXPLLGGXXPPPXXXXXXGXG--APPXPXXRATXPSP---PPXXPXX--PPPPF 535 P P P + PPP +PP P ++ P P P P PPPP+ Sbjct: 604 PVYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPPY 663 Query: 536 XTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXX 715 PP P P P + P P P P Sbjct: 664 VYSSPPPPYYS--PSPKPTYKSPPPPYVYSSPPPPYYSPAPKPTYKSPPPPYVYSSPPPP 721 Query: 716 XXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPPGAP 841 P PP PPP P + P P Sbjct: 722 YYSPSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPP 763 Score = 33.9 bits (74), Expect = 0.15 Identities = 34/162 (20%), Positives = 40/162 (24%), Gaps = 6/162 (3%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 66 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 125 Query: 551 XPPQXPTXPP-----PXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXX 715 P PP P P + P P P P Sbjct: 126 KPTYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 185 Query: 716 XXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPPGAP 841 P P P PPP + P P P Sbjct: 186 YVYNSPPPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKP 227 Score = 33.5 bits (73), Expect = 0.20 Identities = 25/90 (27%), Positives = 31/90 (34%), Gaps = 6/90 (6%) Frame = +2 Query: 359 TXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPS------PPPXXPXX 520 T PP P + PPP +PP P + P PPP Sbjct: 10 TYSSPPPPLYDSPTPKVDYKSPPPPYVY----SSPPPPLSYSPSPKVDYKSPPPPYVYSS 65 Query: 521 PPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 PPPP+ +P P PPP + P P Sbjct: 66 PPPPYYSP--SPKVEYKSPPPPYVYSSPPP 93 Score = 33.5 bits (73), Expect = 0.20 Identities = 23/83 (27%), Positives = 29/83 (34%), Gaps = 5/83 (6%) Frame = +2 Query: 377 PXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXP 556 P P P + PPP P P ++ PPP PPPP+ +P P Sbjct: 302 PAYKSPPPPYVYSFPPPPYY------SPSPKPVYKSP---PPPYVYNSPPPPYYSPSPKP 352 Query: 557 PQXPTXPP-----PXPXFXLPRP 610 PP P P + P P Sbjct: 353 AYKSPPPPYVYSSPPPPYYSPSP 375 Score = 33.1 bits (72), Expect = 0.26 Identities = 24/84 (28%), Positives = 28/84 (33%), Gaps = 6/84 (7%) Frame = +2 Query: 377 PXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTP---- 544 P P P + PPP P P P PPP PPPP+ +P Sbjct: 729 PTYKSPPPPYVYSSPPPPPYYS-------PSPKVEYKSP-PPPYVYSSPPPPYYSPSPKV 780 Query: 545 --XXXPPQXPTXPPPXPXFXLPRP 610 PP PP P + P P Sbjct: 781 EYKSPPPPYVYSSPPPPPYYSPSP 804 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/55 (30%), Positives = 20/55 (36%), Gaps = 6/55 (10%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTP------XXXPPQXPTXPPPXPXFXLPRP 610 P P P PP PPPP+ +P PP PP P + P P Sbjct: 776 PSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYYSPSP 830 Score = 31.9 bits (69), Expect = 0.61 Identities = 20/69 (28%), Positives = 24/69 (34%), Gaps = 6/69 (8%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXXXPPQXPTXPP-----P 583 PPP P + SPPP PPPP+ +P P PP P Sbjct: 282 PPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSFPPPPYYSPSPKPVYKSPPPPYVYNSP 341 Query: 584 XPXFXLPRP 610 P + P P Sbjct: 342 PPPYYSPSP 350 Score = 31.5 bits (68), Expect = 0.81 Identities = 18/50 (36%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPP---XXXPPPXXXRPPXP 812 + P P PPP +PTP P PPPP PPP P P Sbjct: 632 KSPPPPYVYSSPPPPYYSPTP--KPTYKSPPPPYVYSSPPPPYYSPSPKP 679 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/65 (30%), Positives = 24/65 (36%), Gaps = 2/65 (3%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXP--XXPPPPFXTPXXXPPQXPTXPPPXPXF 595 PPP P + T SPPP PPPP+ +P P PPP + Sbjct: 709 PPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPPYYSP--SPKVEYKSPPPPYVY 766 Query: 596 XLPRP 610 P P Sbjct: 767 SSPPP 771 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/57 (31%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPP---XXXPPPXXXRPPXPLXPXXHP 833 + P P PPP +P+P P PPPP PPP P P+ P Sbjct: 355 KSPPPPYVYSSPPPPYYSPSP--KPTYKSPPPPYVYSSPPPPYYSPSPKPVYKSPPP 409 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/49 (34%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPP--XXXPPPXXXRPPXP 812 + P P PPP +P+P P PPPP PPP P P Sbjct: 707 KSPPPPYVYSSPPPPYYSPSP--KPTYKSPPPPYVYSSPPPPPYYSPSP 753 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P + P P +P PP PP P P PP P Sbjct: 191 PPPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKSPPPP 235 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P + P P +P PP PP P P PP P Sbjct: 241 PPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPIYKSPPPP 285 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P + P P +P PP PP P P PP P Sbjct: 291 PPPPYYSPSPKPAYKSPPPPYVYSFPPPPYYSPSPKPVYKSPPPP 335 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P + P P +P PP PP P P PP P Sbjct: 341 PPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPP 385 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P + P P +P PP PP P P PP P Sbjct: 366 PPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSPKPVYKSPPPP 410 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P + P P +P PP PP P P PP P Sbjct: 618 PPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPP 662 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P + P P +P PP PP P P PP P Sbjct: 643 PPPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPP 687 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P + P P +P PP PP P P PP P Sbjct: 668 PPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPAPKPTYKSPPPP 712 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P + P P +P PP PP P P PP P Sbjct: 693 PPPPYYSPAPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPP 737 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P + P P +P PP PP P P PP P Sbjct: 216 PPPPYYSPSPKPVYKSPPPPYVYSSPPPPYYSPSPKPAYKSPPPP 260 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/50 (34%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPP---XXXPPPXXXRPPXP 812 + P P PPP +P+P P PPPP PPP P P Sbjct: 305 KSPPPPYVYSFPPPPYYSPSP--KPVYKSPPPPYVYNSPPPPYYSPSPKP 352 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P + P P +P PP PP P P PP P Sbjct: 316 PPPPYYSPSPKPVYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPP 360 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/50 (34%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPP---XXXPPPXXXRPPXP 812 + P P PPP +P+P P PPPP PPP P P Sbjct: 380 KSPPPPYVYSSPPPPYYSPSP--KPVYKSPPPPYIYNSPPPPYYSPSPKP 427 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P + P P +P PP PP P P PP P Sbjct: 391 PPPPYYSPSPKPVYKSPPPPYIYNSPPPPYYSPSPKPSYKSPPPP 435 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = +2 Query: 458 APPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 +PP P + P PPP P P + + PP + PPP P+P Sbjct: 557 SPPTPYVYHS-PPPPPYYSPSPKPAYKS--SPPPYVYSSPPPPYYSPAPKP 604 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P + P P +P PP PP P P PP P Sbjct: 593 PPPPYYSPAPKPVYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPP 637 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/50 (34%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPP---XXXPPPXXXRPPXP 812 + P P PPP +P+P P PPPP PPP P P Sbjct: 657 KSPPPPYVYSSPPPPYYSPSP--KPTYKSPPPPYVYSSPPPPYYSPAPKP 704 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP--XXXRPPXP 812 P P + P P +P PP PPPP P P PP P Sbjct: 718 PPPPYYSPSPKPTYKSPPPPYV-YSSPPPPPYYSPSPKVEYKSPPPP 763 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPX--XXPPPXXXRPPXP 812 P + PPP P +P PPPP PPP P P Sbjct: 787 PPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYYSPSP 830 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP--XXXRPPXP 812 P P + P P +P PP PPPP P P PP P Sbjct: 116 PPPPYYSPSPKPTYKSPPPPY--VYNSPPPPYYSPSPKVEYKSPPPP 160 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P + P P +P PP PP P P PP P Sbjct: 266 PPPPYYSPSPKPIYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPP 310 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/50 (34%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPP---XXXPPPXXXRPPXP 812 + P P PPP +P+P P PPPP PPP P P Sbjct: 330 KSPPPPYVYNSPPPPYYSPSP--KPAYKSPPPPYVYSSPPPPYYSPSPKP 377 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/50 (34%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPP--XXXPPPXXXRPPXPL 815 + P P PPP +P+P P PPPP PPP P L Sbjct: 405 KSPPPPYIYNSPPPPYYSPSP--KPSYKSPPPPYVYSSPPPPYYSPSPKL 452 Score = 29.5 bits (63), Expect = 3.3 Identities = 18/59 (30%), Positives = 22/59 (37%), Gaps = 2/59 (3%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPP--XXXPPPXXXRPPXPLXPXXHPGRH 842 + P P PPP +P+P P PPPP PPP P + P H Sbjct: 480 KSPPPPYVYSSPPPPYYSPSP--KPSYKSPPPPYVYNSPPPPYYSPSPKVIYKSPPHPH 536 Score = 29.5 bits (63), Expect = 3.3 Identities = 26/129 (20%), Positives = 31/129 (24%), Gaps = 5/129 (3%) Frame = +2 Query: 470 PXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPP-----PXPXFXLPRPXXGXGXGG 634 P P P PPPP+ +P P + PP P P + P P Sbjct: 551 PKIEYKSPPTPYVYHSPPPPPYYSPSPKPAYKSSPPPYVYSSPPPPYYSPAPKPVYKSPP 610 Query: 635 LXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXS 814 P P P P P PPP + P Sbjct: 611 PPYVYNSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPPYVYSSPPP 670 Query: 815 XSXXPPGAP 841 P P Sbjct: 671 PYYSPSPKP 679 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/50 (34%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPP---XXXPPPXXXRPPXP 812 + P P PPP +P+P P PPPP PPP P P Sbjct: 607 KSPPPPYVYNSPPPPYYSPSP--KPTYKSPPPPYVYSSPPPPYYSPTPKP 654 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/50 (34%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPP---XXXPPPXXXRPPXP 812 + P P PPP +P P P PPPP PPP P P Sbjct: 682 KSPPPPYVYSSPPPPYYSPAP--KPTYKSPPPPYVYSSPPPPYYSPSPKP 729 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/46 (34%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPP--XXXPPPXXXRP 803 + P P PPP +P+P P PPPP PPP P Sbjct: 105 KSPPPPYVYSSPPPPYYSPSP--KPTYKSPPPPYVYNSPPPPYYSP 148 Score = 29.1 bits (62), Expect = 4.3 Identities = 25/89 (28%), Positives = 29/89 (32%), Gaps = 10/89 (11%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAP---PXPXXRATXPSPPPXXPXXPPPP-FXT 541 PP P + PPP P P P P PPP PPPP + + Sbjct: 769 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSP-PPPYVYSSPPPPTYYS 827 Query: 542 P------XXXPPQXPTXPPPXPXFXLPRP 610 P PP PP P + P P Sbjct: 828 PSPKVEYKSPPPPYVYNSPPPPAYYSPSP 856 Score = 29.1 bits (62), Expect = 4.3 Identities = 18/72 (25%), Positives = 21/72 (29%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PPP P SPPP P P PP + Sbjct: 811 PPPPYVYSSPPPPTYYSPSPKVEYKSPPPPYVYNSPPPPAYYSPSPKIEYKSPPPPYVYS 870 Query: 572 XPPPXPXFXLPR 607 PPP P+ Sbjct: 871 SPPPPSYSPSPK 882 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/47 (29%), Positives = 17/47 (36%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 + P P PPP +P+P PP PPP P P Sbjct: 758 KSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSP 804 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/41 (34%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPX--XXPPPXXXRP 803 P + PPP P +P PPPP PPP P Sbjct: 736 PPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSP 776 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/48 (31%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRP-PXP 812 + P P PPP +P+P PP PPP P P P Sbjct: 80 KSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKP 127 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/48 (31%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRP-PXP 812 + P P PPP +P+P PP PPP P P P Sbjct: 155 KSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKP 202 Score = 27.9 bits (59), Expect = 10.0 Identities = 21/71 (29%), Positives = 24/71 (33%), Gaps = 1/71 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP A P + SPPP PPPP +P Sbjct: 822 PPTYYSPSPKVEYKSPPPPYVYNSPPPPAYYSPSPKIEYKSPPPPYVYSSPPPPSYSP-- 879 Query: 551 XPPQXPTXPPP 583 P PPP Sbjct: 880 SPKAEYKSPPP 890 >At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 646 Score = 37.1 bits (82), Expect = 0.016 Identities = 23/63 (36%), Positives = 24/63 (38%) Frame = -2 Query: 558 GGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPPKRGXXGXGRX 379 GG GGGG G GGG G A G G P GGG P RG Sbjct: 569 GGGGADYYGGGGGYGGVPGGGYG--AMPGGYGPVPGGGYGNVPGGGYAPYGRGGGAYYGP 626 Query: 378 GGF 370 GG+ Sbjct: 627 GGY 629 Score = 33.9 bits (74), Expect = 0.15 Identities = 23/80 (28%), Positives = 26/80 (32%) Frame = -2 Query: 603 GRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGG 424 G K GG G +GGGG GGG G G P GG Sbjct: 545 GGGKNRRSGGRFGGRDFRRESFSRGGGGADYYGGGGGYGGVPGGGYGAMPGGYGPVPGGG 604 Query: 423 GXXPPKRGXXGXGRXGGFFF 364 P G GR GG ++ Sbjct: 605 YGNVPGGGYAPYGRGGGAYY 624 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -1 Query: 808 WGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 +GGR GGGG G GG G GGG G Sbjct: 556 FGGRDFRRESFSRGGGGADYYGGGGGYGGVPGGGYGAMPGG 596 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = -1 Query: 814 RGWGGRXXXGGGXXXGG-GGXXXXGXXGGVGVGXGGG 707 RG GG GGG GG G GG G GGG Sbjct: 568 RGGGGADYYGGGGGYGGVPGGGYGAMPGGYGPVPGGG 604 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 37.1 bits (82), Expect = 0.016 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 PPP P P P P PPPP PP P P Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPP 126 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 PP P P+PP PPP PP PP P Sbjct: 93 PPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPPP 127 Score = 33.1 bits (72), Expect = 0.26 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPP 832 PP PPPP PP P P S PP Sbjct: 98 PPSPPPPSQACPPPPLPPSPPKKSYCPP 125 Score = 32.7 bits (71), Expect = 0.35 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = +2 Query: 470 PXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P PSPPP PPPP P P + PPP + P Sbjct: 92 PPPSPPPPSPPPPSQACPPPPL--PPSPPKKSYCPPPPSTYIYMTGP 136 Score = 29.5 bits (63), Expect = 3.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 762 PPPXXXPPPXXXRPPXPLXP 821 PPP PPP PP PL P Sbjct: 96 PPPPSPPPPSQACPPPPLPP 115 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 PP P PP P PPPP PPP P PL P Sbjct: 861 PPLQPQSQPPEPPPEMMPPPPQALPPPLPHSHP-PLVP 897 Score = 35.5 bits (78), Expect = 0.050 Identities = 21/63 (33%), Positives = 23/63 (36%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXL 601 PPP PP ++ P PPP PPPP P P P PP P L Sbjct: 848 PPPLGHSLPSVLQPPLQP-QSQPPEPPPE--MMPPPPQALPPPLPHSHPPLVPPPPFSPL 904 Query: 602 PRP 610 P Sbjct: 905 LSP 907 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P PP P P P PPP PP PP P P P Sbjct: 861 PPLQPQSQPPEPPPEMMPPPPQALPPPLPHSHPPLV--PPPPFSPLLSP 907 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 3/63 (4%) Frame = +2 Query: 401 PLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSP---PPXXPXXPPPPFXTPXXXPPQXPT 571 P LG P PP P P P PP P PP P P P Sbjct: 849 PPLGHSLPSVLQPPLQPQSQPPEPPPEMMPPPPQALPPPLPHSHPPLVPPPPFSPLLSPR 908 Query: 572 XPP 580 PP Sbjct: 909 LPP 911 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +2 Query: 464 PXPXXRATXPS--PPPXXPXXPPPPFXTPXXXPPQXPTXPPPXP 589 P P + PS PP P PP P PP PPP P Sbjct: 847 PPPPLGHSLPSVLQPPLQPQSQPPE-PPPEMMPPPPQALPPPLP 889 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PPP P P PPP PP P P H P Sbjct: 848 PPPLGHSLPSVLQPPLQPQSQPPEPPPEMMPPPPQALPPPLPHSHPP 894 Score = 27.9 bits (59), Expect = 10.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 752 PXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 P PPP PPP P P PP P P Sbjct: 869 PPEPPPEMMPPP-PQALPPPLPHSHPPLVPPP 899 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 36.7 bits (81), Expect = 0.022 Identities = 24/79 (30%), Positives = 27/79 (34%), Gaps = 2/79 (2%) Frame = +2 Query: 359 TXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRA--TXPSPPPXXPXXPPPP 532 T P P P + PP PP P T P+ PP P PP P Sbjct: 285 TLPPNPLIPSPPSLPPIPLIPTPPTLPTIPLLPTPPTPTLPPIPTIPTLPPL-PVLPPVP 343 Query: 533 FXTPXXXPPQXPTXPPPXP 589 P PP P+ P P P Sbjct: 344 IVNPPSLPPPPPSFPVPLP 362 Score = 35.1 bits (77), Expect = 0.066 Identities = 24/80 (30%), Positives = 26/80 (32%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPP-PXXPXXPPPPFXTPXX 550 P P P P P P P T PP P P PP P P Sbjct: 284 PTLPPNPLIPSPPSLPPIPLIPTPPTLPTIPLLPTPPTPTLPPIPTIPTLPPLPVLPPVP 343 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P+ PPP P F +P P Sbjct: 344 IV-NPPSLPPPPPSFPVPLP 362 Score = 34.3 bits (75), Expect = 0.11 Identities = 21/74 (28%), Positives = 21/74 (28%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 P P P P L P PP P P P P PP P Sbjct: 322 PTLPPIPTIPTLPPLPVLPPVPIVNPPSLPPPPPSFPVPLPPVPGLPGIPPVPLIPGIPP 381 Query: 554 PPQXPTXPPPXPXF 595 P P PP P F Sbjct: 382 APLIPGIPPLSPSF 395 Score = 33.5 bits (73), Expect = 0.20 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPT-PPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P LP P P P PTPT PP PP P P P P P P P Sbjct: 308 PTLPTI-PLLPTP-PTPTLPPIPTIPTLPPLPVLPPVPIVNPPSLPPPPPSFP 358 Score = 31.9 bits (69), Expect = 0.61 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPP--PXXXPPPXXXR-PPXPLXPXXHP 833 P LP P PP P PP P P P P P P PP PL P P Sbjct: 337 PVLPPV-PIVNPPSLPPPPPSFPVPLPPVPGLPGIPPVPLIPGIPPAPLIPGIPP 390 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXX-PPPPXXXPPPXXXRPPXPLXPXXHP 833 P PP PTPP P P PP PP P P P P Sbjct: 296 PSLPPIPLIPTPPTLPTIPLLPTPPTPTLPPIPTIPTLPPLPVLPP 341 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +3 Query: 699 PXXPPPXPTPTP--PXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P PP P P P P PP P PP PP PL P Sbjct: 265 PLNPPSIIPPNPLIPSIPTPTLPPNPLIPSPPSL--PPIPLIP 305 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXP-PPXXXRPPXPLXP 821 P LP P P P PT P P PP P P P PP P+ P Sbjct: 296 PSLPPI-PLIPTPPTLPTIPLLPT---PPTPTLPPIPTIPTLPPLPVLP 340 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 P P P PTP P P PP P P PP Sbjct: 269 PSIIPPNPLIPSIPTPTLPPNPLIPSPPSLPPIPLIPTPP 308 Score = 30.3 bits (65), Expect = 1.9 Identities = 19/60 (31%), Positives = 21/60 (35%), Gaps = 8/60 (13%) Frame = +3 Query: 678 PXLPXF-CPXXPPPXPTPTPPXXPXXXXPPPPXXXP-------PPXXXRPPXPLXPXXHP 833 P +P P PP P+PP P P P P PP PP P P P Sbjct: 276 PLIPSIPTPTLPPNPLIPSPPSLPPIPLIPTPPTLPTIPLLPTPPTPTLPPIPTIPTLPP 335 Score = 30.3 bits (65), Expect = 1.9 Identities = 21/68 (30%), Positives = 22/68 (32%), Gaps = 2/68 (2%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT 571 P P + PP P P P P P PPPP P PP P Sbjct: 308 PTLPTIPLLPTPPTPTLPPIPTIPTLPPLPVLPPVPIVNPPSLPPPPPSFPVPLPP-VPG 366 Query: 572 XP--PPXP 589 P PP P Sbjct: 367 LPGIPPVP 374 Score = 30.3 bits (65), Expect = 1.9 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P LP P P P PP P P PP P PP PL P P P Sbjct: 334 PPLPVL-PPVPIVNPPSLPPPPPSFPVPLPPVPGLPGI---PPVPLIPGIPPAPLIP 386 Score = 29.9 bits (64), Expect = 2.5 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = +3 Query: 669 GRXPXLPXFCPXXPPPXPT-PTPPXXPXXXXPPPPXXXPPPXXXRP--PXPLXPXXHP 833 G P LP P PPP P P P PP P P P P PL P P Sbjct: 175 GSKPLLPD--PSFPPPLQDPPNPSPLPNLPIVPPLPNLPVPKLPVPDLPLPLVPPLLP 230 Score = 29.9 bits (64), Expect = 2.5 Identities = 24/77 (31%), Positives = 26/77 (33%), Gaps = 4/77 (5%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPP--PXXPXXPPPPFXTPXXXPP 559 P P P + PP PP P T P+ P P P PP P P P Sbjct: 274 PNPLIPSIPTPTLPPNPLIPSPPSLPPIPLI-PTPPTLPTIPLLPT-PPTPTLPPIPTIP 331 Query: 560 QXPTXP--PPXPXFXLP 604 P P PP P P Sbjct: 332 TLPPLPVLPPVPIVNPP 348 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P +P P PP P P PPPP P P PP P P P Sbjct: 325 PPIPTI-PTLPPLPVLPPVPIVNPPSLPPPPPSFPVPL---PPVPGLPGIPP 372 Score = 27.9 bits (59), Expect = 10.0 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXP 577 PP P + P P P PP P P PT P Sbjct: 273 PPNPLIPSIPTPTLPPNPLIPSPPSLPPIPLIPTPPTLP 311 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPPPPFXTPXXXP 556 PP P R + PSPPP PPPP P P Sbjct: 26 PPPPPMRRSAPSPPPMSGRVPPPPPPPPMFDP 57 Score = 31.9 bits (69), Expect = 0.61 Identities = 23/72 (31%), Positives = 25/72 (34%), Gaps = 1/72 (1%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXX-RATXPSPPPXXPXXPPPPFXTPX 547 +PP RP + PPP G P P R PSPPP PP P Sbjct: 601 RPPSRPRYACCRIPAVNPPPRLVC----GPYPLPRLVRVGSPSPPPPSMSGGAPPPPPPP 656 Query: 548 XXPPQXPTXPPP 583 T PPP Sbjct: 657 PMLVASRTAPPP 668 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +2 Query: 449 GXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXP 589 G A P R P PPP PPP + PP PPP P Sbjct: 8 GADAVVTPPMRGRVPLPPPP----PPPMRRSAPSPPPMSGRVPPPPP 50 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/58 (31%), Positives = 22/58 (37%) Frame = +3 Query: 669 GRXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRH 842 GR P LP P PPP P P PPP PP + + PG++ Sbjct: 19 GRVP-LP---PPPPPPMRRSAPSPPPMSGRVPPPPPPPPMFDPKGAGRVICCLRPGQN 72 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/52 (32%), Positives = 20/52 (38%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXT 541 P P P + G PPP PP P A+ +PPP PF T Sbjct: 638 PSPPPPSMSGGAPPPP---------PPPPMLVASRTAPPPHLSHVRSIPFQT 680 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PP P PP P P PPP P PL G P Sbjct: 595 PPPSIPRPPSRPRYACCRIPAVNPPPRLVCGPYPLPRLVRVGSPSP 640 Score = 27.9 bits (59), Expect = 10.0 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 491 PSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXF 595 P PPP P PP + PP PPP P F Sbjct: 26 PPPPPMRRSAPSPPPMSGRVPPP-----PPPPPMF 55 >At5g07190.1 68418.m00819 embryo-specific protein 3, putative similar to embryo-specific protein 3 GI:3335171 from [Arabidopsis thaliana] Length = 213 Score = 36.7 bits (81), Expect = 0.022 Identities = 18/36 (50%), Positives = 19/36 (52%) Frame = +2 Query: 503 PXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P PPP F P PP+ PT PPP P PRP Sbjct: 154 PSSPDLPPPHF--PPEFPPETPTTPPPPP----PRP 183 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 1/25 (4%) Frame = +3 Query: 699 PXXPPPX-PTPTPPXXPXXXXPPPP 770 P PPP P PP P PPPP Sbjct: 157 PDLPPPHFPPEFPPETPTTPPPPPP 181 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 36.7 bits (81), Expect = 0.022 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Frame = +2 Query: 422 PPPXXXXXXGXG----APPXPXXRATXPSPPPXXPXXP-PPPFXTPXXXPPQXPTXPPP 583 PPP G A P P P PPP P PPP + PP P PPP Sbjct: 285 PPPKRSISLGDSTENRADPPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 35.1 bits (77), Expect = 0.066 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 PPP P P PP PP PPP PP Sbjct: 310 PPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 PP P P PP PPP PP PP P Sbjct: 310 PPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 4/34 (11%) Frame = +3 Query: 699 PXXPPPXPTPT----PPXXPXXXXPPPPXXXPPP 788 P PPP P P PP PPPP PPP Sbjct: 310 PPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXK 853 PP PPPP PP P S + PP P P K Sbjct: 313 PPPPPPPLLQQPPPPPSV---SKAPPPPPPPPPPK 344 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +3 Query: 708 PPPX---PTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 PPP P P PP P PPP PP PP P P Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPP---PPSVSKAPPPPPPP 340 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP PPPP PP P S S PP P P Sbjct: 310 PPPPPPP--PPPLLQQPPPPPSVSKAPPPPPPP 340 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTP 544 K PP R PP PP P P PP PPPP P Sbjct: 284 KPPPKRSISLGDSTENRADPPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXP 472 K PP P P PLL PPP PP P Sbjct: 307 KSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +2 Query: 491 PSPPPXXPXXPPPPFXTPXXXPPQXPT---XPPPXP 589 P P P PPPP PP P+ PPP P Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPP 338 Score = 27.9 bits (59), Expect = 10.0 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +2 Query: 491 PSPPPXXPXXPPPPFXTPXXXPPQXPTXP 577 P PPP P PP + PP P+ P Sbjct: 29 PLPPPPPPPLKPPSSGSATTKPPINPSKP 57 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 36.7 bits (81), Expect = 0.022 Identities = 26/77 (33%), Positives = 26/77 (33%) Frame = -2 Query: 603 GRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGG 424 GR G GGG G GG G GG G G GGG G G GG Sbjct: 98 GRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGGDNSCFKCGEPGHMARECSQGGGG 157 Query: 423 GXXPPKRGXXGXGRXGG 373 G G G GG Sbjct: 158 YSGGGGGGRYGSGGGGG 174 Score = 36.3 bits (80), Expect = 0.028 Identities = 28/80 (35%), Positives = 30/80 (37%), Gaps = 1/80 (1%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGE-GXVARXXGXGGAPXPXXXXX 433 G GR GG G +GG G GGGG GE G +AR GG Sbjct: 105 GGGRGGGRGGGSYGGGYGGRGSGGRGGGGGDNSCFKCGEPGHMARECSQGGG-----GYS 159 Query: 432 XGGGXXPPKRGXXGXGRXGG 373 GGG G G G GG Sbjct: 160 GGGGGGRYGSGGGGGGGGGG 179 Score = 33.9 bits (74), Expect = 0.15 Identities = 22/70 (31%), Positives = 24/70 (34%) Frame = -2 Query: 582 GGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPPKR 403 GGG G GG G +GGG G GGG G GG G + Sbjct: 92 GGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGGDNSCFKCGEPGHMAREC 151 Query: 402 GXXGXGRXGG 373 G G GG Sbjct: 152 SQGGGGYSGG 161 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -1 Query: 805 GGRXXXGGGXXXGG--GGXXXXGXXGGVGVGXGGGXXG 698 GGR GGG GG GG G GG G G GG G Sbjct: 97 GGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGG 134 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 787 GGGXXXGGGGXXXXGXXGGVGVGXGG 710 GGG GGGG G GG G G GG Sbjct: 154 GGGGYSGGGGGGRYGSGGGGGGGGGG 179 Score = 29.9 bits (64), Expect = 2.5 Identities = 33/125 (26%), Positives = 34/125 (27%) Frame = -2 Query: 831 GGXXXXEXGXAXXGXGGGXXXGGGGXGGXXXXXXXXXXXXXXXXGKKXEGXGXXRXXXXX 652 G G G G GGGG GG G + G G Sbjct: 83 GAPVQGNSGGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGGDNSCFKCG 142 Query: 651 XXXXGRPPXPXPXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXX 472 G G G GGG G GG GGGG G G AR Sbjct: 143 EPGHMARECSQ---GGGGYSGGGGGGRYGSGGGG----GGGGGGLSCYSCGESGHFARDC 195 Query: 471 GXGGA 457 GGA Sbjct: 196 TSGGA 200 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G G G G GGR GG GGG G G G G GGG Sbjct: 92 GGGSSGGRGGFGGGGGRGGGRGGGSYGGG----YGGRGSGGRGGGGG 134 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -2 Query: 588 GXGGGXV-GXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGG 460 G G V G GG +GG G G GGG G + G GG Sbjct: 80 GPDGAPVQGNSGGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGG 123 Score = 28.3 bits (60), Expect = 7.5 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 531 GGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPPKRGXXGXGRXGG 373 GGGG G GG G R G GG GGG RG G G GG Sbjct: 91 GGGGSSGGRGGFGGGGGRGGGRGGG-------SYGGGYG--GRGSGGRGGGGG 134 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 787 GGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 GGG GG G G GG G G GGG G G Sbjct: 91 GGGGSSGGRGGFGGG--GGRGGGRGGGSYGGGYG 122 Score = 27.5 bits (58), Expect(2) = 1.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 769 GGGGXXXXGXXGGVGVGXGGGXXG 698 GGGG G G G G GGG G Sbjct: 154 GGGGYSGGGGGGRYGSGGGGGGGG 177 Score = 21.4 bits (43), Expect(2) = 1.9 Identities = 11/32 (34%), Positives = 12/32 (37%) Frame = -1 Query: 853 FXGXWRPGWXXGXRGWGGRXXXGGGXXXGGGG 758 F G G G +GG G GGGG Sbjct: 102 FGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGG 133 >At1g04660.1 68414.m00463 glycine-rich protein Length = 212 Score = 36.7 bits (81), Expect = 0.022 Identities = 21/57 (36%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGG-GXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGG 421 G GG +G GG G+ K GG G G GG G + G G A GGG Sbjct: 144 GLGGAGLGGVGGVGGGIGKAGGIGGLGGLGGAGGGLGGVGGLGKAGGIGVGGGIGGG 200 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G G G GG GG G GG G GG G+G GG G Sbjct: 114 GGVGGLGGVGGGVGGLGGVGGGVGGLGGVGGLGGAGLGGVGGVGG 158 Score = 32.7 bits (71), Expect = 0.35 Identities = 27/74 (36%), Positives = 29/74 (39%), Gaps = 2/74 (2%) Frame = -2 Query: 588 GXGG-GXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGG-GXX 415 G GG +G GG G GG G G GGG G + G GGA GG G Sbjct: 106 GIGGFHSIGGVGGL--GGVGGGVGGLGGVGGGVGGLGGVGGLGGAGLGGVGGVGGGIGKA 163 Query: 414 PPKRGXXGXGRXGG 373 G G G GG Sbjct: 164 GGIGGLGGLGGAGG 177 Score = 31.9 bits (69), Expect = 0.61 Identities = 21/50 (42%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXG-GGXXGQKXG 686 G G G GG GGG GG G GG+GVG G GG G G Sbjct: 161 GKAGGIGGLGGLGGAGGGL----GGVGGLGKAGGIGVGGGIGGGHGVVGG 206 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGG-GXXGQKXG 686 G G GG GGG GG G GG G G GG G G+ G Sbjct: 146 GGAGLGGVGGVGGGIGK-AGGIGGLGGLGGAGGGLGGVGGLGKAGG 190 Score = 30.3 bits (65), Expect = 1.9 Identities = 20/51 (39%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXG-GGXXXGGGGXXXXGXXGGVG-VGXGGGXXGQKXG 686 G G G GG G GG GGG G GG+G +G GG G G Sbjct: 134 GGVGGLGGVGGLGGAGLGGVGGVGGGIGKAGGIGGLGGLGGAGGGLGGVGG 184 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G GG GG GGG G GG+G GG G G Sbjct: 115 GVGGLGGVGGGVGGLGGVGGGVGGLGGVGGLGGAGLGGVGGVGGG 159 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 36.3 bits (80), Expect = 0.028 Identities = 25/84 (29%), Positives = 26/84 (30%), Gaps = 4/84 (4%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPX--PXXRATXP--SPPPXXPXXPPPPFX 538 KPP P P PP PP P P + PP P PP Sbjct: 125 KPPT-PTVKPPTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQ 183 Query: 539 TPXXXPPQXPTXPPPXPXFXLPRP 610 P PP P PP P P P Sbjct: 184 PPTYNPPTTPVKPPTAPPVKPPTP 207 Score = 36.3 bits (80), Expect = 0.028 Identities = 22/80 (27%), Positives = 23/80 (28%) Frame = +2 Query: 350 KXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPP 529 K T KPP P PP P T P PP P Sbjct: 125 KPPTPTVKPPTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQP 184 Query: 530 PFXTPXXXPPQXPTXPPPXP 589 P P P + PT PP P Sbjct: 185 PTYNPPTTPVKPPTAPPVKP 204 Score = 36.3 bits (80), Expect = 0.028 Identities = 19/49 (38%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPP--PPXXXPPPXXXRPP--XPLXPXXHP 833 P P PT TPP P PP PP PP +PP P+ P P Sbjct: 160 PTSPVKPPTTTPPVKPPTTTPPVQPPTYNPPTTPVKPPTAPPVKPPTPP 208 Score = 34.7 bits (76), Expect = 0.087 Identities = 24/80 (30%), Positives = 25/80 (31%), Gaps = 1/80 (1%) Frame = +2 Query: 347 KKXXTXKKKPPXRPX-PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXP 523 K T KPP P P+ PP PP T P PP P Sbjct: 132 KPPTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTY--NP 189 Query: 524 PPPFXTPXXXPPQXPTXPPP 583 P P PP P PPP Sbjct: 190 PTTPVKPPTAPPVKPPTPPP 209 Score = 33.5 bits (73), Expect = 0.20 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 1/67 (1%) Frame = +3 Query: 720 PTPTPPXXPXXXXPPPPXXXPPPXXXRPP-XPLXPXXHPGRHXPXNTIXXXXXXXXXXXX 896 PTPT P PP P PP +PP P P P P Sbjct: 34 PTPTLPSPSPATKPPSPALKPPTPSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPVKPPVS 93 Query: 897 XPPQKXP 917 PP K P Sbjct: 94 TPPIKLP 100 Score = 33.1 bits (72), Expect = 0.26 Identities = 20/55 (36%), Positives = 22/55 (40%), Gaps = 8/55 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXP--PPXPTPT---PPXXPXXXXPPPPXXXPP---PXXXRPPXP 812 + P P P P PP TP PP P PP P PP P +PP P Sbjct: 75 KPPVKPPTIPVTPVKPPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPPTYKPPTP 129 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/50 (36%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +3 Query: 672 RXPXLPXFCPXXPPP--XPTPTPPXXPXXXXPP-PPXXXPPPXXXRPPXP 812 + P P P PP PT TPP P PP P P +PP P Sbjct: 158 KPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNPPTTPVKPPTAPPVKPPTP 207 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/71 (26%), Positives = 21/71 (29%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPX 547 K PP +P P PP P + PP P PP P Sbjct: 98 KLPPVQPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPP-VQSPPVQPPT 156 Query: 548 XXPPQXPTXPP 580 PP P PP Sbjct: 157 YKPPTSPVKPP 167 Score = 31.9 bits (69), Expect = 0.61 Identities = 22/74 (29%), Positives = 22/74 (29%), Gaps = 1/74 (1%) Frame = +3 Query: 699 PXXPPPXPTPTPP-XXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXPXNTIXXXXX 875 P PP PT PP P PP P PP P P P P T Sbjct: 105 PTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQPP--TYKPPTS 162 Query: 876 XXXXXXXXPPQKXP 917 PP K P Sbjct: 163 PVKPPTTTPPVKPP 176 Score = 31.5 bits (68), Expect = 0.81 Identities = 26/87 (29%), Positives = 27/87 (31%), Gaps = 2/87 (2%) Frame = +2 Query: 350 KXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPP 529 K T KPP P P+ PP P PP P PP Sbjct: 53 KPPTPSYKPPT--LPTTPIKPPTTKPPVKPPTIPVTPVKPPVSTPPIKLPPVQPPTYKPP 110 Query: 530 PFXTPXXXPP--QXPTXPPPXPXFXLP 604 TP PP Q PT PP P P Sbjct: 111 ---TPTVKPPSVQPPTYKPPTPTVKPP 134 Score = 31.1 bits (67), Expect = 1.1 Identities = 26/88 (29%), Positives = 30/88 (34%), Gaps = 8/88 (9%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPP---PPXXXPP--PXXXRPPXPL--XPXXHPG 836 P P P PP PT P P PP PP PP P +PP P P P Sbjct: 65 PTTPIKPPTTKPPVKPPTIPVTP--VKPPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPP 122 Query: 837 RHXPXN-TIXXXXXXXXXXXXXPPQKXP 917 + P T+ PP + P Sbjct: 123 TYKPPTPTVKPPTTSPVKPPTTPPVQSP 150 Score = 30.3 bits (65), Expect = 1.9 Identities = 22/81 (27%), Positives = 24/81 (29%), Gaps = 3/81 (3%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPF--XTP 544 KPP P P P PP P+P P PP + TP Sbjct: 70 KPPTTKPPVKPPTIPVTPVKPPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPPTYKPPTP 129 Query: 545 XXXPP-QXPTXPPPXPXFXLP 604 PP P PP P P Sbjct: 130 TVKPPTTSPVKPPTTPPVQSP 150 Score = 29.9 bits (64), Expect = 2.5 Identities = 23/75 (30%), Positives = 25/75 (33%), Gaps = 4/75 (5%) Frame = +2 Query: 371 KPPXRPXPXX--PLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP--PPFX 538 KPP P P+ PP PP PP P PP PP Sbjct: 89 KPPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQ 148 Query: 539 TPXXXPPQXPTXPPP 583 +P P Q PT PP Sbjct: 149 SP---PVQPPTYKPP 160 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXP 589 P P PP P + PS P P P P P PP P P P Sbjct: 34 PTPTLPSPSPATKPPSPALKPPTPSYKP--PTLPTTPIKPPTTKPPVKPPTIPVTP 87 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/41 (31%), Positives = 15/41 (36%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P PP P+ PP P PP P P P+ P Sbjct: 50 PALKPPTPSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPVKP 90 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 P LP P PP P PP P P P P +PP Sbjct: 36 PTLPSPSPATKPPSPALKPP-TPSYKPPTLPTTPIKPPTTKPP 77 Score = 27.9 bits (59), Expect = 10.0 Identities = 11/33 (33%), Positives = 13/33 (39%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP PP PP P P + + PP P Sbjct: 90 PPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPP 122 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 36.3 bits (80), Expect = 0.028 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +2 Query: 425 PPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXF 595 PP PP P + PPP PPP PP PP P F Sbjct: 44 PPPSKPSPSMSPPPSPSLPLSSSPPPPPPHKHSPPPLSQSLSPPPLITVIHPPPPRF 100 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXR-PPXPLXPXXHP 833 P PP P+P+ P PPP PPP P PL HP Sbjct: 51 PSMSPP-PSPSLPLSSSPPPPPPHKHSPPPLSQSLSPPPLITVIHP 95 Score = 31.5 bits (68), Expect = 0.81 Identities = 23/76 (30%), Positives = 26/76 (34%), Gaps = 8/76 (10%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXP------SPPPXXPXXPPPP- 532 PP +P P PPP PP P + + P SPPP PPP Sbjct: 45 PPSKPSP------SMSPPPSPSLPLSSSPPPPPPHKHSPPPLSQSLSPPPLITVIHPPPP 98 Query: 533 -FXTPXXXPPQXPTXP 577 F PP P P Sbjct: 99 RFYYFESTPPPPPLSP 114 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXKHN 859 PP P P PPP P + P S S P P P KH+ Sbjct: 45 PPSKPSPSMSPPPSP--SLPLSSSPPP---PPPHKHS 76 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/49 (30%), Positives = 17/49 (34%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P C PP P+P+ P P PPP P PL P Sbjct: 39 PTICSP-PPSKPSPSMSPPPSPSLPLSSSPPPPPPHKHSPPPLSQSLSP 86 Score = 29.1 bits (62), Expect = 4.3 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 8/56 (14%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPP--PXXXPPP------XXXRPPXPLXP 821 P LP PPP +PP PPP PPP PP PL P Sbjct: 59 PSLPLSSSPPPPPPHKHSPPPLSQSLSPPPLITVIHPPPPRFYYFESTPPPPPLSP 114 >At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 161 Score = 36.3 bits (80), Expect = 0.028 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +3 Query: 696 CPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPG 836 C P P P P+P P PPP P P P P+ P PG Sbjct: 30 CKPSPKPKPVPSPKPKPVQCPPPPRPSVPSPN----PRPVTPPRTPG 72 Score = 27.9 bits (59), Expect = 10.0 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 512 PXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P +P P Q P PPP P P P Sbjct: 32 PSPKPKPVPSPKPKPVQCP--PPPRPSVPSPNP 62 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 36.3 bits (80), Expect = 0.028 Identities = 35/140 (25%), Positives = 42/140 (30%), Gaps = 11/140 (7%) Frame = +2 Query: 461 PPXPXXRATXP----SPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGX 628 PP P + P SPPP PP P+ PP + PPP P P Sbjct: 289 PPSPYVYKSPPYVYSSPPPYAYSPPPSPYV--YKSPPYVYSSPPPYAYSPPPSPYVYKSP 346 Query: 629 GGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPP----XPPPP---XXXPPP 787 P PS ++ PP PPPP PPP Sbjct: 347 ---PYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYTYSPPPYAYSPPPPCPDVYKPPP 403 Query: 788 XPXXAXPXSXSXXPPGAPXP 847 + P PP +P P Sbjct: 404 YVYSSPPPYVYNPPPSSPPP 423 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 PPP PP P PPP PP P P P P Sbjct: 384 PPPYAYSPPPPCPDVYKPPPYVYSSPPPYVYNPPPSSPPPSP 425 Score = 30.7 bits (66), Expect = 1.4 Identities = 37/171 (21%), Positives = 47/171 (27%), Gaps = 9/171 (5%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPP-PXXXXXXGXGAPPXPXXRATXP----SPPPXXPXXPPPP 532 K PP P + PP PP P + P SPPP PP P Sbjct: 130 KSPPYVYSSPPPYVYSSPPPYAYSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSP 189 Query: 533 FXTPXXXPPQXPTXPPP----XPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLX 700 + PP + PPP P + P P PS ++ Sbjct: 190 YV--YKSPPYVYSSPPPYAYSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVY 247 Query: 701 XXXXXXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXK 853 P PP P P + P + PP +P K Sbjct: 248 KSPPYVYSSPPPYAYSP--PPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYK 296 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P + PPP P P PPP PPP PP P Sbjct: 385 PPYAYSPPPPCPDVYKPPPYVYSSPPPYVYNPPPSSP-PPSP 425 Score = 29.5 bits (63), Expect = 3.3 Identities = 30/125 (24%), Positives = 34/125 (27%), Gaps = 6/125 (4%) Frame = +2 Query: 491 PSPPPXXPXXPPPPFXTP------XXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXX 652 PSPPP PPP +P PP + PPP P P Sbjct: 33 PSPPPYVYSSPPPYTYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSP---PYVYS 89 Query: 653 XXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPP 832 P PS ++ PP P PP P S PP Sbjct: 90 SPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYVYSSPPP 149 Query: 833 GAPXP 847 A P Sbjct: 150 YAYSP 154 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 P P + PPP PP PP PPP PP Sbjct: 33 PSPPPYVYSSPPPYTYSPPPSPYVYKSPPYVYSSPPPYAYSPP 75 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +2 Query: 494 SPPPXXPXXPPPPFXTPXXXPPQX----PTXPPPXPXFXLPRP 610 SPPP P PP PP P+ PPP P + P Sbjct: 390 SPPPPCPDVYKPPPYVYSSPPPYVYNPPPSSPPPSPSYSYSSP 432 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 P + PPP PP PP PPP PP Sbjct: 60 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPP 99 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 P + PPP PP PP PPP PP Sbjct: 84 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPP 123 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/54 (27%), Positives = 17/54 (31%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P + PPP PP PP PPP P P P + P Sbjct: 108 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYVYSSPPPYAYSPPPYAYSP 161 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 P + PPP PP PP PPP PP Sbjct: 171 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPP 210 Score = 28.3 bits (60), Expect = 7.5 Identities = 27/120 (22%), Positives = 34/120 (28%) Frame = +2 Query: 494 SPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRX 673 SPPP PP P+ PP + PPP P P Sbjct: 208 SPPPYAYSPPPSPYV--YKSPPYVYSSPPPYAYSPPPSPYVYKSP---PYVYSSPPPYAY 262 Query: 674 XPXPSXFLXXXXXXXXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXK 853 P PS ++ P PP P P + P + PP +P K Sbjct: 263 SPPPSPYVYKSPPYVYSSPPPYAYSP--PPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYK 320 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 P + PPP PP PP PPP PP Sbjct: 226 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPP 265 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 P + PPP PP PP PPP PP Sbjct: 250 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPP 289 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 P + PPP PP PP PPP PP Sbjct: 274 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPP 313 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 P + PPP PP PP PPP PP Sbjct: 298 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPP 337 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 P + PPP PP PP PPP PP Sbjct: 322 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPP 361 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 P + PPP PP PP PPP PP Sbjct: 346 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYTYSPP 385 Score = 27.9 bits (59), Expect = 10.0 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP 788 P + PPP +PP P PPP PPP Sbjct: 132 PPYVYSSPPPYVYSSPP--PYAYSPPPYAYSPPP 163 >At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 202 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G RG GGR GGG GGGG GG G GGG G Sbjct: 10 GFRGRGGRDGGGGGRFGGGGGRF---GGGGGRFGGGGGRFG 47 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/49 (42%), Positives = 22/49 (44%) Frame = -2 Query: 636 RPPXPXPXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEG 490 RPP RGR GGG G +GG G GGGG G GG G Sbjct: 2 RPPMRGGGGFRGRGGRDGGGG--GRFGG-GGGRFGGGGGRFGGGGGRFG 47 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 838 RPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXG 743 R G G G GG GGG GGGG G Sbjct: 17 RDGGGGGRFGGGGGRFGGGGGRFGGGGGRFGG 48 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 36.3 bits (80), Expect = 0.028 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G GG GGG GGGG G GG G G GGG G Sbjct: 76 GGGGGHYGGGGGHYGGGGGHYGG--GGGGYGGGGGHHG 111 Score = 35.9 bits (79), Expect = 0.038 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGG 460 G G G GGG G GG GGGG G GGG G G GG Sbjct: 69 GHGLDGYGGGGGHYGGGGGHYG----GGGGHYGGGGGGYGGGGGHHGGGG 114 Score = 35.5 bits (78), Expect = 0.050 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVG-VGXGGGXXGQKXG 686 G G G GG G G GGGG G GG G G GGG G G Sbjct: 45 GGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGG 94 Score = 33.9 bits (74), Expect = 0.15 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 2/65 (3%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXK--GGGGXXGXXGGGEGXVARXXGXGGAPXPXXXX 436 G G G G G G GG G+ GGGG G GG G G GG Sbjct: 49 GHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGGGG 108 Query: 435 XXGGG 421 GGG Sbjct: 109 HHGGG 113 Score = 33.5 bits (73), Expect = 0.20 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G G G GG GGG GGGG G GG G GGG G Sbjct: 76 GGGGGHYGGGGGHYGGGGGHYGGGG----GGYGGGGGHHGGGGHG 116 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G G G G GGG GGGG G G G G GGG G Sbjct: 62 GGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYG-GGGGGYGG 105 Score = 31.5 bits (68), Expect = 0.81 Identities = 24/72 (33%), Positives = 24/72 (33%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPP 409 G GGG G G GGG G GG G G GG GGG Sbjct: 42 GYGGGH-----GGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHY 96 Query: 408 KRGXXGXGRXGG 373 G G G GG Sbjct: 97 GGGGGGYGGGGG 108 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G GG GG G GG GG G GGG G G Sbjct: 57 GGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGG 101 Score = 29.5 bits (63), Expect = 3.3 Identities = 25/72 (34%), Positives = 25/72 (34%), Gaps = 1/72 (1%) Frame = -2 Query: 588 GXGG-GXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXP 412 G GG G G GG G GGGG G G G G G G GGG Sbjct: 46 GHGGHGGHGGGGGHGHGGHNGGGGH-GLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYG 104 Query: 411 PKRGXXGXGRXG 376 G G G G Sbjct: 105 GGGGHHGGGGHG 116 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGV 728 G G G GG GGG GGGG G G+ Sbjct: 83 GGGGGHYGGGGGHYGGGGGGYGGGGGHHGGGGHGL 117 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 36.3 bits (80), Expect = 0.028 Identities = 23/72 (31%), Positives = 25/72 (34%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P P+ PPP PP P + PSPP PPPP Sbjct: 243 PPPPPPPPIPVKQSATPPP----------PPPPKLKNNGPSPP------PPPPLKKTAAL 286 Query: 554 PPQXPTXPPPXP 589 PPP P Sbjct: 287 SSSASKKPPPAP 298 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P PPP P P P PPPP PP P Sbjct: 241 PTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPP 278 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 693 FCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 F P P P P PP PPP PPP + P P P Sbjct: 236 FVKPDPTPPPPPPPPIPVKQSATPPP---PPPPKLKNNGPSPPPPPP 279 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 10/41 (24%) Frame = +2 Query: 497 PPPXXPXXPPPPF-----XTPXXXPP-----QXPTXPPPXP 589 P P P PPPP TP PP P+ PPP P Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 767 PXXXPPPXPXXAXPXSXSXXPPGAPXPXKHNS 862 P PPP P P S PP P P N+ Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPPPPPPKLKNN 270 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPL 815 P P PPP P P PPP P PP PL Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPP-PPPPL 280 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 35.9 bits (79), Expect = 0.038 Identities = 27/73 (36%), Positives = 29/73 (39%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPP 409 G GGG G +GG G K GGG G GG G G GG GGG P Sbjct: 235 GYGGGHGGGYGG-PGGPYKSGGGYGGGRSGGYG------GYGGEFGGYGGGGYGGGVG-P 286 Query: 408 KRGXXGXGRXGGF 370 RG G G + Sbjct: 287 YRGEPALGYSGRY 299 Score = 35.9 bits (79), Expect = 0.038 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXG-VXKGGGGXXGXXGGGEGXVARXXGXGG 460 G G G GGG GG G V GG G G GGG G + G GG Sbjct: 356 GYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGG 406 Score = 35.1 bits (77), Expect = 0.066 Identities = 27/82 (32%), Positives = 29/82 (35%), Gaps = 2/82 (2%) Frame = -2 Query: 609 GRGRXKXGXGGGXV--GXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXX 436 G G G GG G +GG G G GG G GGG G G P Sbjct: 239 GHGGGYGGPGGPYKSGGGYGGGRSGGYGGYGGEFGGYGGG-GYGGGVGPYRGEPALGYSG 297 Query: 435 XXGGGXXPPKRGXXGXGRXGGF 370 GGG RG G GG+ Sbjct: 298 RYGGGGGGYNRGGYSMGGGGGY 319 Score = 35.1 bits (77), Expect = 0.066 Identities = 24/73 (32%), Positives = 26/73 (35%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPP 409 G GGG +GG G GG G GGG G GG GGG Sbjct: 318 GYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGY-- 375 Query: 408 KRGXXGXGRXGGF 370 G G G GG+ Sbjct: 376 DMGGVGGGGAGGY 388 Score = 35.1 bits (77), Expect = 0.066 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 805 GGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 GG GGG GGGG G GG G G G G G Sbjct: 359 GGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGG 398 Score = 33.9 bits (74), Expect = 0.15 Identities = 28/85 (32%), Positives = 29/85 (34%) Frame = -2 Query: 624 PXPXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPX 445 P G G G GG G G G GGG G GGG A G GG Sbjct: 341 PSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGG---AGGYGAGGGGNGG 397 Query: 444 XXXXXGGGXXPPKRGXXGXGRXGGF 370 GGG RG G G G + Sbjct: 398 GSFYGGGGG----RGGYGGGGSGRY 418 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXGR 683 G+ G G GG G G GGG G G G G GG GR Sbjct: 374 GYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGGSGRYHPYGR 423 Score = 32.7 bits (71), Expect = 0.35 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G+ G G GG GGG GG G GG G G GG G G Sbjct: 356 GYGGGMGGAGGGGYRGGGGYDMGG--VGGGGAGGYGAGGGGNGGGSFYG 402 Score = 32.3 bits (70), Expect = 0.46 Identities = 26/82 (31%), Positives = 27/82 (32%) Frame = -2 Query: 618 PXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXX 439 P G G GGG G G G GG G G GGG + G G Sbjct: 334 PGGGYGGPSGSYGGGY-GSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGG 392 Query: 438 XXXGGGXXPPKRGXXGXGRXGG 373 GGG G G G GG Sbjct: 393 GGNGGGSF--YGGGGGRGGYGG 412 Score = 31.5 bits (68), Expect = 0.81 Identities = 40/156 (25%), Positives = 42/156 (26%), Gaps = 4/156 (2%) Frame = -2 Query: 831 GGXXXXEXGXAXXGXGGGXXXGGGGXGGXXXXXXXXXXXXXXXXGKKXEGXGXXRXXXXX 652 GG G GG GGG G G G R Sbjct: 254 GGGYGGGRSGGYGGYGGEFGGYGGGGYGGGVGPYRGEPALGYSGRYGGGGGGYNRGGYSM 313 Query: 651 XXXXGRPPXPXPXXGRGRXKXGXG-GGXVGXWGGXXXGVXKGG-GGXXGXXGGG--EGXV 484 G P G + G G GG G +GG GG GG G GGG G Sbjct: 314 GGGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGG 373 Query: 483 ARXXGXGGAPXPXXXXXXGGGXXPPKRGXXGXGRXG 376 G G GGG G GR G Sbjct: 374 GYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGG 409 Score = 31.5 bits (68), Expect = 0.81 Identities = 26/81 (32%), Positives = 26/81 (32%), Gaps = 2/81 (2%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXK-GGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXX 433 G G G GGG G G G G G G GGG G GG Sbjct: 267 GYGGEFGGYGGGGYGGGVGPYRGEPALGYSGRYGGGGGGYNRGGYSMGGGGGYGGGPGDM 326 Query: 432 XGGGXXPPKRGXXG-XGRXGG 373 GG P G G G GG Sbjct: 327 YGGSYGEPGGGYGGPSGSYGG 347 Score = 30.7 bits (66), Expect = 1.4 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GG GGG GGG G GG G GGG G G Sbjct: 239 GHGGGYGGPGGPYKSGGGY--GGGRSGGYGGYGGEFGGYGGGGYGGGVG 285 Score = 30.7 bits (66), Expect = 1.4 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXG--XXGGGEGXVARXXGXGGAPXP 448 G G + G G G GG G GGGG G GGG G G G P Sbjct: 365 GGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGGSGRYHP 420 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -1 Query: 820 GXRGWGGRXXXG-GGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G RG GG G GG GG G G GG G GGG G G Sbjct: 368 GYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGR-GGYGG 412 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXG---XXGGVGVGXGGG 707 G G G G GGG GGG G GGVG G GG Sbjct: 343 GSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGG 387 Score = 27.9 bits (59), Expect = 10.0 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 5/55 (9%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXGGGXXXGGG-----GXXXXGXXGGVGVGXGGGXXG 698 G + G G G+GG GG GGG G G G G G GG G Sbjct: 255 GGYGGGRSGGYGGYGGEFGGYGGGGYGGGVGPYRGEPALGYSGRYGGGGGGYNRG 309 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 35.9 bits (79), Expect = 0.038 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -1 Query: 787 GGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 GGG GGGG G GG G G GGG G G Sbjct: 148 GGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGG 181 Score = 34.7 bits (76), Expect = 0.087 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -2 Query: 582 GGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPPKR 403 GGG G GG G G G G GGG G R G G G Sbjct: 87 GGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSE 146 Query: 402 GXXGXGRXGG 373 G G G GG Sbjct: 147 GGGGYGGGGG 156 Score = 34.7 bits (76), Expect = 0.087 Identities = 31/92 (33%), Positives = 33/92 (35%), Gaps = 13/92 (14%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGE-----------GXVAR--XXG 469 G + G GGG G G G GGGG G GGG G +AR G Sbjct: 89 GSSGGRGGFGGGR-GGGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEG 147 Query: 468 XGGAPXPXXXXXXGGGXXPPKRGXXGXGRXGG 373 GG GGG G G GR GG Sbjct: 148 GGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGG 179 Score = 34.7 bits (76), Expect = 0.087 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 805 GGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 GG GGG GGGG G G G G GGG G Sbjct: 147 GGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGG 182 Score = 34.7 bits (76), Expect = 0.087 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G GG GGG GGG G GG G G GGG Sbjct: 147 GGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGG 181 Score = 33.9 bits (74), Expect = 0.15 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -2 Query: 582 GGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGG 460 GGG G GG GGGG G GGG G R G GG Sbjct: 147 GGGGYGGGGGGY-----GGGGGYGGGGGGYGGGGRGGGGGG 182 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGG 460 G GGG G GG G GG G G GGG G G G Sbjct: 150 GYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGGGSCYSCGESG 192 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G G GG GGG GGGG G GG G GGG Sbjct: 149 GGYGGGGGGYGGGGGYGGGGGGYGGGGRGG---GGGGG 183 Score = 33.1 bits (72), Expect = 0.26 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGE-GXVARXXGXGG 460 G G G GGG G GG G GGGG GE G AR GG Sbjct: 152 GGGGGGYGGGGGYGGGGGGYGGGGRGGGGGGGSCYSCGESGHFARDCTSGG 202 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -1 Query: 805 GGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 GGR GGG GGG G GG G G GG G + G Sbjct: 92 GGRGGFGGGR---GGGRGSGGGYGGGGGGYGGRGGGGRGG 128 Score = 31.9 bits (69), Expect = 0.61 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G+GG GGG GGG G GG G G GG K G Sbjct: 89 GSSGGRGGFGG--GRGGGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCG 135 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGG 731 G+ G G+GG GGG GGG G GG Sbjct: 150 GYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGGG 183 Score = 28.7 bits (61), Expect = 5.7 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = -2 Query: 603 GRXKXGXGGGXVGXWG--GXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXX 430 GR G GG G G GGG G GGG G G GG Sbjct: 120 GRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGG 179 Query: 429 GGG 421 GGG Sbjct: 180 GGG 182 >At4g29030.1 68417.m04151 glycine-rich protein glycine-rich protein - Onobrychis viciifolia,PID:g2565429 Length = 115 Score = 35.9 bits (79), Expect = 0.038 Identities = 20/50 (40%), Positives = 21/50 (42%) Frame = -1 Query: 835 PGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 PG G G+GG GG GG G G GG G G G G G G Sbjct: 62 PGGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLGG-GSGIGAGTSGGSTG 110 Score = 31.9 bits (69), Expect = 0.61 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = -1 Query: 832 GWXXGXRGWG--GRXXXG-GGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G+ G G G G G GG G GG G GG G G GGG G Sbjct: 37 GYGGGYSGVGDNGLPFGGVGGGVSGPGGNLGYGGFGGAGGGLGGGLGG 84 Score = 31.5 bits (68), Expect = 0.81 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -1 Query: 805 GGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 GG GG GG G G GG+G G G G G G Sbjct: 57 GGVSGPGGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLGG 96 Score = 30.3 bits (65), Expect = 1.9 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKG-GGGXXGXXGGGEGXVARXXGXGG 460 G GGG G G G G GGG G GGG G G GG Sbjct: 54 GVGGGVSGPGGNLGYGGFGGAGGGLGGGLGGGAGS-GLGGGLGG 96 Score = 29.5 bits (63), Expect = 3.3 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXG-GGXXG 698 G G G GG GG GGG G G G+G G GG G Sbjct: 54 GVGGGVSGPGGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLGGGSG 99 >At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi|20465684|gb|AY096677.1| Length = 158 Score = 35.9 bits (79), Expect = 0.038 Identities = 27/79 (34%), Positives = 29/79 (36%), Gaps = 2/79 (2%) Frame = -2 Query: 603 GRXKXGXG-GGXVGXWGGXXXGVXKGG-GGXXGXXGGGEGXVARXXGXGGAPXPXXXXXX 430 G G G GG G GG + GG GG G GGG G + G GG Sbjct: 54 GAGGVGAGLGGVAGGVGGVAGVLPVGGVGGGIGGLGGGVGGLGGLGGLGGGSGLGHGVGG 113 Query: 429 GGGXXPPKRGXXGXGRXGG 373 GG G G G GG Sbjct: 114 IGGDPGIGSGIGGLGGAGG 132 Score = 31.5 bits (68), Expect = 0.81 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -2 Query: 618 PXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGA 457 P G G G GGG G G G G G G GG G + G GGA Sbjct: 77 PVGGVGGGIGGLGGGVGGLGGLGGLGGGSGLGHGVGGIGGDPGIGSGIGGLGGA 130 Score = 29.5 bits (63), Expect = 3.3 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGG 421 G GG G GG G GG G G G G + G GG GGG Sbjct: 93 GGLGGLGGLGGGSGLGHGVGGIGGDPGIGSGIGGLGGAGGLGGIGGVGGLGGIGGG 148 Score = 28.3 bits (60), Expect = 7.5 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGG--GXXXGGGGXXXXGXXGGVGVGXGGG 707 G G G GG G G G GG G GG+G G GGG Sbjct: 106 GLGHGVGGIGGDPGIGSGIGGLGGAGGLGGIGGVGGLG-GIGGG 148 >At4g08400.1 68417.m01388 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 513 Score = 35.9 bits (79), Expect = 0.038 Identities = 22/79 (27%), Positives = 27/79 (34%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P + PPP P + SPPP PPPP+ +P Sbjct: 217 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYYRSPPPPYYSP--S 274 Query: 554 PPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 275 PKVDYKSPPPPYVYSSPPP 293 Score = 33.5 bits (73), Expect = 0.20 Identities = 23/79 (29%), Positives = 27/79 (34%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P + PPP P P P PPP PPPP+ +P Sbjct: 243 PPPYYSPSPKVNYKSPPPPYYRSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPPYYSP--S 299 Query: 554 PPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 300 PKVDYKSPPPPYVYSSPPP 318 Score = 32.3 bits (70), Expect = 0.46 Identities = 22/82 (26%), Positives = 28/82 (34%), Gaps = 1/82 (1%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTP 544 + PP P + PPP P + SPPP PPPP+ +P Sbjct: 264 RSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 323 Query: 545 XXXPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 324 --TPKVDYKSPPPPYVYSSPPP 343 Score = 31.9 bits (69), Expect = 0.61 Identities = 23/88 (26%), Positives = 28/88 (31%), Gaps = 1/88 (1%) Frame = +2 Query: 350 KXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPS-PPPXXPXXPP 526 K PP P + PPP P + S PPP PP Sbjct: 59 KPSIYSSSPPPSYYSPSPKVDYKSPPPSYVYSSPPPPYYSPSPKVDYKSLPPPYVYSSPP 118 Query: 527 PPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 PP+ +P P PPP + P P Sbjct: 119 PPYYSP--SPKVNYKSPPPPYVYSSPPP 144 Score = 31.9 bits (69), Expect = 0.61 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 117 PPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSP-- 174 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 175 SPKVDYKSPPPPYVYSSPPP 194 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 167 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSP-- 224 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 225 SPKVDYKSPPPPYVYSSPPP 244 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 291 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSP-- 348 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 349 SPKVDYKSPPPPYVYSSPPP 368 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 316 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 373 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 374 SPKVDYKSPPPPYVYNSPPP 393 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 341 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSP-- 398 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 399 SPKVDYKSPPPPYIYNSPPP 418 Score = 31.1 bits (67), Expect = 1.1 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 366 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYIYNSPPPPYYSP-- 423 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 424 SPKVNYKTPPPPYVYSSPPP 443 Score = 29.9 bits (64), Expect = 2.5 Identities = 21/78 (26%), Positives = 26/78 (33%), Gaps = 1/78 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 416 PPPPYYSPSPKVNYKTPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSP-- 473 Query: 551 XPPQXPTXPPPXPXFXLP 604 P PPP + P Sbjct: 474 SPNVDYKSPPPPYVYSSP 491 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/47 (31%), Positives = 18/47 (38%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 + P P PPP +P+P PPPP PP P P Sbjct: 231 KSPPPPYVYSSPPPPYYSPSPKVN--YKSPPPPYYRSPPPPYYSPSP 275 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRP 803 + P P PPP +PTP PP PPP P Sbjct: 181 KSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSP 224 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRP 803 + P P PPP +PTP PP PPP P Sbjct: 305 KSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSP 348 >At3g05920.1 68416.m00668 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 126 Score = 35.9 bits (79), Expect = 0.038 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXP-PPPXXXPPPXXXRPP 806 P PPP P P PP P P PPP PP +PP Sbjct: 65 PVIISVGPPPKP-PEPPKPPEPEKPKPPPAPEPPKHVCKPP 104 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 35.9 bits (79), Expect = 0.038 Identities = 24/59 (40%), Positives = 24/59 (40%), Gaps = 1/59 (1%) Frame = -2 Query: 633 PPXPXPXXG-RGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGG 460 P P P G RG G GG G W G G GGGG G G G G G GG Sbjct: 66 PRGPGPWSGPRGPRPGGGGGPGPGPWSG-PRGPRPGGGGGPG-SGCGSGTGGGNQGQGG 122 Score = 34.7 bits (76), Expect = 0.087 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXX 430 GRG G G G W G G GGGG G G G G GG P Sbjct: 56 GRGPRGPGFGPRGPGPWSG-PRGPRPGGGGGPG-PGPWSGPRGPRPGGGGGPGSGCGSGT 113 Query: 429 GGG 421 GGG Sbjct: 114 GGG 116 Score = 32.3 bits (70), Expect = 0.46 Identities = 28/88 (31%), Positives = 29/88 (32%), Gaps = 3/88 (3%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXG---XXGGVGVGXGGGXXGQKXGRXXXXXXXXXXX 650 G RG+GGR G G GG G G GG G G GG G GR Sbjct: 13 GGRGFGGR-GGGPGFGPGGPGFGPGGPGFGPGGPGFGPGGPGFG---GRGPRGPGFGPRG 68 Query: 649 XXXGETPXPXXPXGXGXXKXGXXGGXSG 566 P P G G G G G Sbjct: 69 PGPWSGPRGPRPGGGGGPGPGPWSGPRG 96 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/60 (33%), Positives = 23/60 (38%), Gaps = 6/60 (10%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXGGGXXXGGGG------XXXXGXXGGVGVGXGGGXXGQKXG 686 G PG+ G G+GGR G G G G G GG G G G G + G Sbjct: 41 GPGGPGFGPGGPGFGGRGPRGPGFGPRGPGPWSGPRGPRPGGGGGPGPGPWSGPRGPRPG 100 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 35.9 bits (79), Expect = 0.038 Identities = 28/80 (35%), Positives = 31/80 (38%), Gaps = 1/80 (1%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXG-GAPXPXXXXX 433 G+ + G GGG G G GGGG G GGG+G G G G Sbjct: 34 GKKKNGGGEGGGGEGTSG------EGGGGGGDGTKGGGDGISGGGHGDGLGCSGGGGDGT 87 Query: 432 XGGGXXPPKRGXXGXGRXGG 373 GGG G G GR GG Sbjct: 88 KGGGRRGDGLG-RGLGRGGG 106 Score = 35.1 bits (77), Expect = 0.066 Identities = 20/50 (40%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVG-XGGGXXGQKXG 686 G G G G GGG GGG G G G+G GGG G K G Sbjct: 41 GEGGGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGGGDGTKGG 90 Score = 32.7 bits (71), Expect = 0.35 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXG-GGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G +G G GGG GG G G G G GGG G K G Sbjct: 15 GGGDGTKGGGNTITGGGGEGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGG 64 Score = 32.7 bits (71), Expect = 0.35 Identities = 25/79 (31%), Positives = 29/79 (36%), Gaps = 1/79 (1%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXX 430 G G G GGG G GG G+ GG G GG G + G G Sbjct: 46 GEGTSGEGGGGGGDGTKGG-GDGISGGGHGDGLGCSGGGGDGTKGGGRRGDGLGRGLGRG 104 Query: 429 GG-GXXPPKRGXXGXGRXG 376 GG G ++G G G G Sbjct: 105 GGRGGWNGRKGFSGEGVVG 123 Score = 31.9 bits (69), Expect = 0.61 Identities = 24/73 (32%), Positives = 24/73 (32%), Gaps = 4/73 (5%) Frame = -2 Query: 582 GGGXVGXWGGXXXGVXKGGGG----XXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXX 415 GGG G GG GG G G GGGEG G GG GG Sbjct: 14 GGGGDGTKGGGNTITGGGGEGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGGGDGISGGGH 73 Query: 414 PPKRGXXGXGRXG 376 G G G G Sbjct: 74 GDGLGCSGGGGDG 86 Score = 31.1 bits (67), Expect = 1.1 Identities = 25/78 (32%), Positives = 27/78 (34%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXX 430 G G G GG GG G +G G G GGG+G G G Sbjct: 22 GGGNTITGGGGEGKKKNGGGEGGGGEGTSGEGGG-GGGDGTKGGGDGISGGGHGDGLGCS 80 Query: 429 GGGXXPPKRGXXGXGRXG 376 GGG G G GR G Sbjct: 81 GGGGD----GTKGGGRRG 94 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXGR 683 G G G G GG G G GG G G G+G GGG + GR Sbjct: 39 GGGEGGGGEGTSGEGG-GGGGDGTKGGGDGISGGGHGDGLGCSGGGGDGTKGGGR 92 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/48 (39%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXG-GGXXGQK 692 G G G G GGG GGG G G+G G G GG G+K Sbjct: 67 GISGGGHGDGLGCSGGGGDGTKGGGRRGDGLGRGLGRGGGRGGWNGRK 114 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G+ GGG GG G G GG G G GG G G Sbjct: 31 GGEGKKKNGGGEGGGGEGTSGEGGGGG-GDGTKGGGDGISGG 71 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G GG GGG GGG GG G G G G+ G Sbjct: 14 GGGGDGTKGGGNTITGGGGEGKKKNGGGEGGGGEGTSGEGGG 55 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = -1 Query: 805 GGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 GG G G GGG G G G+G G G G + G Sbjct: 70 GGGHGDGLGCSGGGGDGTKGGGRRGDGLGRGLGRGGGRGG 109 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 35.9 bits (79), Expect = 0.038 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -1 Query: 814 RGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 +G G GGG GGGG G GG G G G G G Sbjct: 178 QGRQGSRYGGGGGSFGGGGGGGAGSYGGGGAGAGSGGGG 216 Score = 35.9 bits (79), Expect = 0.038 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGG 496 GR + G GGG G GG G GGG G GGG Sbjct: 179 GRQGSRYGGGGGSFGGGGGGGAGSYGGGGAGAGSGGGG 216 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G R GG GGG GGGG G GG G G GGG Sbjct: 182 GSRYGGGGGSFGGG---GGGGAGSYG-GGGAGAGSGGG 215 Score = 29.1 bits (62), Expect = 4.3 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGG 460 G G G GG G GGGG G GGG G A G GG Sbjct: 179 GRQGSRYGGGGGSFGG---GGGGGAGSYGGG-GAGAGSGGGGG 217 >At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear antigen EBNA-1 (GI:3342234) {Cercopithecine herpesvirus 15} Length = 118 Score = 35.5 bits (78), Expect = 0.050 Identities = 22/72 (30%), Positives = 22/72 (30%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPP 409 G G G G G GG G G GG G R G G G Sbjct: 7 GSGSSGSGSGGSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGD 66 Query: 408 KRGXXGXGRXGG 373 RG G GR G Sbjct: 67 GRGIGGGGRGRG 78 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQ 695 G G G GGR G G G G G G G GGG G+ Sbjct: 32 GSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGDGRGIGGGGRGR 77 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXG-XXGGVGVGXGGG-XXGQKXGR 683 G G G GG G G G G G GG G G GGG G+ GR Sbjct: 17 GSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGDGR 68 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXG 463 G G G GG G G +G GG GGG G R G G Sbjct: 22 GSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGD-GRGDGRG 69 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXGR 683 G GG G G G G G G G G G G+ GR Sbjct: 14 GSGGSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGR 56 >At5g04970.1 68418.m00526 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 624 Score = 35.5 bits (78), Expect = 0.050 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +2 Query: 491 PSPPPXXPXXPP---PPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 PS PP P P PP P P Q PT PP P P P Sbjct: 28 PSQPPSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTP 70 Score = 34.7 bits (76), Expect = 0.087 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P PP P PP P P P PP P PL P Sbjct: 44 PTQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSPSQPSPLPP 84 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/50 (30%), Positives = 17/50 (34%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P PP P+ PP P P P PP P P P + P Sbjct: 32 PSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSPSQPSP 81 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +2 Query: 491 PSPPPXXPXXPPP---PFXTPXXXPPQXPTXPPPXP 589 PS PP P PP P P P Q P+ P P P Sbjct: 48 PSQPPTQPPTQPPSHPPTQPPTPPPSQSPSQPSPLP 83 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/75 (28%), Positives = 24/75 (32%), Gaps = 2/75 (2%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPF--XTP 544 +PP +P P+ PP P P PS PP P PPP P Sbjct: 26 RPPSQPPSHPPIQPSSQPPTQPPSQPPTQPPTQP------PSHPPTQPPTPPPSQSPSQP 79 Query: 545 XXXPPQXPTXPPPXP 589 PP P P Sbjct: 80 SPLPPNIACKSTPYP 94 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +2 Query: 491 PSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P+ PP P PP P PP P PPP P P Sbjct: 44 PTQPPSQPPTQPPT--QPPSHPPTQPPTPPPSQSPSQPSP 81 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P PP P PP P P P PP +P P P HP P Sbjct: 24 PTRPPSQPPSHPPIQPSSQPPTQPPSQPP---TQP--PTQPPSHPPTQPP 68 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P P P P PP P P P PP PP P Sbjct: 32 PSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSP 76 Score = 29.5 bits (63), Expect = 3.3 Identities = 18/64 (28%), Positives = 18/64 (28%), Gaps = 2/64 (3%) Frame = +2 Query: 425 PPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP--PPFXTPXXXPPQXPTXPPPXPXFX 598 PP PP PP P PP PP P P Q PP Sbjct: 31 PPSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSPSQPSPLPPNIACKS 90 Query: 599 LPRP 610 P P Sbjct: 91 TPYP 94 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 2/50 (4%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPP--PPFXTPXXXPPQXPTXPPPXPXFXLP 604 PP P P PP PP P P PT PP P P Sbjct: 27 PPSQPPSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSP 76 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 35.5 bits (78), Expect = 0.050 Identities = 35/156 (22%), Positives = 41/156 (26%), Gaps = 3/156 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAP---PXPXXRATXPSPPPXXPXXPPPPFXTP 544 PP P + PPP P P P P PP PPPP+ +P Sbjct: 134 PPLTYYSPSPKVIYNSPPPPYIYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSP 193 Query: 545 XXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXX 724 P PPP + P P + P P + Sbjct: 194 --SPKVEYKSPPPPYVYSFPPPPP-------YYSPSPKVGYKSPPAPYVYSSPPPPPYYS 244 Query: 725 XXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPP 832 P PP PPP P P PP Sbjct: 245 PSPKVNYKSPPPPYVYSSPPPPPYSPSPKVEFKSPP 280 Score = 33.5 bits (73), Expect = 0.20 Identities = 35/165 (21%), Positives = 42/165 (25%), Gaps = 2/165 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P + PPP P P + SPPP PPP Sbjct: 238 PPPPYYSPSPKVNYKSPPPPYVYSSPPPPPYSPSPKVEFKSPPPPYIYNSPPPPSYYSPS 297 Query: 554 PPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXX 733 P PPP + P P P ++ Sbjct: 298 PKIDYKSPPPPYVYSSPPPPTYYSPSPRVDYKSPPPPYVYNSLPPPYVYNSPPPPPYYSP 357 Query: 734 XXXXXPPXPPPP--XXXPPPXPXXAXPXSXSXXPPGAPXPXKHNS 862 PPPP PPP P + P P P +NS Sbjct: 358 SPTVNYKSPPPPYVYNSPPPPPYYSPFPKVEYKSP--PPPYIYNS 400 Score = 32.7 bits (71), Expect = 0.35 Identities = 22/81 (27%), Positives = 26/81 (32%), Gaps = 8/81 (9%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXGA--PPXPXXRATXPSPPPXXPXXPPPPFXTP------X 547 P P + PPP P P P PP PPPP+ +P Sbjct: 331 PPPPYVYNSLPPPYVYNSPPPPPYYSPSPTVNYKSPPPPYVYNSPPPPPYYSPFPKVEYK 390 Query: 548 XXPPQXPTXPPPXPXFXLPRP 610 PP PP P + P P Sbjct: 391 SPPPPYIYNSPPPPPYYSPSP 411 Score = 32.3 bits (70), Expect = 0.46 Identities = 22/80 (27%), Positives = 26/80 (32%), Gaps = 3/80 (3%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAP---PXPXXRATXPSPPPXXPXXPPPPFXTP 544 PP P + PPP P P P P PP PPPP+ +P Sbjct: 350 PPPPYYSPSPTVNYKSPPPPYVYNSPPPPPYYSPFPKVEYKSPPPPYIYNSPPPPPYYSP 409 Query: 545 XXXPPQXPTXPPPXPXFXLP 604 P PPP + P Sbjct: 410 --SPKITYKSPPPPYIYKTP 427 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPX--XXPPPXXXRPPXP 812 P + PPP P +P PPPP PPP P P Sbjct: 152 PPYIYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSP 195 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPP--XXXPPPXXXRPPXP 812 P + PPP P +P PPPP PPP P P Sbjct: 178 PPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSFPPPPPYYSPSP 221 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPP--XXXPPPXXXRPPXP 812 P + PPP P +P PPPP PPP P P Sbjct: 342 PPYVYNSPPPPPYYSPSPTVNYKSPPPPYVYNSPPPPPYYSPFP 385 Score = 27.9 bits (59), Expect = 10.0 Identities = 14/47 (29%), Positives = 17/47 (36%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 + P P PPP +P+P PP PPP P P Sbjct: 252 KSPPPPYVYSSPPPPPYSPSPKVEFKSPPPPYIYNSPPPPSYYSPSP 298 >At4g12490.1 68417.m01974 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 182 Score = 35.5 bits (78), Expect = 0.050 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P PSP P P P TP P PT P P P P Sbjct: 36 PRPLPNPKVPSPKVPTPSVPSPYVPTPSVPSPSVPTPSVPSPSVPSPNP 84 Score = 28.3 bits (60), Expect = 7.5 Identities = 19/68 (27%), Positives = 21/68 (30%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXL 601 P P P + PSP P P P TP P P+ P P P Sbjct: 32 PSPKPRPLPNPKVPSPKVPTPSVPSPYVPTPSVPSPSVPTPSVPSPSVPS-PNPTPVIP- 89 Query: 602 PRPXXGXG 625 PR G Sbjct: 90 PRTPGSSG 97 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 35.5 bits (78), Expect = 0.050 Identities = 27/80 (33%), Positives = 28/80 (35%), Gaps = 1/80 (1%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGG-APXPXXXXX 433 G G G GGG G +GG GGG G GG G GG P Sbjct: 134 GYGAPAGGYGGG-AGGYGGNSSYSGNAGGG--GGYGGNSSYGGNAGGYGGNPPYSGNAVG 190 Query: 432 XGGGXXPPKRGXXGXGRXGG 373 GGG G G G GG Sbjct: 191 GGGGYGSNFGGGGGYGVAGG 210 Score = 31.1 bits (67), Expect = 1.1 Identities = 27/81 (33%), Positives = 28/81 (34%), Gaps = 3/81 (3%) Frame = -2 Query: 603 GRXKXGXGGGXVGXWGGXXXGVXKGG-GGXXGXXGGGEGXVARXXGXG--GAPXPXXXXX 433 GR G GGG GG G GG GG G GG G G G Sbjct: 118 GRGFGGPGGGYGASDGG--YGAPAGGYGGGAGGYGGNSSYSGNAGGGGGYGGNSSYGGNA 175 Query: 432 XGGGXXPPKRGXXGXGRXGGF 370 G G PP G G GG+ Sbjct: 176 GGYGGNPPYSG-NAVGGGGGY 195 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = -2 Query: 579 GGXVGXWGGXXX--GVXKGGGGXXGXXGGGEGXVARXXGXGGA 457 GG G +GG G GGGG G GG G G GG+ Sbjct: 172 GGNAGGYGGNPPYSGNAVGGGGGYGSNFGGGGGYGVAGGVGGS 214 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQK 692 G+GG G GGGG GG G G GG G + Sbjct: 177 GYGGNPPYSGNAVGGGGGYGS-NFGGGGGYGVAGGVGGSE 215 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGG 710 G+ G G+GG G GGGG GG G GG Sbjct: 141 GYGGGAGGYGGNSSYSGN-AGGGGGYGGNSSYGGNAGGYGG 180 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 35.5 bits (78), Expect = 0.050 Identities = 26/91 (28%), Positives = 30/91 (32%), Gaps = 4/91 (4%) Frame = +2 Query: 374 PPXRPXPXX--PLLGGXXPPPXXXXXXGXGAP--PXPXXRATXPSPPPXXPXXPPPPFXT 541 P RP P P++ PP G P P +PP P PP Sbjct: 115 PIVRPPPITRPPIIIPPIQPPPVTTPPGLLPPITTPPGLLPPVTTPPGLLPPVTTPPGLL 174 Query: 542 PXXXPPQXPTXPPPXPXFXLPRPXXGXGXGG 634 P P T PPP + P G G GG Sbjct: 175 PPIINPPPVTVPPPSSGYPPYGPPSGGGGGG 205 Score = 31.9 bits (69), Expect = 0.61 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 6/51 (11%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPP---PPXXXPP---PXXXRPPXPLXPXXHP 833 P PPP TP P P PP PP PP P PP L P +P Sbjct: 131 PIQPPPVTTP-PGLLPPITTPPGLLPPVTTPPGLLPPVTTPPGLLPPIINP 180 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +3 Query: 708 PPPXPTPTPP-XXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 PPP PP P PPP PPP RPP + P P Sbjct: 94 PPPVVVRPPPIIRPPPVVYPPPIVRPPP-ITRPPIIIPPIQPP 135 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 473 GGXGGXPXPRXXXXXGGGXPPPKGXXXG 390 GG GG P GGG PPP G G Sbjct: 46 GGGGGSKPPPHHGGKGGGKPPPHGGKGG 73 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPP---PPXXXPPPXXXRPPXPLXPXXHP 833 P PP TP P P PP PP PPP PP P P Sbjct: 151 PGLLPPVTTP-PGLLPPVTTPPGLLPPIINPPPVTVPPPSSGYPPYGP 197 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 472 GGWGGXPPXGXXXXGGGXXPPQKGXXXXGPP 380 GG G PP GGG PP G GPP Sbjct: 47 GGGGSKPPPHHGGKGGGKPPPH-GGKGGGPP 76 Score = 29.5 bits (63), Expect = 3.3 Identities = 24/86 (27%), Positives = 25/86 (29%), Gaps = 1/86 (1%) Frame = +3 Query: 603 PXPXGXXGXGVSXXXXXXXXXXGRXPXL-PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXX 779 P P G G G P + P PPP P P P PPP Sbjct: 65 PPPHGGKGGGPPHHGGGGGGGGKSPPVVRPPPVVVRPPPIIRPPPVVYPPPIVRPPPITR 124 Query: 780 PPPXXXRPPXPLXPXXHPGRHXPXNT 857 PP P P PG P T Sbjct: 125 -PPIIIPPIQPPPVTTPPGLLPPITT 149 Score = 28.7 bits (61), Expect = 5.7 Identities = 24/80 (30%), Positives = 24/80 (30%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTP 544 K P RP P PP PP P R PP P PPP TP Sbjct: 87 KSPPVVRPPPVVVRPPPIIRPPPVVYPPPIVRPP-PITR-----PPIIIPPIQPPPVTTP 140 Query: 545 XXXPPQXPTXPPPXPXFXLP 604 P T P P P Sbjct: 141 PGLLPPITTPPGLLPPVTTP 160 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 35.5 bits (78), Expect = 0.050 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP PPP PPP P P S PP + P Sbjct: 148 PPESPPPESLPPPSPESPSPPSPEPPPPSSLEP 180 Score = 34.7 bits (76), Expect = 0.087 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 455 GAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXP 589 G PP P PPP P P PP +P PP PPP P Sbjct: 144 GQPPPPESPPPESLPPPS-PESPSPP--SPEPPPPSSLEPPPPPP 185 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P P PP P PP P PPP PP P Sbjct: 147 PPPESPPPESLPPPSPESPSPPSPEP-PPPSSLEPPPP 183 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP 788 P P P P P+P P P PPP PPP Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPP 182 Score = 31.9 bits (69), Expect = 0.61 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 PP P P P P PP PPP P P P Sbjct: 148 PPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/42 (30%), Positives = 14/42 (33%) Frame = +2 Query: 407 LGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPP 532 + G PPP P P PPP PPPP Sbjct: 142 IAGQPPPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPP 183 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 PPP +P P P P P PP PP L P P Sbjct: 146 PPPPESPPPESLPP---PSPESPSPPSPEPPPPSSLEPPPPP 184 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 497 PPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 PPP P PP P P P+ PP P P P Sbjct: 147 PPPESP--PPESLPPPSPESPSPPSPEPPPPSSLEPPP 182 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 684 LPXFCPXXPPPXPTPTPPXXPXXXXPPPP 770 LP P P P P+P PP PPPP Sbjct: 157 LPPPSPESPSP-PSPEPPPPSSLEPPPPP 184 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 35.1 bits (77), Expect = 0.066 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 636 RPPXPXPXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGG 520 RP P G G G GGG G GG G GGGG Sbjct: 114 RPSAPRAYGGGGGYSYGGGGGGYGGGGGGYGGGGDGGGG 152 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = -1 Query: 814 RGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 R +GG GGG GGGG G GG G G GG Sbjct: 119 RAYGG----GGGYSYGGGGGGYGGGGGGYGGGGDGG 150 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 838 RPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGG 710 RP G GG GGG GGGG G GG G G GG Sbjct: 114 RPSAPRAYGGGGGYSYGGGGGGYGGGG----GGYGGGGDGGGG 152 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -2 Query: 618 PXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEG 490 P R GGG +GG G GGGG G GG G Sbjct: 110 PANDRPSAPRAYGGGGGYSYGGGGGGYGGGGGGYGGGGDGGGG 152 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 35.1 bits (77), Expect = 0.066 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXH 830 PPP P P P PPPP PPP P P P H Sbjct: 9 PPPPPPPPPRLLVLPPLPPPP---PPPPPQLPFGPKLPFPH 46 Score = 31.5 bits (68), Expect = 0.81 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 494 SPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXP 589 +P P PPPP PP P PPP P Sbjct: 3 TPSKRRPPPPPPPPPRLLVLPPLPPPPPPPPP 34 Score = 29.5 bits (63), Expect = 3.3 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +2 Query: 458 APPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPP-PXPXFXLPR 607 A P P PPP PP P P PPQ P P P P + R Sbjct: 2 ATPSKRRPPPPPPPPPRLLVLPPLP-PPPPPPPPQLPFGPKLPFPHIIIRR 51 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 744 PXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P PPPP PP PP P P P Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPPPPPP 33 >At2g24980.1 68415.m02987 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 559 Score = 35.1 bits (77), Expect = 0.066 Identities = 23/83 (27%), Positives = 29/83 (34%), Gaps = 1/83 (1%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXT 541 K PP + P + PPP P + SPPP PPPP+ + Sbjct: 54 KSSPPPQYYTPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS 113 Query: 542 PXXXPPQXPTXPPPXPXFXLPRP 610 P P PPP + P P Sbjct: 114 P--SPKVDYKSPPPPYVYSSPPP 134 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 82 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 139 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 140 SPKVDYKSPPPPYVYNSPPP 159 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 107 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSP-- 164 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 165 SPKVDYKSPPPPYVYSSPPP 184 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 132 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 189 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 190 SPKVYYKSPPPPYVYSSPPP 209 Score = 31.1 bits (67), Expect = 1.1 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 157 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP-- 214 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 215 SPKVYYKSPPPPYVYSSPPP 234 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 214 PSPKVYYKSP-PPPYVYSSPPPPYYSP--SPKVYYKSPPPPYVYSSPPP 259 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 239 PSPKVYYKSP-PPPYVYSSPPPPYYSP--SPKVYYKSPPPPYVYSSPPP 284 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 264 PSPKVYYKSP-PPPYVYSSPPPPYYSP--SPKVYYKSPPPPYVYSSPPP 309 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 289 PSPKVYYKSP-PPPYVYSSPPPPYYSP--SPKVYYKSPPPPYVYSSPPP 334 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 314 PSPKVYYKSP-PPPYVYSSPPPPYYSP--SPKVYYKSPPPPYVYSSPPP 359 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 339 PSPKVYYKSP-PPPYVYSSPPPPYYSP--SPKVYYKSPPPPYVYSSPPP 384 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 364 PSPKVYYKSP-PPPYVYSSPPPPYYSP--SPKVYYKSPPPPYVYNSPPP 409 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 389 PSPKVYYKSP-PPPYVYNSPPPPYYSP--SPKVYYKSPPPPYVYSSPPP 434 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 414 PSPKVYYKSP-PPPYVYSSPPPPYYSP--SPKVYYKSPPPPYVYSSPPP 459 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 439 PSPKVYYKSP-PPPYVYSSPPPPYYSP--SPKVYYKSPPPSYVYSSPPP 484 Score = 30.3 bits (65), Expect = 1.9 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXX-PPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 457 PPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSP-- 514 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 515 SPKVYYKSPPPPYVYSSPPP 534 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/47 (34%), Positives = 19/47 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLP 604 P P P PPP PPPP+ +P P PPP + P Sbjct: 514 PSPKVYYKSP-PPPYVYSSPPPPYYSP--SPKVTYKSPPPPYVYKTP 557 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +2 Query: 491 PSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP + TP P PPP + P P Sbjct: 47 PHPKPYVKSSPPPQYYTP--SPKVNYKSPPPPYVYSSPPP 84 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 35.1 bits (77), Expect = 0.066 Identities = 25/58 (43%), Positives = 26/58 (44%), Gaps = 4/58 (6%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGG-VGVG---XGGGXXGQKXG 686 G R G G G GGR GGG GGGG G GG G G GGG G + G Sbjct: 93 GGHRGGGSYG--GGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGG 148 Score = 34.7 bits (76), Expect = 0.087 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G R G G GG GGG GGG G GG G G GGG G G Sbjct: 105 GGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGG--GGYGGGEGGGYGGSGGG 156 Score = 34.3 bits (75), Expect = 0.11 Identities = 26/78 (33%), Positives = 30/78 (38%) Frame = -2 Query: 606 RGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXG 427 + R G GG G G G +GGGG GGG G +R G GG G Sbjct: 85 QSRGSGGGGGHRGGGSYGGGGGRREGGGGYS---GGGGGYSSR--GGGGGSYGGGRREGG 139 Query: 426 GGXXPPKRGXXGXGRXGG 373 GG + G G GG Sbjct: 140 GGYGGGEGGGYGGSGGGG 157 Score = 32.7 bits (71), Expect = 0.35 Identities = 25/73 (34%), Positives = 29/73 (39%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPP 409 G GGG G G + GGG G GGG G +R G GG+ GG Sbjct: 90 GGGGGHRGGGSYGGGGGRREGGG--GYSGGGGGYSSRGGG-GGSYGGGRREGGGGYGGGE 146 Query: 408 KRGXXGXGRXGGF 370 G G G GG+ Sbjct: 147 GGGYGGSGGGGGW 159 Score = 31.5 bits (68), Expect = 0.81 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGV-GXGGGXXG 698 G G RG GG GGG GGGG G GG G GGG G Sbjct: 90 GGGGGHRG-GGSYGGGGGRREGGGGYS--GGGGGYSSRGGGGGSYG 132 Score = 31.5 bits (68), Expect = 0.81 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G RG GG GGG GGGG G GG G GGG Sbjct: 118 GGGYSSRGGGG-GSYGGGRREGGGGYGG-GEGGGYGGSGGGG 157 Score = 30.7 bits (66), Expect = 1.4 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVX--KGGGGXXGXXGGGEGXV--ARXXGXGG 460 G G GGG G GG G GGGG GGG G R G GG Sbjct: 88 GSGGGGGHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGG 141 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEG 490 G G G GGG G GG G GGG G GG G Sbjct: 118 GGGYSSRGGGGGSYG--GGRREGGGGYGGGEGGGYGGSGG 155 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 35.1 bits (77), Expect = 0.066 Identities = 16/49 (32%), Positives = 19/49 (38%) Frame = +2 Query: 479 RATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXG 625 +A P PPP P PP + P PPP P + P P G Sbjct: 31 QARPPVPPPTQPGGPPAWYSNQFHHPHSPSPPPPPPPQWGPPSPHYPQG 79 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +2 Query: 491 PSPPPXXP--XXPPPPFXTPXXXPPQXPTXPPPXPXF 595 PSPPP P PP P P P P PP P F Sbjct: 59 PSPPPPPPPQWGPPSPHY-PQGQPYSSPAYPPHQPPF 94 Score = 29.1 bits (62), Expect = 4.3 Identities = 18/63 (28%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPT--PPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHX 845 R P P P PP + P P PPPP PP P +P Sbjct: 33 RPPVPPPTQPGGPPAWYSNQFHHPHSPSPPPPPPPQWGPPSPHYPQGQPYSSPAYPPHQP 92 Query: 846 PXN 854 P N Sbjct: 93 PFN 95 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAP 841 PP PPP P P P S PP P Sbjct: 62 PPPPPPQWGPPSPHYPQGQPYSSPAYPPHQP 92 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 35.1 bits (77), Expect = 0.066 Identities = 16/49 (32%), Positives = 19/49 (38%) Frame = +2 Query: 479 RATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXG 625 +A P PPP P PP + P PPP P + P P G Sbjct: 31 QARPPVPPPTQPGGPPAWYSNQFHHPHSPSPPPPPPPQWGPPSPHYPQG 79 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +2 Query: 491 PSPPPXXP--XXPPPPFXTPXXXPPQXPTXPPPXPXF 595 PSPPP P PP P P P P PP P F Sbjct: 59 PSPPPPPPPQWGPPSPHY-PQGQPYSSPAYPPHQPPF 94 Score = 29.1 bits (62), Expect = 4.3 Identities = 18/63 (28%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPT--PPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHX 845 R P P P PP + P P PPPP PP P +P Sbjct: 33 RPPVPPPTQPGGPPAWYSNQFHHPHSPSPPPPPPPQWGPPSPHYPQGQPYSSPAYPPHQP 92 Query: 846 PXN 854 P N Sbjct: 93 PFN 95 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAP 841 PP PPP P P P S PP P Sbjct: 62 PPPPPPQWGPPSPHYPQGQPYSSPAYPPHQP 92 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 35.1 bits (77), Expect = 0.066 Identities = 21/72 (29%), Positives = 22/72 (30%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P + P P P RA P PPP P P Sbjct: 194 PPPPPPPGNAAIPVEPPLTMSAEKESYAPLPPPPGRAALPPPPPL-PMAVRKGVAAPPLP 252 Query: 554 PPQXPTXPPPXP 589 PP PPP P Sbjct: 253 PPGTAALPPPPP 264 Score = 31.5 bits (68), Expect = 0.81 Identities = 19/66 (28%), Positives = 20/66 (30%), Gaps = 2/66 (3%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXX--GXGAPPXPXXRATXPSPPPXXPXXPPPPFXT 541 +K P P P PPP G APP P PPP P Sbjct: 216 EKESYAPLPPPPGRAALPPPPPLPMAVRKGVAAPPLPPPGTAALPPPPPLPMAAGKGVAA 275 Query: 542 PXXXPP 559 P PP Sbjct: 276 PPPPPP 281 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 482 ATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 A P PP PPPP P PPP P P Sbjct: 221 APLPPPPGRAALPPPPPLPMAVRKGVAAPPLPPPGTAALPPPP 263 >At1g07135.1 68414.m00759 glycine-rich protein Length = 155 Score = 35.1 bits (77), Expect = 0.066 Identities = 22/59 (37%), Positives = 25/59 (42%), Gaps = 3/59 (5%) Frame = -2 Query: 540 VXKGGGGXXGXXGGG---EGXVARXXGXGGAPXPXXXXXXGGGXXPPKRGXXGXGRXGG 373 + KGGGG G GGG G +R G G + GGG P G G G GG Sbjct: 62 IKKGGGGGGGGRGGGGARSGGRSRGGGGGSSSSRSRDWKRGGGVVPIHTG-GGNGSLGG 119 Score = 30.7 bits (66), Expect = 1.4 Identities = 24/74 (32%), Positives = 26/74 (35%) Frame = -2 Query: 594 KXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXX 415 K G GGG GG G + GG G GG +R GG P GGG Sbjct: 63 KKGGGGGG----GGRGGGGARSGGRSRGGGGGSSSSRSRDWKRGGGVVP---IHTGGGNG 115 Query: 414 PPKRGXXGXGRXGG 373 G G R G Sbjct: 116 SLGGGSAGSHRSSG 129 >At4g15460.1 68417.m02363 glycine-rich protein Length = 148 Score = 34.7 bits (76), Expect = 0.087 Identities = 18/42 (42%), Positives = 20/42 (47%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G GG GGG GGGG GG G GGG G++ G Sbjct: 67 GGGGHASVGGGHASGGGG---HAVEGGGHAGGGGGGHGEEEG 105 Score = 34.7 bits (76), Expect = 0.087 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G GG GGG GGGG GG G+G GGG Sbjct: 81 GGGGHAVEGGGHAGGGGGGHGE-EEGGHGIGRGGG 114 Score = 32.7 bits (71), Expect = 0.35 Identities = 26/77 (33%), Positives = 27/77 (35%), Gaps = 8/77 (10%) Frame = -2 Query: 579 GGXVGXWGGXXXGVXKGG-----GGXXGXXGGGEGXVARXXGXGG---APXPXXXXXXGG 424 GG G GG V GG GG GGG V GG A GG Sbjct: 38 GGGGGAHGGGGVHVSVGGAHASVGGGHASGGGGHASVGGGHASGGGGHAVEGGGHAGGGG 97 Query: 423 GXXPPKRGXXGXGRXGG 373 G + G G GR GG Sbjct: 98 GGHGEEEGGHGIGRGGG 114 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 34.7 bits (76), Expect = 0.087 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G GG GGG GGGG G G G G GGG Sbjct: 122 GGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGG 156 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEG 490 G GGG G GG G GGG G GGG+G Sbjct: 122 GGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDG 154 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 838 RPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 RP G GG GGG GGGG G GG G G GG Sbjct: 114 RPSAPRAYGGGGGYSGGGGGYGGGGGG--YGGGGGGYGGGGDGG 155 Score = 32.7 bits (71), Expect = 0.35 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = -2 Query: 636 RPPXPXPXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEG 490 RP P G G G GG +GG G GGGG G GG G Sbjct: 114 RPSAPRAYGGGGGYSGGGGG-----YGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 32.7 bits (71), Expect = 0.35 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVG 725 G G G GG GGG GGGG G GG G Sbjct: 122 GGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -1 Query: 799 RXXXGGGXXXGGGG--XXXXGXXGGVGVGXGGGXXG 698 R GGG GGGG G GG G G GGG G Sbjct: 119 RAYGGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDG 154 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 787 GGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 GGG GGG G GG G G GGG G G Sbjct: 122 GGGGGYSGGGGGYGGGGGGYG-GGGGGYGGGGDG 154 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 34.7 bits (76), Expect = 0.087 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 693 FCPXXPPPXPTPTPP-XXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 F P PPP P P PP PPPP PPP PP + P Sbjct: 40 FLPHPPPPPPPPPPPLYFSYFSLPPPP---PPPHL--PPTSVTP 78 Score = 31.9 bits (69), Expect = 0.61 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +2 Query: 491 PSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXP 589 P PPP P PPP + + PP P PP P Sbjct: 42 PHPPPPPPPPPPPLYFSYFSLPP--PPPPPHLP 72 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 34.7 bits (76), Expect = 0.087 Identities = 23/78 (29%), Positives = 27/78 (34%), Gaps = 2/78 (2%) Frame = +2 Query: 377 PXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXP 556 P P P PPP +P + PSPP P PP +P P Sbjct: 55 PSSPPPLSLSPSSPPPPPPSSSPLSSLSP------SLSPSPPSSSPSSAPPSSLSPSSPP 108 Query: 557 P--QXPTXPPPXPXFXLP 604 P P+ PPP P P Sbjct: 109 PLSLSPSSPPPPPPSSSP 126 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +2 Query: 491 PSPPPXXPXXPPPPFXTPXXXPP--QXPTXPPPXPXFXLP 604 PSPP P PP +P PP P+ PPP P P Sbjct: 38 PSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSP 77 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/41 (29%), Positives = 16/41 (39%) Frame = +2 Query: 458 APPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPP 580 +P P + P P PPP +P PP P+ P Sbjct: 37 SPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSP 77 >At1g49270.1 68414.m05524 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 699 Score = 34.7 bits (76), Expect = 0.087 Identities = 21/68 (30%), Positives = 22/68 (32%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTP 544 + PP P P P PP PP T P PPP P PPP Sbjct: 8 ENSPPAPPPPSPP------SPPSSNDQQTTSPPPSDNQETTSP-PPPSSPDIAPPPQQQQ 60 Query: 545 XXXPPQXP 568 PP P Sbjct: 61 ESPPPPLP 68 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/58 (29%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = +2 Query: 425 PPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPP---QXPTXPPPXP 589 PP P + T P P PPP +P PP Q + PPP P Sbjct: 11 PPAPPPPSPPSPPSSNDQQTTSPPPSDNQETTSPPPPSSPDIAPPPQQQQESPPPPLP 68 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 34.7 bits (76), Expect = 0.087 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P PPP P P+ P PPPP PP +P P Sbjct: 215 PVLLPLQPPPPPPPSQPLPRPLLLPPPP---PPSFHAQPILP 253 >At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi domain-containing protein contains Pfam profiles PF02170: PAZ domain, PF02171: Piwi domain Length = 1194 Score = 34.7 bits (76), Expect = 0.087 Identities = 26/81 (32%), Positives = 30/81 (37%), Gaps = 2/81 (2%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGX-WGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXX 433 GRG + GGG G + G G +GG G G G G+G G G Sbjct: 9 GRGDGRGRGGGGDRGRGYSGRGDGRGRGGDGDRGYSGRGDGHGRGGGGDRGRGYSGRGDG 68 Query: 432 XG-GGXXPPKRGXXGXGRXGG 373 G GG RG G G G Sbjct: 69 RGRGGGGDRGRGYSGRGDGHG 89 Score = 32.3 bits (70), Expect = 0.46 Identities = 21/48 (43%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXG-GVGVGXGGG 707 G R G RG+ GR G G GGGG G G G G G GGG Sbjct: 49 GHGRGGGGDRGRGYSGR---GDGRGRGGGGDRGRGYSGRGDGHGRGGG 93 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/51 (37%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGX-WGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGG 460 GRG GGG G + G G +GGGG G G G G GG Sbjct: 45 GRGDGHGRGGGGDRGRGYSGRGDGRGRGGGGDRGRGYSGRGD-GHGRGGGG 94 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/41 (39%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGX-WGGXXXGVXKGGGGXXGXXGGGEG 490 GRG + GGG G + G G +GGGG G G G Sbjct: 64 GRGDGRGRGGGGDRGRGYSGRGDGHGRGGGGDRGRGYSGRG 104 Score = 28.7 bits (61), Expect = 5.7 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = -2 Query: 567 GXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXG-GGXXPPKRGXXG 391 G GG G +GGGG G G G G G G GG RG G Sbjct: 5 GYRGGRGDGRGRGGGGDRGRGYSGRGDGRGRGGDGDRGYSGRGDGHGRGGGGDRGRGYSG 64 Query: 390 XGRXGG 373 G G Sbjct: 65 RGDGRG 70 >At5g25550.1 68418.m03040 leucine-rich repeat family protein / extensin family protein similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana]; contains Pfam PF00560: Leucine Rich Repeat domains Length = 433 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P P P P PT P P P PP PPP PP L P Sbjct: 389 PSSQPLAPAPSPTSPPLSTPPPARPCPPVYSPPPP---PPLSLAP 430 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +2 Query: 470 PXXRATXPSPPPXXPXXPP--PPFXTPXXXPPQXPTXPPPXP 589 P PS P P P PP TP P P PP P Sbjct: 382 PPPSQISPSSQPLAPAPSPTSPPLSTPPPARPCPPVYSPPPP 423 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/48 (29%), Positives = 17/48 (35%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLP 604 PP ++ P P P PP P P + PPP P P Sbjct: 383 PPSQISPSSQPLAPAPSPTSPPLSTPPPARPCPPVYSPPPPPPLSLAP 430 >At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 244 Score = 34.3 bits (75), Expect = 0.11 Identities = 27/86 (31%), Positives = 28/86 (32%), Gaps = 2/86 (2%) Frame = -2 Query: 624 PXPXXGRGRXKXGXGGGXVGXWGGXXXGVXKGG--GGXXGXXGGGEGXVARXXGXGGAPX 451 P G G G GG G G G GG GG G GG A G GGA Sbjct: 134 PGGASGGGDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASG 193 Query: 450 PXXXXXXGGGXXPPKRGXXGXGRXGG 373 GG G G + GG Sbjct: 194 GGPGGASGGASGDKPEGAPG-DKPGG 218 Score = 33.1 bits (72), Expect = 0.26 Identities = 26/87 (29%), Positives = 26/87 (29%), Gaps = 3/87 (3%) Frame = -2 Query: 624 PXPXXGRGRXKXGXGGGXVGXWGGXXXGVXKGG---GGXXGXXGGGEGXVARXXGXGGAP 454 P G K G G G G G GG GG G GG A GGA Sbjct: 109 PGASGGASGDKPGEMSGAGGPSGDKPGGASGGGDKPGGASGGGPGGASGGASGGASGGAS 168 Query: 453 XPXXXXXXGGGXXPPKRGXXGXGRXGG 373 GGG G G GG Sbjct: 169 GGASGGASGGGPGGASGGGPGGASGGG 195 Score = 32.7 bits (71), Expect = 0.35 Identities = 28/86 (32%), Positives = 28/86 (32%), Gaps = 2/86 (2%) Frame = -2 Query: 624 PXPXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGG--GXXGXXGGGEGXVARXXGXGGAPX 451 P G G GG G GG G GGG G G GG A GGA Sbjct: 120 PGEMSGAGGPSGDKPGGASG--GGDKPGGASGGGPGGASGGASGGASGGASGGASGGASG 177 Query: 450 PXXXXXXGGGXXPPKRGXXGXGRXGG 373 GGG G G G GG Sbjct: 178 GGPGGASGGGPGGASGGGPG-GASGG 202 Score = 29.1 bits (62), Expect = 4.3 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXGGGXXXGG--GGXXXXGXXGGVGVGXGGGXXGQKXG 686 G +PG G G GG G GG GG GG G GGG G G Sbjct: 140 GGDKPGGASGG-GPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGG 194 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = -1 Query: 835 PGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGG-VGVGXGGGXXGQKXG 686 PG G G GG G G G GG G GGG G G Sbjct: 152 PGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASGG 202 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GG GG G G GG G GG G G Sbjct: 157 GGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASGGASG 205 Score = 28.3 bits (60), Expect = 7.5 Identities = 26/87 (29%), Positives = 27/87 (31%), Gaps = 5/87 (5%) Frame = -2 Query: 618 PXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXG--GGEGXVARXXGXGGAPXPX 445 P G G GG G G G GG G G GG A G P Sbjct: 152 PGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASGGASGDKPEGA 211 Query: 444 XXXXXGG--GXXPPKR-GXXGXGRXGG 373 GG G P K+ G G GG Sbjct: 212 PGDKPGGAWGGKPGKKPGHKPEGARGG 238 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G GG GG G G GG G GG G G Sbjct: 136 GASGGGDKPGGASGGGPGGASGGASGGASGGASGGASGGASG 177 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 12/49 (24%) Frame = +2 Query: 494 SPPPXXPXXPPPPFXTP------------XXXPPQXPTXPPPXPXFXLP 604 SPPP P PPPP TP PP P PPP P P Sbjct: 119 SPPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTITPP 167 Score = 32.7 bits (71), Expect = 0.35 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 8/58 (13%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXX-------PPPPX-XXPPPXXXRPPXPLXPXXHPGRHXP 848 P PPP PT TPP PPPP PPP PP H P Sbjct: 124 PPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTITPPVTTTTTGHHHHRPP 181 Score = 32.3 bits (70), Expect = 0.46 Identities = 20/70 (28%), Positives = 22/70 (31%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P P + +PP P P PPP P PP T Sbjct: 122 PPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPP------PPPPPPPPTITPPVTTTTTGH 175 Query: 554 PPQXPTXPPP 583 P PPP Sbjct: 176 HHHRPPPPPP 185 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 4/48 (8%) Frame = +3 Query: 699 PXXPPPXP----TPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXH 830 P PPP P T T PPPP PPP PP H Sbjct: 97 PPPPPPPPLSAITTTGHHHHRRSPPPPPPPPPPPPTITPPVTTTTAGH 144 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP PPPP PP A PP P P Sbjct: 125 PPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPP 157 Score = 28.7 bits (61), Expect = 5.7 Identities = 21/80 (26%), Positives = 24/80 (30%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTP 544 ++ PP P P P PP A R+ P PPP P P T Sbjct: 117 RRSPPPPPPPPPP------PPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTITPPVTT 170 Query: 545 XXXPPQXPTXPPPXPXFXLP 604 PPP P P Sbjct: 171 TTTGHHHHRPPPPPPATTTP 190 >At2g04190.1 68415.m00404 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 411 Score = 34.3 bits (75), Expect = 0.11 Identities = 29/87 (33%), Positives = 32/87 (36%), Gaps = 5/87 (5%) Frame = -2 Query: 618 PXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXG-----GAP 454 P G G G GGG +GG G +G GG G G G +R G G Sbjct: 14 PGKGVGSCVFGGGGGGP-AFGGRGGGPGRGYGGGPRVHGPGYGIGSRGPDPGPGFFFGGA 72 Query: 453 XPXXXXXXGGGXXPPKRGXXGXGRXGG 373 P GGG P G G GR G Sbjct: 73 GPGPGYGGGGGHG-PGYGGGGDGRGYG 98 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = -1 Query: 811 GWGGRXXXGGGXXX---GGGGXXXXGXXGGVGVGXGGG 707 GWG G G GGGG G GG G G GGG Sbjct: 9 GWGDFPGKGVGSCVFGGGGGGPAFGGRGGGPGRGYGGG 46 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/51 (39%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -1 Query: 835 PGWXXGXRGWGGRXXXGGGXXXGGGGXXXX-GXXGGVGVGXGGGXXGQKXG 686 PG+ G RG G G GG G G GG G G GGG G+ G Sbjct: 52 PGYGIGSRG----PDPGPGFFFGGAGPGPGYGGGGGHGPGYGGGGDGRGYG 98 Score = 28.3 bits (60), Expect = 7.5 Identities = 19/62 (30%), Positives = 20/62 (32%) Frame = -2 Query: 633 PPXPXPXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAP 454 P P G G G G G G GGG G GGG+G GG Sbjct: 47 PRVHGPGYGIGSRGPDPGPGFFFGGAGPGPGYGGGGGHGPGYGGGGDGRGYGSETGGGNH 106 Query: 453 XP 448 P Sbjct: 107 GP 108 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 34.3 bits (75), Expect = 0.11 Identities = 25/79 (31%), Positives = 27/79 (34%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXX 430 G + G GG G G +GGGG G GG G G GG Sbjct: 23 GTHSLQAGGNGGGSGKGQWLHGGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSS 82 Query: 429 GGGXXPPKRGXXGXGRXGG 373 GGG G G G GG Sbjct: 83 GGG------GGGGEGDGGG 95 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGG 496 G G K GGG G GG GGGG G GGG Sbjct: 59 GGGGQKISKGGGGGGSGGGQRSSSGGGGGGGEGDGGGG 96 Score = 33.5 bits (73), Expect = 0.20 Identities = 22/66 (33%), Positives = 26/66 (39%), Gaps = 2/66 (3%) Frame = -2 Query: 582 GGGXVGXW--GGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPP 409 GG G W GG G GGG G GGG +++ G GG+ GGG Sbjct: 34 GGSGKGQWLHGGGGEG---GGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGGE 90 Query: 408 KRGXXG 391 G G Sbjct: 91 GDGGGG 96 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G G G GG+ GG G GG GG G G G G G Sbjct: 52 GEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGGEGDGGGG 96 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = -1 Query: 847 GXW-RPGWXXGXRGWGGRXXXGGGXXX--GGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G W G G G GG GGG GGGG G G GGG G G Sbjct: 39 GQWLHGGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGGEGDGGG 95 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/50 (36%), Positives = 20/50 (40%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXGR 683 G G G G GGG GG G G GG + GGG G G+ Sbjct: 30 GGNGGGSGKGQWLHGGGGEGGGGEGGGGEG-GGGQKISKGGGGGGSGGGQ 78 Score = 28.7 bits (61), Expect = 5.7 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = -1 Query: 832 GWXXGXRGW--GGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQK 692 G G W GG GGG GGGG G G G GG GQ+ Sbjct: 33 GGGSGKGQWLHGGGGEGGGGE--GGGGEGGGGQKISKGGGGGGSGGGQR 79 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 32.7 bits (71), Expect = 0.35 Identities = 19/70 (27%), Positives = 19/70 (27%) Frame = +3 Query: 558 PXTPLXPPXXPXXXXPXPXGXXGXGVSXXXXXXXXXXGRXPXLPXFCPXXPPPXPTPTPP 737 P TP PP P P V F P PP P P PP Sbjct: 249 PATPPPPPPPPPVEVPQKPRRTHRSVRNRDLQENAKRSETKFKRTFQPPPSPPPPPPPPP 308 Query: 738 XXPXXXXPPP 767 P PP Sbjct: 309 PQPLIAATPP 318 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXA 802 PP PPPP PPP P A Sbjct: 297 PPSPPPPPPPPPPQPLIA 314 Score = 29.1 bits (62), Expect(2) = 0.13 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 494 SPPPXXPXXPPPPFXTPXXXPPQXP 568 SPP P PPPP P PQ P Sbjct: 243 SPPQQPPATPPPPPPPPPVEVPQKP 267 Score = 27.9 bits (59), Expect = 10.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPPP 529 PP PSPPP P PPP Sbjct: 373 PPQYQSLIPPPSPPPPPPPPPPP 395 Score = 27.9 bits (59), Expect = 10.0 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 749 PPXPPPPXXXPPP 787 PP PPPP PPP Sbjct: 382 PPSPPPPPPPPPP 394 Score = 23.8 bits (49), Expect(2) = 0.13 Identities = 9/23 (39%), Positives = 9/23 (39%) Frame = +2 Query: 542 PXXXPPQXPTXPPPXPXFXLPRP 610 P PP P PPP P P Sbjct: 296 PPPSPPPPPPPPPPQPLIAATPP 318 >At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; glycine-rich protein 14 (GRP14) PMID:11431566; PIR:JQ1063 Length = 193 Score = 33.9 bits (74), Expect = 0.15 Identities = 22/49 (44%), Positives = 23/49 (46%) Frame = -1 Query: 853 FXGXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 F G R G G G GG GGG G GG G GG+G G GGG Sbjct: 100 FGGGRRFGGRFGKPGGGG--LGGGGLPGGLGGLGGGGLPGGLG-GLGGG 145 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/46 (41%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -1 Query: 820 GXRGWGGRXXXGGG-XXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G R +GG GG GGGG G GG+G GGG G G Sbjct: 96 GLRRFGGGRRFGGRFGKPGGGGLGGGGLPGGLGGLGGGGLPGGLGG 141 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/42 (42%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = -1 Query: 820 GXRGWGGRXXX-GGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G R +GGR GGG GGG G GG G+ G G G Sbjct: 102 GGRRFGGRFGKPGGGGLGGGGLPGGLGGLGGGGLPGGLGGLG 143 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 491 PSPPPXX-PXXPPPPFXTPXXXPPQXPTXPPPXP 589 P P P P PPPP P P P PPP P Sbjct: 9 PYPAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPP 42 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 720 PTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P P P PPPP PP PP P P P Sbjct: 9 PYPAPGNYPQG--PPPPVGVPPQYYPPPPPPPPPPPPP 44 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXR 800 P P P P P P P PPPP PPP R Sbjct: 9 PYPAPGNYPQGPPP-PVGVPPQYYPPPPPPPPPPPPPR 45 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P P P P PP PPP PP P Sbjct: 9 PYPAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPPP 43 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +2 Query: 458 APPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPP 583 A P P PPP P PP + P PP P PPP Sbjct: 7 AYPYPAPGNYPQGPPP--PVGVPPQYYPP--PPPPPPPPPPP 44 >At4g08410.1 68417.m01390 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 707 Score = 33.9 bits (74), Expect = 0.15 Identities = 34/154 (22%), Positives = 40/154 (25%), Gaps = 7/154 (4%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXG--APPXPXXRATXPSP-----PPXXPXXPPPPFXTPXX 550 P P + PPP +PP P ++ P P P PPPP+ Sbjct: 351 PPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSTPPPYYSPSPKVDYKSPPPPYVYSSP 410 Query: 551 XPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXX 730 PP P P + P P L P P Sbjct: 411 PPPYYS--PSPKVDYKSPPPPYIYSSTPLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPS 468 Query: 731 XXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPP 832 PP PP PPP P PP Sbjct: 469 PKVDYKPPPPPYVYSSPPPPYYSPSPKVDYKSPP 502 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = +2 Query: 491 PSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P PPP PPPP+ +P P PPP + P P Sbjct: 475 PPPPPYVYSSPPPPYYSP--SPKVDYKSPPPPYVYSFPPP 512 Score = 32.7 bits (71), Expect = 0.35 Identities = 23/85 (27%), Positives = 28/85 (32%), Gaps = 6/85 (7%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 410 PPPPYYSPSPKVDYKSPPPPYIYSSTPLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 469 Query: 551 XPPQXPTXPP-----PXPXFXLPRP 610 P PP P P + P P Sbjct: 470 KVDYKPPPPPYVYSSPPPPYYSPSP 494 Score = 32.3 bits (70), Expect = 0.46 Identities = 34/157 (21%), Positives = 41/157 (26%), Gaps = 7/157 (4%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXG--APPXPXXRATXPSP-----PPXXPXXPPPPFXTPXX 550 P P + G PPP +PP P ++ P P P PPPP+ Sbjct: 326 PPPPYVYGSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSST 385 Query: 551 XPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXX 730 PP P P + P P P P Sbjct: 386 PPPYYS--PSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYIYSSTPLPYYSPS 443 Query: 731 XXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPPGAP 841 P PPP PP P + PP P Sbjct: 444 PKVDYKSP-PPPYVYSSPPPPYYSPSPKVDYKPPPPP 479 Score = 31.9 bits (69), Expect = 0.61 Identities = 23/88 (26%), Positives = 28/88 (31%), Gaps = 1/88 (1%) Frame = +2 Query: 350 KXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPS-PPPXXPXXPP 526 K PP P + PPP P + S PPP PP Sbjct: 77 KPSIYSSSPPPSYYSPSPKVDYKSPPPSYVYSSPPPPYYSPSPKVDYKSLPPPYVYSSPP 136 Query: 527 PPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 PP+ +P P PPP + P P Sbjct: 137 PPYYSP--SPKVNYKSPPPPYVYSSPPP 162 Score = 31.9 bits (69), Expect = 0.61 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 135 PPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSP-- 192 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 193 SPKVDYKSPPPPYVYSSPPP 212 Score = 31.9 bits (69), Expect = 0.61 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 235 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSP-- 292 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 293 SPKVDYKSPPPPYVYSSPPP 312 Score = 31.9 bits (69), Expect = 0.61 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 285 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSP-- 342 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 343 SPKVDYKSPPPPYVYSSPPP 362 Score = 31.9 bits (69), Expect = 0.61 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 510 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSP-- 567 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 568 SPKVEYKSPPPPYIYSSPPP 587 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 185 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSP-- 242 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 243 SPKVDYKSPPPPYVYSSPPP 262 Score = 31.5 bits (68), Expect = 0.81 Identities = 24/82 (29%), Positives = 29/82 (35%), Gaps = 3/82 (3%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPX--PXXRATXPSPPPXXP-XXPPPPFXTP 544 PP P + PPP G PP P + SPPP PPPP+ +P Sbjct: 310 PPPPYYSPSPKVNYKSPPPPYVY--GSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 367 Query: 545 XXXPPQXPTXPPPXPXFXLPRP 610 + PPP P P Sbjct: 368 -SPKVDYKSPPPPYVYSSTPPP 388 Score = 31.5 bits (68), Expect = 0.81 Identities = 21/66 (31%), Positives = 24/66 (36%), Gaps = 3/66 (4%) Frame = +2 Query: 422 PPPXXXXXXGXGAP---PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPX 592 PPP P P P P PPP PPPP+ +P P PPP Sbjct: 475 PPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSFPPPPYYSP--SPKVDYKSPPPPYV 531 Query: 593 FXLPRP 610 + P P Sbjct: 532 YSSPPP 537 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 585 PPPPYYAPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 642 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 643 SPKVNYKSPPPPYVYSSPPP 662 Score = 31.5 bits (68), Expect = 0.81 Identities = 24/86 (27%), Positives = 29/86 (33%), Gaps = 7/86 (8%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTP-- 544 PP P + PPP P + SPPP PPPP+ +P Sbjct: 610 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSP 669 Query: 545 ----XXXPPQXPTXPPPXPXFXLPRP 610 PPQ PP P + P P Sbjct: 670 KVDYKSSPPQYVYSSPPTPYYS-PSP 694 Score = 31.1 bits (67), Expect = 1.1 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 560 PPPPYYSPSPKVEYKSPPPPYIYSSPPPPYYAPSPKVDYKSPPPPYVYSSPPPPYYSP-- 617 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 618 SPKVDYKSPPPPYVYSSPPP 637 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRP 803 + P P PPP +PTP PP PPP P Sbjct: 199 KSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSP 242 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/44 (34%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +3 Query: 684 LPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXP-PPXXXRPPXP 812 LP + P +P PP PPPP P P +PP P Sbjct: 437 LPYYSPSPKVDYKSPPPPYV--YSSPPPPYYSPSPKVDYKPPPP 478 >At3g54580.1 68416.m06039 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 951 Score = 33.9 bits (74), Expect = 0.15 Identities = 37/175 (21%), Positives = 45/175 (25%), Gaps = 11/175 (6%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTP-- 544 PP P + PPP P + SPPP PPPP+ +P Sbjct: 430 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 489 Query: 545 ---XXXPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXX 715 PP P P + P P P P + Sbjct: 490 KVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 549 Query: 716 XXXXXXXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPP-----GAPXPXKHNSS 865 P PP PPP P PP +P P H+ S Sbjct: 550 YYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYHSPS 604 Score = 32.7 bits (71), Expect = 0.35 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 155 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSP-- 212 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 213 SPKVEYKSPPPPYVYSSPPP 232 Score = 32.7 bits (71), Expect = 0.35 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 380 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSP-- 437 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 438 SPKVEYKSPPPPYVYSSPPP 457 Score = 32.7 bits (71), Expect = 0.35 Identities = 23/82 (28%), Positives = 28/82 (34%), Gaps = 1/82 (1%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTP 544 K PP P + PPP P + SPPP PPPP+ +P Sbjct: 761 KSPPPPYYAPTPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSP 820 Query: 545 XXXPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 821 --SPKVEYKSPPPPYVYSSPPP 840 Score = 32.3 bits (70), Expect = 0.46 Identities = 23/82 (28%), Positives = 28/82 (34%), Gaps = 1/82 (1%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTP 544 K PP P + PPP P + SPPP PPPP+ +P Sbjct: 544 KSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYHSP 603 Query: 545 XXXPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 604 --SPKVQYKSPPPPYVYSSPPP 623 Score = 31.9 bits (69), Expect = 0.61 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 205 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 262 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 263 SPKVEYKSPPPPYVYSSPPP 282 Score = 31.9 bits (69), Expect = 0.61 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 255 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 312 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 313 SPKVDYKSPPPPYVYSSPPP 332 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/49 (34%), Positives = 21/49 (42%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P + P PPP PPPP+ +P P PPP + P P Sbjct: 603 PSPKVQYKSP-PPPYVYSSPPPPYYSP--SPKVYYKSPPPPYVYSSPPP 648 Score = 31.1 bits (67), Expect = 1.1 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 813 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 870 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 871 SPKVDYKSPPPPYVYSSPPP 890 Score = 31.1 bits (67), Expect = 1.1 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 838 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 895 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 896 SPVVDYKSPPPPYVYSSPPP 915 Score = 30.7 bits (66), Expect = 1.4 Identities = 22/80 (27%), Positives = 26/80 (32%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP +P Sbjct: 80 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSP-- 137 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 138 SPKVEYKSPPPPYVYSSPPP 157 Score = 30.7 bits (66), Expect = 1.4 Identities = 22/80 (27%), Positives = 26/80 (32%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP +P Sbjct: 105 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSP-- 162 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 163 SPKVEYKSPPPPYVYSSPPP 182 Score = 30.7 bits (66), Expect = 1.4 Identities = 22/80 (27%), Positives = 26/80 (32%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP +P Sbjct: 330 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSP-- 387 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 388 SPKVEYKSPPPPYVYSSPPP 407 Score = 30.7 bits (66), Expect = 1.4 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 596 PPPPYHSPSPKVQYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP-- 653 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 654 SPKVYYKSPPPPYVYSSPPP 673 Score = 30.3 bits (65), Expect = 1.9 Identities = 22/80 (27%), Positives = 26/80 (32%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP +P Sbjct: 280 PPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSP-- 337 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 338 SPKVEYKSPPPPYVYSSPPP 357 Score = 30.3 bits (65), Expect = 1.9 Identities = 22/80 (27%), Positives = 26/80 (32%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP +P Sbjct: 305 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSP-- 362 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 363 SPKVEYKSPPPPYVYSSPPP 382 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 895 PSPVVDYKSP-PPPYVYSSPPPPYYSP--SPKVEYKSPPPPYVYKSPPP 940 Score = 29.1 bits (62), Expect = 4.3 Identities = 23/80 (28%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P P + PPP P + SPPP PPPP +P Sbjct: 56 PPPTYSPA-PEVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSP-- 112 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 113 SPKVEYKSPPPPYVYSSPPP 132 Score = 29.1 bits (62), Expect = 4.3 Identities = 19/57 (33%), Positives = 22/57 (38%), Gaps = 10/57 (17%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPX---PTP-----TPPXXPXXXXPPPPXXXPPP--XXXRPPXP 812 + P P C PPP P+P +PP PPPP P P PP P Sbjct: 685 KSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYSSPPPPHYSPSPKVYYKSPPPP 741 Score = 29.1 bits (62), Expect = 4.3 Identities = 23/80 (28%), Positives = 29/80 (36%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGA-PPXPXXRATXPSPPPXXPXXPPPPFXTPXX 550 PP P ++ PPP P P P PPP PPPP+ +P Sbjct: 698 PPPCYSPSPKVVYKSPPPPYVYSSPPPPHYSPSPKVYYKSP-PPPYVYSSPPPPYYSP-- 754 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P+ PP P + P P Sbjct: 755 -SPKVHYKSPP-PPYYAPTP 772 Score = 28.7 bits (61), Expect = 5.7 Identities = 19/66 (28%), Positives = 24/66 (36%), Gaps = 2/66 (3%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGX--GAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQX 565 P P + PPP +PP P P PPP P + +P PP Sbjct: 662 PPPPYVYSSPPPPYYSPSPKVYYKSPPHPHV-CVCPPPPPCYSPSPKVVYKSPP--PPYV 718 Query: 566 PTXPPP 583 + PPP Sbjct: 719 YSSPPP 724 Score = 27.9 bits (59), Expect = 10.0 Identities = 22/84 (26%), Positives = 25/84 (29%) Frame = +2 Query: 359 TXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFX 538 T PP P + P P P P P PP PPPP Sbjct: 27 TDSSPPPLYSSPLPKIEYKTPPLPYIDSSPPPTYSPAPEVEYKSPPPPYVYS-SPPPPTY 85 Query: 539 TPXXXPPQXPTXPPPXPXFXLPRP 610 +P P PPP + P P Sbjct: 86 SP--SPKVEYKSPPPPYVYSSPPP 107 Score = 27.9 bits (59), Expect = 10.0 Identities = 16/49 (32%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP--XXXRPPXP 812 + P P PPP +P+P PPPP P P PP P Sbjct: 736 KSPPPPYVYSSPPPPYYSPSPKV--HYKSPPPPYYAPTPKVHYKSPPPP 782 >At3g10300.3 68416.m01236 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 335 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/63 (28%), Positives = 23/63 (36%), Gaps = 2/63 (3%) Frame = +2 Query: 407 LGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP--XXPPPPFXTPXXXPPQXPTXPP 580 + G P G PP P +T +PPP PPPP+ + P P Sbjct: 1 MSGYPPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSGSNPPPPYGSSASSPYAVPYGAQ 60 Query: 581 PXP 589 P P Sbjct: 61 PAP 63 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/64 (28%), Positives = 22/64 (34%) Frame = +2 Query: 413 GXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPX 592 G PPP G P P ++ +PPP P+ P P PP P Sbjct: 14 GGNPPPPQPPYGSTGNNPPPYG-SSGSNPPPPYGSSASSPYAVPYGAQPAPYGAPPSAPY 72 Query: 593 FXLP 604 LP Sbjct: 73 ASLP 76 >At3g10300.2 68416.m01235 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 324 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/63 (28%), Positives = 23/63 (36%), Gaps = 2/63 (3%) Frame = +2 Query: 407 LGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP--XXPPPPFXTPXXXPPQXPTXPP 580 + G P G PP P +T +PPP PPPP+ + P P Sbjct: 1 MSGYPPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSGSNPPPPYGSSASSPYAVPYGAQ 60 Query: 581 PXP 589 P P Sbjct: 61 PAP 63 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/64 (28%), Positives = 22/64 (34%) Frame = +2 Query: 413 GXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPX 592 G PPP G P P ++ +PPP P+ P P PP P Sbjct: 14 GGNPPPPQPPYGSTGNNPPPYG-SSGSNPPPPYGSSASSPYAVPYGAQPAPYGAPPSAPY 72 Query: 593 FXLP 604 LP Sbjct: 73 ASLP 76 >At3g10300.1 68416.m01234 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 232 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/63 (28%), Positives = 23/63 (36%), Gaps = 2/63 (3%) Frame = +2 Query: 407 LGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP--XXPPPPFXTPXXXPPQXPTXPP 580 + G P G PP P +T +PPP PPPP+ + P P Sbjct: 1 MSGYPPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSGSNPPPPYGSSASSPYAVPYGAQ 60 Query: 581 PXP 589 P P Sbjct: 61 PAP 63 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/64 (28%), Positives = 22/64 (34%) Frame = +2 Query: 413 GXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPX 592 G PPP G P P ++ +PPP P+ P P PP P Sbjct: 14 GGNPPPPQPPYGSTGNNPPPYG-SSGSNPPPPYGSSASSPYAVPYGAQPAPYGAPPSAPY 72 Query: 593 FXLP 604 LP Sbjct: 73 ASLP 76 >At2g43680.2 68415.m05430 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 669 Score = 33.9 bits (74), Expect = 0.15 Identities = 23/80 (28%), Positives = 25/80 (31%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXX 550 KPP P P L PP P R T P PP P P P Sbjct: 214 KPPS-PRAEPPTLDTPRPPSPRAASLRADPPRLDAARPTTPRPP--SPLADAPRLDAPRP 270 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P+ P+ P PRP Sbjct: 271 TTPKPPSPRSDPPRLDAPRP 290 Score = 33.5 bits (73), Expect = 0.20 Identities = 24/91 (26%), Positives = 29/91 (31%), Gaps = 5/91 (5%) Frame = +2 Query: 350 KXXTXKKKPPX--RPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXP---SPPPXXP 514 K + + +PP P P P P P P A P +P P P Sbjct: 214 KPPSPRAEPPTLDTPRPPSPRAASLRADPPRLDAARPTTPRPPSPLADAPRLDAPRPTTP 273 Query: 515 XXPPPPFXTPXXXPPQXPTXPPPXPXFXLPR 607 P P P P+ T PP P PR Sbjct: 274 KPPSPRSDPPRLDAPRPTTPKPPSPRSVSPR 304 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 720 PTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P PT P P PP P P +PP P Sbjct: 268 PRPTTPKPPSPRSDPPRLDAPRPTTPKPPSP 298 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/62 (27%), Positives = 21/62 (33%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXL 601 P P PP P SP P P P +P P+ + PP P + Sbjct: 80 PTPDRPNPYSASPPPRPASPRVA-SPRPTSPRVASPRVPSPRAEVPRTLSPKPPSPRAEV 138 Query: 602 PR 607 PR Sbjct: 139 PR 140 Score = 27.9 bits (59), Expect = 10.0 Identities = 21/76 (27%), Positives = 25/76 (32%), Gaps = 2/76 (2%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATX--PSPPPXXPXXPPPPFXTPXXXPP 559 P P P PPP P A+ PSP P P +P P Sbjct: 80 PTPDRPNPYSASPPPRPASPRVASPRPTSPRVASPRVPSPRAEVPRTLSPKPPSPRAEVP 139 Query: 560 QXPTXPPPXPXFXLPR 607 + + PP P LPR Sbjct: 140 RSLSPKPPSPRADLPR 155 >At2g43680.1 68415.m05429 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 668 Score = 33.9 bits (74), Expect = 0.15 Identities = 23/80 (28%), Positives = 25/80 (31%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXX 550 KPP P P L PP P R T P PP P P P Sbjct: 213 KPPS-PRAEPPTLDTPRPPSPRAASLRADPPRLDAARPTTPRPP--SPLADAPRLDAPRP 269 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P+ P+ P PRP Sbjct: 270 TTPKPPSPRSDPPRLDAPRP 289 Score = 33.5 bits (73), Expect = 0.20 Identities = 24/91 (26%), Positives = 29/91 (31%), Gaps = 5/91 (5%) Frame = +2 Query: 350 KXXTXKKKPPX--RPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXP---SPPPXXP 514 K + + +PP P P P P P P A P +P P P Sbjct: 213 KPPSPRAEPPTLDTPRPPSPRAASLRADPPRLDAARPTTPRPPSPLADAPRLDAPRPTTP 272 Query: 515 XXPPPPFXTPXXXPPQXPTXPPPXPXFXLPR 607 P P P P+ T PP P PR Sbjct: 273 KPPSPRSDPPRLDAPRPTTPKPPSPRSVSPR 303 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 720 PTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P PT P P PP P P +PP P Sbjct: 267 PRPTTPKPPSPRSDPPRLDAPRPTTPKPPSP 297 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/62 (27%), Positives = 21/62 (33%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXL 601 P P PP P SP P P P +P P+ + PP P + Sbjct: 79 PTPDRPNPYSASPPPRPASPRVA-SPRPTSPRVASPRVPSPRAEVPRTLSPKPPSPRAEV 137 Query: 602 PR 607 PR Sbjct: 138 PR 139 Score = 27.9 bits (59), Expect = 10.0 Identities = 21/76 (27%), Positives = 25/76 (32%), Gaps = 2/76 (2%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATX--PSPPPXXPXXPPPPFXTPXXXPP 559 P P P PPP P A+ PSP P P +P P Sbjct: 79 PTPDRPNPYSASPPPRPASPRVASPRPTSPRVASPRVPSPRAEVPRTLSPKPPSPRAEVP 138 Query: 560 QXPTXPPPXPXFXLPR 607 + + PP P LPR Sbjct: 139 RSLSPKPPSPRADLPR 154 >At1g09460.1 68414.m01058 glucan endo-1,3-beta-glucosidase-related similar to glucan endo-1,3-beta-glucosidase precursor SP:P52409 from [Triticum aestivum] Length = 330 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P P T P P PPP PPP PP L P Sbjct: 56 PTNPATTVPIVPPVTTIPPPTLTPPPVITIPPPTLTP 92 Score = 27.9 bits (59), Expect = 10.0 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = +3 Query: 684 LPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 +P P P PT TPP P PPP P P P P P Sbjct: 63 VPIVPPVTTIPPPTLTPP--PVITIPPPTLTPPVTNPVTNPVTQYPPTQPSGTVP 115 >At5g06640.1 68418.m00750 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 689 Score = 33.5 bits (73), Expect = 0.20 Identities = 22/80 (27%), Positives = 28/80 (35%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP + P + PPP P + SPPP PPPP+ +P Sbjct: 387 PPPQYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVAYKSPPPPYVYSSPPPPYYSP-- 444 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 445 SPKVDYKSPPPPYVYSSPPP 464 Score = 32.3 bits (70), Expect = 0.46 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 87 PPPSYYSPSPKVNYKSPPPPNVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 144 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 145 SPKVDYKSPPPPYVYSSPPP 164 Score = 31.9 bits (69), Expect = 0.61 Identities = 25/81 (30%), Positives = 29/81 (35%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPX 547 K P P P P + PPP P P P PPP PPPP+ +P Sbjct: 70 KSPKYAPHPK-PYVYISPPPPSYYS-------PSPKVNYKSP-PPPNVYNSPPPPYYSP- 119 Query: 548 XXPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 120 -SPKVDYKSPPPPYVYSSPPP 139 Score = 31.9 bits (69), Expect = 0.61 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 362 PPPPYYSPSPKVDYKSPPPPYVYSSPPPQYYSPSPKVAYKSPPPPYVYSSPPPPYYSP-- 419 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 420 SPKVAYKSPPPPYVYSSPPP 439 Score = 31.9 bits (69), Expect = 0.61 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 412 PPPPYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 469 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 470 SPKVEYKSPPPPYVYSSPPP 489 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 112 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 169 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 170 SPKVEYKSPPPPYVYNSPPP 189 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 187 PPPPYYSPSPKIEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSP-- 244 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 245 SPKVDYKSPPPPYVYSSPPP 264 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 212 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYFSP-- 269 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 270 SPKVEYKSPPPPYVYNSPPP 289 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 437 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSP-- 494 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 495 SPKVEYKSPPPPYVYSSPPP 514 Score = 31.1 bits (67), Expect = 1.1 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 137 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSP-- 194 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 195 SPKIEYKSPPPPYVYSSPPP 214 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 269 PSPKVEYKSP-PPPYVYNSPPPPYYSP--SPKVEYKSPPPPYVYSSPPP 314 Score = 30.7 bits (66), Expect = 1.4 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 287 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP-- 344 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 345 SPKVDYKSPPPPYVYSSPPP 364 Score = 30.7 bits (66), Expect = 1.4 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 312 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 369 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 370 SPKVDYKSPPPPYVYSSPPP 389 Score = 30.3 bits (65), Expect = 1.9 Identities = 20/70 (28%), Positives = 24/70 (34%), Gaps = 1/70 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P P + PPP P + SPPP PPPP+ +P Sbjct: 538 PPPYYSPS-PKVNYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSP 596 Query: 551 XPPQXPTXPP 580 T PP Sbjct: 597 MVDYKSTPPP 606 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/47 (34%), Positives = 19/47 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLP 604 P P P PPP PPPP+ +P P PPP + P Sbjct: 644 PSPKVHYKSP-PPPYVYNSPPPPYYSP--SPKVTYKSPPPPYVYKAP 687 Score = 29.1 bits (62), Expect = 4.3 Identities = 20/63 (31%), Positives = 23/63 (36%), Gaps = 9/63 (14%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPX--PTP-----TPPXXPXXXXPPPPXXXPPP--XXXRPPXPLXPX 824 + P P PPP P+P +PP PPPP P P PP P Sbjct: 476 KSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYHSPSPKVNYKSPPPPYVYS 535 Query: 825 XHP 833 HP Sbjct: 536 SHP 538 Score = 29.1 bits (62), Expect = 4.3 Identities = 21/78 (26%), Positives = 26/78 (33%), Gaps = 8/78 (10%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXX-PPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 512 PPPPYHSPSPKVNYKSPPPPYVYSSHPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSP 571 Query: 551 X-------PPQXPTXPPP 583 PP + PPP Sbjct: 572 KVNYKSPPPPYVYSSPPP 589 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/49 (32%), Positives = 19/49 (38%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P+ PP P P Sbjct: 494 PSPKVEYKSP-PPPYVYSSPPPPYHSP---SPKVNYKSPPPPYVYSSHP 538 Score = 28.3 bits (60), Expect = 7.5 Identities = 21/80 (26%), Positives = 26/80 (32%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPP+ +P Sbjct: 487 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYHSPSPKVNYKSPPPPYVYSSHPPPYYSP-- 544 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 545 SPKVNYKSPPPPYVYSSPPP 564 >At4g12500.1 68417.m01975 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 177 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 485 TXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 T PSP P P P +P P PT P P P P Sbjct: 38 TVPSPKVPSPKYPSPSIPSPSVPTPSVPTPSVPTPSVPSPNP 79 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 491 PSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGG 634 PSP P P P TP P PT P P P G G Sbjct: 45 PSPKYPSPSIPSPSVPTPSVPTPSVPTPSVPSPNPTPVTPPRTPGSSG 92 >At4g03120.1 68417.m00425 proline-rich family protein similar to U1 small nuclear ribonucleoprotein C; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 207 Score = 33.5 bits (73), Expect = 0.20 Identities = 26/86 (30%), Positives = 28/86 (32%), Gaps = 8/86 (9%) Frame = +2 Query: 371 KPPXRPXPXXPLLGGXXPP--PXXXXXXGXGAPPXPXXRATXP---SPPPXXPXXPPPPF 535 +PP P P P G PP P G PP P P +P P PP Sbjct: 95 RPPVLPRPMMPPQGYMPPPGVPQMMAPPGAPLPPPPQNGILRPPGMAPIPGQGGGPPGMA 154 Query: 536 XTP---XXXPPQXPTXPPPXPXFXLP 604 P PP PPP P P Sbjct: 155 PIPGQGGGPPPNYNGLPPPPPYHTNP 180 Score = 30.7 bits (66), Expect = 1.4 Identities = 20/68 (29%), Positives = 21/68 (30%), Gaps = 2/68 (2%) Frame = +2 Query: 383 RPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPP-PXXPXXPPP-PFXTPXXXP 556 RP P+ G PP G G P P P PP P PP F P Sbjct: 136 RPPGMAPIPGQGGGPPGMAPIPGQGGGPPPNYNGLPPPPPYHTNPAAPPSGNFNNPNLNN 195 Query: 557 PQXPTXPP 580 P P Sbjct: 196 PNPSAESP 203 Score = 29.5 bits (63), Expect = 3.3 Identities = 24/81 (29%), Positives = 26/81 (32%), Gaps = 4/81 (4%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXP--SPPPXXPXXPPPPFXTPX 547 PP P P PPP G P P P +P P PPP + Sbjct: 112 PPGVPQMMAPPGAPLPPPPQNGILRPPGMAPIPGQGGGPPGMAPIPGQGGGPPPNY-NGL 170 Query: 548 XXPPQXPTXP--PPXPXFXLP 604 PP T P PP F P Sbjct: 171 PPPPPYHTNPAAPPSGNFNNP 191 Score = 28.3 bits (60), Expect = 7.5 Identities = 19/66 (28%), Positives = 21/66 (31%), Gaps = 5/66 (7%) Frame = +2 Query: 455 GAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPP-----XPXFXLPRPXXG 619 G+ P P P PPP PP P PPP P P P G Sbjct: 88 GSMPMGMRPPVLPRPMMPPQGYMPPPGVPQMMAPPGAPLPPPPQNGILRPPGMAPIPGQG 147 Query: 620 XGXGGL 637 G G+ Sbjct: 148 GGPPGM 153 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 2/44 (4%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPP--PXXXPPPXXXRPPXP 812 P P P P P P PPP P PP PP P Sbjct: 87 PGSMPMGMRPPVLPRPMMPPQGYMPPPGVPQMMAPPGAPLPPPP 130 >At3g50650.1 68416.m05540 scarecrow-like transcription factor 7 (SCL7) Length = 542 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Frame = +2 Query: 521 PPPPFXTPXXXP----PQXPTXPPPXPXFXLPRP 610 PPPP T P PQ P PPP P F L +P Sbjct: 143 PPPPASTAIWSPSPPSPQHPPPPPPQPDFDLNQP 176 >At3g04640.1 68416.m00497 glycine-rich protein predicted proteins, Arabidopsis thaliana Length = 159 Score = 33.5 bits (73), Expect = 0.20 Identities = 21/56 (37%), Positives = 23/56 (41%) Frame = -2 Query: 540 VXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPPKRGXXGXGRXGG 373 V K GGG G GGG G R G GG+ GGG + G R GG Sbjct: 69 VVKKGGGGGGRGGGGFGGGGRSFGGGGS------SSRGGGGSSSRGGGGSSSRGGG 118 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -1 Query: 838 RPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGG 710 + G G RG GG GGG GGGG G G G GG Sbjct: 71 KKGGGGGGRGGGG--FGGGGRSFGGGGSSSRGGGGSSSRGGGG 111 Score = 30.3 bits (65), Expect = 1.9 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 4/53 (7%) Frame = -2 Query: 594 KXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGE----GXVARXXGXGGAPXP 448 K G GGG G G G GGGG GGG G + G G P P Sbjct: 71 KKGGGGGGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGGGSSSRGGGLRPIP 123 Score = 29.9 bits (64), Expect = 2.5 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Frame = -1 Query: 859 IVFXGXWRPGWXXGXRGWGGRXXXGGG-XXXGGGGXXXXGXXGGVGVGXGGG 707 +V G G G G GGR GGG GGGG G GG GGG Sbjct: 69 VVKKGGGGGGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRG--GGGSSSRGGG 118 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGG 496 G GR G GGG GG +GGGG GGG Sbjct: 76 GGGRGGGGFGGGGRSFGGGGSSS--RGGGGSSSRGGGG 111 >At2g18470.1 68415.m02151 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 633 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXKHNSS 865 PP P PP PP + P S PP P NSS Sbjct: 30 PPAPSPPSPTPPQGDSSSSPPPDSTSPPAPQAPNPPNSS 68 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPP-PXXXRPP 806 P P P P+PTPP PPP PP P PP Sbjct: 30 PPAPSP-PSPTPPQGDSSSSPPPDSTSPPAPQAPNPP 65 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPP 580 P +T SPP P P PP PP T PP Sbjct: 19 PPSNTNSTTSSPPAPSPPSPTPPQGDSSSSPPPDSTSPP 57 Score = 29.9 bits (64), Expect = 2.5 Identities = 22/82 (26%), Positives = 25/82 (30%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQX 565 P P P P +PP P + P+PP PPP T PP Sbjct: 5 PESAPPTNSTSSPSPPSNTNSTTSSPPAPSPPS--PTPPQGDSSSSPPPDST---SPPAP 59 Query: 566 PTXPPPXPXFXLPRPXXGXGXG 631 PP P P G G Sbjct: 60 QAPNPPNSSNNSPSPPSQGGGG 81 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 491 PSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXL 601 PSPPP P P + P P PPP P L Sbjct: 230 PSPPPP-PRMPTSGEDSSMYSGPSRPVLPPPSPALAL 265 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXV 484 G GGG G GG GV G G GGG G V Sbjct: 191 GGGGGGGGGGGGGGGGVDGSGSGSGSGSGGGSGNV 225 Score = 32.7 bits (71), Expect = 0.35 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 805 GGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 GG GGG GGGG G G G G G G Sbjct: 191 GGGGGGGGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 31.9 bits (69), Expect = 0.61 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G G G GG GGG G G G G G G G G Sbjct: 91 GIVVGGGGGGGGGGGGGGGSGGSNGSFFNGSGSGTGYGSGDG 132 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 787 GGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 GGG GGGG G G G G G G G Sbjct: 191 GGGGGGGGGGGGGGGGVDGSGSGSGSGSGG 220 Score = 29.5 bits (63), Expect = 3.3 Identities = 21/73 (28%), Positives = 22/73 (30%), Gaps = 1/73 (1%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXX-GXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXP 412 G G G V G GG G G GGG+G G G G Sbjct: 128 GSGDGRVSSSGEYSASAGGGGSGEGSGGGGGGDGSSGSGSGSGSGSGSGTGTASGPDVYM 187 Query: 411 PKRGXXGXGRXGG 373 G G G GG Sbjct: 188 HVEGGGGGGGGGG 200 Score = 29.1 bits (62), Expect = 4.3 Identities = 20/74 (27%), Positives = 21/74 (28%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPP 409 G GGG GG G+ G G G G P GGG Sbjct: 50 GGGGGGASVEGGTEKGIDDNANGYGDGNGNGNA-----HGRADCPGGIVVGGGGGGGGGG 104 Query: 408 KRGXXGXGRXGGFF 367 G G G FF Sbjct: 105 GGGGGSGGSNGSFF 118 Score = 29.1 bits (62), Expect = 4.3 Identities = 21/70 (30%), Positives = 21/70 (30%) Frame = -2 Query: 582 GGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPPKR 403 GG VG GG GGGG G GG G G G G Sbjct: 90 GGIVVGGGGGGG-----GGGGGGGGSGGSNGSFFNGSGSGTGYGSGDGRVSSSGEYSASA 144 Query: 402 GXXGXGRXGG 373 G G G G Sbjct: 145 GGGGSGEGSG 154 Score = 27.9 bits (59), Expect = 10.0 Identities = 21/72 (29%), Positives = 23/72 (31%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPP 409 G GGG G G G G G G G+G V+ G A G G Sbjct: 100 GGGGGGGGGGSGGSNGSFFNGSGSGTGYGSGDGRVS-SSGEYSASAGGGGSGEGSGGGGG 158 Query: 408 KRGXXGXGRXGG 373 G G G G Sbjct: 159 GDGSSGSGSGSG 170 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/37 (45%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = -2 Query: 588 GXGGGXV--GXWGGXXXGVXKGGGGXXGXXGGGEGXV 484 G GGG G +GG G +GG G G GGG G V Sbjct: 118 GGGGGFARRGGYGGGRGGYARGGFGRGGFGGGGYGFV 154 >At1g12810.1 68414.m01488 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 129 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRP 803 P P PPP P+PP PP P PP RP Sbjct: 22 PPGYPSAPPPPGYPSPPSHHEGYPPPQPYGGYPPPSSRP 60 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = +2 Query: 497 PPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXG 619 PPP PPP PP P+ P + P+P G Sbjct: 12 PPPGYQSHYPPPGYPSAPPPPGYPSPPSHHEGYPPPQPYGG 52 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G G G GGG GGGG G GG G G GGG G Sbjct: 63 GIGAGIGAGAGLGLGGGGGGLGGGGGGLLGG-GGFGGGAGGGLGG 106 Score = 33.1 bits (72), Expect = 0.26 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGV--GVGXGGGXXGQKXG 686 G G G G G G GGGG G GG+ G G GGG G G Sbjct: 56 GAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAGGGLGG 106 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGG 460 G G G +G G G G GG G GGG G + G GG Sbjct: 56 GAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGG 98 Score = 30.3 bits (65), Expect = 1.9 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAP 454 G G G GG G+ GGGG G GGG G A G GG P Sbjct: 67 GIGAGAGLGLGGGGGGLGGGGGGLLG--GGGFGGGA-GGGLGGLP 108 Score = 29.5 bits (63), Expect = 3.3 Identities = 18/46 (39%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXX-GXXGGVGVGXGGGXXGQKXG 686 G G G GGG GG G G G+G+G GGG G G Sbjct: 43 GGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGG 88 Score = 29.1 bits (62), Expect = 4.3 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGG 460 G G G G G G G G+ GGGG G GG G G GG Sbjct: 54 GGGAGLGGLGIG-AGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAGG 102 >At1g11130.1 68414.m01274 leucine-rich repeat family protein / protein kinase family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to leucine-rich repeat transmembrane protein kinase 2 [Zea mays] gi|3360291|gb|AAC27895 Length = 768 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 3/50 (6%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPP---PXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PPP P PP P P P PP P PL P HP P Sbjct: 249 PPPPPVVDPPPATHRAPPVPRIPPVSGVPPAPFAPFAPLQPQQHPPPSPP 298 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +3 Query: 729 TPPXXPXXXXPPPPXXXPPPXXXR-PPXPLXP 821 TP PPPP PPP R PP P P Sbjct: 240 TPFNTSIITPPPPPVVDPPPATHRAPPVPRIP 271 Score = 27.9 bits (59), Expect = 10.0 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXG 631 PP RA P PP PF P Q PPP P P G G Sbjct: 257 PPPATHRAPPVPRIPPVSGVPPAPF--APFAPLQPQQHPPPSPPLVWSPPSSDNGGG 311 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGR 839 P PP P P P P PP P PP PP + P P R Sbjct: 117 PLGPPQTPGPEFPVPPSPS-PPMPDTPNPPTPKTPPDVVPPIWEPPR 162 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPP-PXXXRPPXPLXP 821 P PPP PP P P PP PP P PP P P Sbjct: 112 PSDPPPLG---PPQTPGPEFPVPPSPSPPMPDTPNPPTPKTP 150 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +3 Query: 699 PXXP-PPXPTPTPPXXPXXXXPP-PPXXXPP---PXXXRPPXPLXP 821 P P PP P P P PP PP PP P PP PL P Sbjct: 139 PDTPNPPTPKTPPDVVPPIWEPPRPPDIFPPESPPPGIDPPPPLGP 184 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/70 (31%), Positives = 23/70 (32%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP P P P+ PP PP P T P P P PP P Sbjct: 120 PPQTPGPEFPV-----PPSPSPPMPDTPNPPTPK---TPPDVVPPIWEPPRPPDIFPPES 171 Query: 554 PPQXPTXPPP 583 PP PPP Sbjct: 172 PPPGIDPPPP 181 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P P+ TPP PPP PP P P+ P P Sbjct: 94 PNIPEISPSETPPEVTTVPSDPPPLG--PPQTPGPEFPVPPSPSP 136 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/69 (24%), Positives = 19/69 (27%) Frame = +2 Query: 377 PXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXP 556 P P + PP G P P P P PP P P Sbjct: 101 PSETPPEVTTVPSDPPPLGPPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEP 160 Query: 557 PQXPTXPPP 583 P+ P PP Sbjct: 161 PRPPDIFPP 169 Score = 29.5 bits (63), Expect = 3.3 Identities = 20/77 (25%), Positives = 21/77 (27%) Frame = +2 Query: 359 TXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFX 538 T PP P P G P P P P + PP PP Sbjct: 110 TVPSDPPPLGPPQTP--GPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIF 167 Query: 539 TPXXXPPQXPTXPPPXP 589 P PP PP P Sbjct: 168 PPESPPPGIDPPPPLGP 184 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +3 Query: 699 PXXP-PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRP-PXPLXPXXHP 833 P P PP P+P P P P P PP P P + P P Sbjct: 126 PEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFPPESP 172 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +2 Query: 461 PPXPXXRATXPSP-PPXXPXXP--PPPFXTPXXXPPQXPTXPPPXP 589 P P PS PP P PPP P P+ P P P P Sbjct: 91 PELPNIPEISPSETPPEVTTVPSDPPPLGPPQTPGPEFPVPPSPSP 136 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/50 (34%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPF-XTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P P P P PP TP P+ P P P + PRP Sbjct: 115 PPPLGPPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVP-PIWEPPRP 163 Score = 27.9 bits (59), Expect = 10.0 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 5/54 (9%) Frame = +3 Query: 687 PXFCPXXPPP-XPTPTPPXXPXXXXPP---PPXXXPP-PXXXRPPXPLXPXXHP 833 P F P P P P P P P PP PP PP P PP P P Sbjct: 126 PEF-PVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFPPESPPPGIDP 178 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPP 583 P P AT P P P PPP TP P PPP Sbjct: 24 PAPTPTATPPPATPP-PVATPPPVATPPPAATPAPATPPP 62 Score = 31.9 bits (69), Expect = 0.61 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P PP TP P P PPP P P P P P Sbjct: 24 PAPTPTATPPPATPPPVATPPPVATPPPAATPAPATPPPAATPAPATTP 72 Score = 31.5 bits (68), Expect = 0.81 Identities = 20/71 (28%), Positives = 21/71 (29%), Gaps = 3/71 (4%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTP---XXXPPQXPTXPPPXPX 592 PPP P A P+P P P P TP P PT PP P Sbjct: 32 PPPATPPPVATPPPVATPPPAATPAPATPPPAATPAPATTPPSVAPSPADVPTASPPAPE 91 Query: 593 FXLPRPXXGXG 625 P G Sbjct: 92 GPTVSPSSAPG 102 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PPP TP P P PPP P P P P P P Sbjct: 43 PPPVATPPPAATPAPATPPPA-ATPAPATTPPSVAPSPADVPTASPP 88 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP-LXPXXHPG 836 P PPP TP P P P P P P P + P PG Sbjct: 57 PATPPPAATPAPATTP-PSVAPSPADVPTASPPAPEGPTVSPSSAPG 102 Score = 27.9 bits (59), Expect = 10.0 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 482 ATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPP 580 A +P P PPP P PP T PP Sbjct: 19 ALAQAPAPTPTATPPPATPPPVATPPPVATPPP 51 Score = 27.9 bits (59), Expect = 10.0 Identities = 14/39 (35%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +2 Query: 479 RATXPSPPPXXPXXPPPPFXT--PXXXPPQXPTXPPPXP 589 +A P+P P PPP T P PP T P P Sbjct: 22 QAPAPTPTATPPPATPPPVATPPPVATPPPAATPAPATP 60 >At5g07530.1 68418.m00862 glycine-rich protein (GRP17) olesin; glycine-rich protein 17 (GRP17) PMID:11431566; function: pollen recognition (PMID:10655594) Length = 543 Score = 33.1 bits (72), Expect = 0.26 Identities = 25/79 (31%), Positives = 27/79 (34%), Gaps = 3/79 (3%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXX---GVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXX 439 G K GGG G GG G+ GGG G GG G G G + Sbjct: 413 GGSGSKHKIGGGKHGGLGGKFGKKRGMSGSGGGMSGSEGGVSGSEGSMSGGGMSGGSGSK 472 Query: 438 XXXGGGXXPPKRGXXGXGR 382 GGG RG G R Sbjct: 473 HKIGGGKHGGLRGKFGKKR 491 Score = 27.9 bits (59), Expect = 10.0 Identities = 16/50 (32%), Positives = 18/50 (36%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGG 460 G+ R G GG G GG G GG GGG+ GG Sbjct: 488 GKKRGMSGSEGGMSGSEGGMSESGMSGSGGGKHKIGGGKHKFGGGKHGGG 537 >At4g34440.1 68417.m04894 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 670 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPP 583 P + P+P P PP P TP P+ PT P P Sbjct: 84 PQTPENPSPPAPEGSTPVTPPAPPQTPSNQSPERPTPPSP 123 Score = 32.7 bits (71), Expect = 0.35 Identities = 20/73 (27%), Positives = 24/73 (32%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTP 544 + PP P P PP APP T + PP P PP P Sbjct: 29 ESSPPTPPSSPPPSSISAPPPDISASFSPPPAPP------TQETSPPTSPSSSPPVVANP 82 Query: 545 XXXPPQXPTXPPP 583 P+ P+ P P Sbjct: 83 SPQTPENPSPPAP 95 Score = 31.5 bits (68), Expect = 0.81 Identities = 20/66 (30%), Positives = 22/66 (33%), Gaps = 3/66 (4%) Frame = +2 Query: 401 PLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPF---XTPXXXPPQXPT 571 P PP +PP P SPPP PPP +P PP T Sbjct: 12 PETSNGTPPSNGTSPSNESSPPTPPS-----SPPPSSISAPPPDISASFSPPPAPPTQET 66 Query: 572 XPPPXP 589 PP P Sbjct: 67 SPPTSP 72 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/65 (30%), Positives = 22/65 (33%) Frame = +2 Query: 425 PPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLP 604 PP APP P A+ SPPP P P +P PP P P P Sbjct: 35 PPSSPPPSSISAPP-PDISASF-SPPPAPPTQETSPPTSPSSSPPVVANPSPQTPENPSP 92 Query: 605 RPXXG 619 G Sbjct: 93 PAPEG 97 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/58 (27%), Positives = 18/58 (31%), Gaps = 1/58 (1%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPP-PXXXRPPXPLXPXXHPGRHXP 848 P P PP P+ +PP P PP P P P P P P Sbjct: 58 PPAPPTQETSPPTSPSSSPPVVANPSPQTPENPSPPAPEGSTPVTPPAPPQTPSNQSP 115 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP-XXHPGRHXP 848 PPP + PP P PPPP PP P P +PG++ P Sbjct: 198 PPPSTSGYPPI-PSAYPPPPPSSAYPPQPYPPQPSYYPQGPYPGQYPP 244 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXP-PPPXXXPPPXXXRPPXPLXP 821 PP P+ PP P P PPP PP P P Sbjct: 191 PPQPSAYPPPSTSGYPPIPSAYPPPPPSSAYPPQPYPP 228 Score = 28.7 bits (61), Expect = 5.7 Identities = 21/70 (30%), Positives = 24/70 (34%), Gaps = 3/70 (4%) Frame = +2 Query: 383 RPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQ 562 +P P G P G PP P + P PPP PP P+ PQ Sbjct: 180 QPSGYPPASGYPPQPSAYPPPSTSGYPPIP---SAYPPPPPS-SAYPPQPYPPQPSYYPQ 235 Query: 563 XP---TXPPP 583 P PPP Sbjct: 236 GPYPGQYPPP 245 >At4g09030.1 68417.m01490 arabinogalactan-protein (AGP10) identical to gi|10880497|gb|AAG24278; supported by Ceres cDNA 265772 Length = 127 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 714 PXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P PTPTP P PP P P PP P Sbjct: 51 PTPTPTPSATPTAAPVSPPAGSPLPSSASPPAP 83 Score = 29.1 bits (62), Expect = 4.3 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +2 Query: 458 APPXPXXRATXPSP--PPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 AP R+ PSP PP P TP P PT P P P P Sbjct: 23 APGPAPTRSPLPSPAQPPRTAAPTPSITPTPTPTPSATPTAAPVSPPAGSPLP 75 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 13/46 (28%) Frame = +2 Query: 491 PSPPPXXPXXPPPPFXTP-------------XXXPPQXPTXPPPXP 589 PSPPP P PPPP +P PP P PPP P Sbjct: 71 PSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPP 116 Score = 31.9 bits (69), Expect = 0.61 Identities = 20/66 (30%), Positives = 22/66 (33%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQX 565 P P P PPP ++ PPP P PPPP T P Sbjct: 69 PSPSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPPPSSTWDFWDPFI 128 Query: 566 PTXPPP 583 P PPP Sbjct: 129 P--PPP 132 Score = 29.5 bits (63), Expect = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 759 PPPPXXXPPPXXXRPPXPLXP 821 PP P PPP PP PL P Sbjct: 68 PPSPSPPPPPPPRPPPPPLSP 88 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPPXXXP 782 PP P+P PP P PPPP P Sbjct: 68 PPSPSPPPPPPP---RPPPPPLSP 88 Score = 27.9 bits (59), Expect = 10.0 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 749 PPXPPPPXXXPPP 787 PP PPPP PPP Sbjct: 73 PPPPPPPRPPPPP 85 Score = 27.9 bits (59), Expect = 10.0 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 749 PPXPPPPXXXPPP 787 PP PPPP PPP Sbjct: 105 PPPPPPPPPPPPP 117 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 PPP P P PPP PPP PP P Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPPPPPPPPPPP 42 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 485 TXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXP 589 T P PPP P P PP P PPP P Sbjct: 6 TIPPPPPLPPRLELRRQRAPPPQPPPPPPPPPPPP 40 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +2 Query: 479 RATXPSPPPXXPXXPPPPFXTPXXXPP-QXPTXPPP 583 RA P PPP P PPPP P P + PPP Sbjct: 23 RAPPPQPPPPPPPPPPPP--PPRLGPRLRLRLLPPP 56 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 714 PXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPG 836 P P P PP PP PPP PP P P G Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPP---PPPPPPPPPPRLG 45 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXR--PP 806 P LP P P PP P PPPP P R PP Sbjct: 11 PPLPPRLELRRQRAPPPQPPPPPPPPPPPPPPRLGPRLRLRLLPP 55 Score = 28.7 bits (61), Expect = 5.7 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 752 PXPPPPXXXPPPXPXXAXPXSXSXXPP 832 P PPPP PPP P PP Sbjct: 29 PPPPPPPPPPPPPPRLGPRLRLRLLPP 55 Score = 27.9 bits (59), Expect = 10.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 745 PPXXXPPPPXPXPPXXXXGXPXL 813 PP PPPP P PP P L Sbjct: 26 PPQPPPPPPPPPPPPPPRLGPRL 48 >At3g28550.1 68416.m03565 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1018 Score = 33.1 bits (72), Expect = 0.26 Identities = 23/80 (28%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXX-PPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ TP Sbjct: 347 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYTP-- 404 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 405 SPKVVYKSPPPPYVYSSPPP 424 Score = 32.7 bits (71), Expect = 0.35 Identities = 25/82 (30%), Positives = 30/82 (36%), Gaps = 3/82 (3%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPX--PXXRATXPSPPPXXP-XXPPPPFXTP 544 PP P +L PPP PP P + SPPP PPPP+ +P Sbjct: 498 PPPYYSPSPKVLYKSPPPPYVYSSP---PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP 554 Query: 545 XXXPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 555 --SPKVVYKSPPPPYVYSSPPP 574 Score = 32.3 bits (70), Expect = 0.46 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 172 PPPSYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP-- 229 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 230 SPKVDYKSPPPPYVYSSPPP 249 Score = 31.9 bits (69), Expect = 0.61 Identities = 23/82 (28%), Positives = 27/82 (32%), Gaps = 1/82 (1%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTP 544 K PP P + PPP P + SPPP PPPP +P Sbjct: 70 KSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPIYSP 129 Query: 545 XXXPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 130 --SPKVDYKSPPPPYVYSSPPP 149 Score = 31.9 bits (69), Expect = 0.61 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 272 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP-- 329 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 330 TPKVDYKSPPPPYVYSSPPP 349 Score = 31.9 bits (69), Expect = 0.61 Identities = 24/84 (28%), Positives = 30/84 (35%), Gaps = 5/84 (5%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXP-----SPPPXXPXXPPPPFX 538 PP P ++ PPP +PP P T PPP PPPP+ Sbjct: 298 PPPYYSPSPKVVYKSPPPPYVY-----SSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYY 352 Query: 539 TPXXXPPQXPTXPPPXPXFXLPRP 610 +P P PPP + P P Sbjct: 353 SP--SPKVDYKSPPPPYVYSSPPP 374 Score = 31.9 bits (69), Expect = 0.61 Identities = 24/82 (29%), Positives = 30/82 (36%), Gaps = 3/82 (3%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPX--PXXRATXPSPPPXXP-XXPPPPFXTP 544 PP P ++ PPP PP P + SPPP PPPP+ +P Sbjct: 373 PPPYYSPSPKIVYKSPPPPYVYSSP---PPPYYTPSPKVVYKSPPPPYVYSSPPPPYYSP 429 Query: 545 XXXPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 430 --SPKVDYKSPPPPYVYSSPPP 449 Score = 31.9 bits (69), Expect = 0.61 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 422 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP-- 479 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 480 SPKVDYKSPPPPYVYSSPPP 499 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 6/56 (10%) Frame = +2 Query: 461 PPXPXXRATXP------SPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 PP P + P SPPP PPPP+ +P P PPP + P P Sbjct: 638 PPPPPCYSPSPKVVYKSSPPPYVYSSPPPPYHSP--SPKVHYKSPPPPYVYSSPPP 691 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 222 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYSP-- 279 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 280 SPKVDYKSPPPPYVYSSPPP 299 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 472 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVLYKSPPPPYVYSSPPPPYYSP-- 529 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 530 SPKVVYKSPPPPYVYSSPPP 549 Score = 31.5 bits (68), Expect = 0.81 Identities = 24/82 (29%), Positives = 30/82 (36%), Gaps = 3/82 (3%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPX--PXXRATXPSPPPXXP-XXPPPPFXTP 544 PP P ++ PPP PP P + SPPP PPPP+ +P Sbjct: 523 PPPYYSPSPKVVYKSPPPPYVYSSP---PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP 579 Query: 545 XXXPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 580 --SPKVVYKSPPPPYVYSSPPP 599 Score = 31.5 bits (68), Expect = 0.81 Identities = 23/80 (28%), Positives = 28/80 (35%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGA-PPXPXXRATXPSPPPXXPXXPPPPFXTPXX 550 PP P ++ PPP P P P PPP PPPP+ +P Sbjct: 640 PPPCYSPSPKVVYKSSPPPYVYSSPPPPYHSPSPKVHYKSP-PPPYVYSSPPPPYYSP-- 696 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 697 SPKVHYKSPPPPYVYSSPPP 716 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 689 PPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP-- 746 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 747 SPKVVYKSPPPPYVYSSPPP 766 Score = 31.5 bits (68), Expect = 0.81 Identities = 24/82 (29%), Positives = 30/82 (36%), Gaps = 3/82 (3%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPX--PXXRATXPSPPPXXP-XXPPPPFXTP 544 PP P ++ PPP PP P + SPPP PPPP+ +P Sbjct: 715 PPPYYSPSPKVVYKSPPPPYVYSSP---PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP 771 Query: 545 XXXPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 772 --SPKVVYKSPPPPYVYSSPPP 791 Score = 31.5 bits (68), Expect = 0.81 Identities = 24/82 (29%), Positives = 30/82 (36%), Gaps = 3/82 (3%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPX--PXXRATXPSPPPXXP-XXPPPPFXTP 544 PP P ++ PPP PP P + SPPP PPPP+ +P Sbjct: 740 PPPYYSPSPKVVYKSPPPPYVYSSP---PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP 796 Query: 545 XXXPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 797 --SPKVVYKSPPPPYVYSSPPP 816 Score = 31.5 bits (68), Expect = 0.81 Identities = 24/82 (29%), Positives = 30/82 (36%), Gaps = 3/82 (3%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPX--PXXRATXPSPPPXXP-XXPPPPFXTP 544 PP P ++ PPP PP P + SPPP PPPP+ +P Sbjct: 765 PPPYYSPSPKVVYKSPPPPYVYSSP---PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP 821 Query: 545 XXXPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 822 --SPKVVYKSPPPPYVYSSPPP 841 Score = 31.5 bits (68), Expect = 0.81 Identities = 24/82 (29%), Positives = 30/82 (36%), Gaps = 3/82 (3%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPX--PXXRATXPSPPPXXP-XXPPPPFXTP 544 PP P ++ PPP PP P + SPPP PPPP+ +P Sbjct: 815 PPPYYSPSPKVVYKSPPPPYVYSSP---PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP 871 Query: 545 XXXPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 872 --SPKVDYKSPPPPYVYSSPPP 891 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 864 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 921 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 922 SPKVDYKSPPPPYVYSSPPP 941 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 889 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 946 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 947 APKVDYKSPPPPYVYSSPPP 966 Score = 31.1 bits (67), Expect = 1.1 Identities = 23/80 (28%), Positives = 28/80 (35%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGA-PPXPXXRATXPSPPPXXPXXPPPPFXTPXX 550 PP P ++ PPP P P P PPP PPPP+ +P Sbjct: 840 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPPYYSP-- 896 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 897 SPKVDYKSPPPPYVYSSPPP 916 Score = 30.3 bits (65), Expect = 1.9 Identities = 22/85 (25%), Positives = 27/85 (31%), Gaps = 6/85 (7%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTP-- 544 PP P + PPP P + SPPP PPPP+ +P Sbjct: 97 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPIYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 156 Query: 545 ---XXXPPQXPTXPPPXPXFXLPRP 610 PP P P + P P Sbjct: 157 KVEYKSPPSPYVYNSPPPSYYSPSP 181 Score = 30.3 bits (65), Expect = 1.9 Identities = 22/80 (27%), Positives = 28/80 (35%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 914 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPAPKVDYKSPPPPYVYSSPPPPYYSP-- 971 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P+ PP P + P P Sbjct: 972 -SPKVDYKSPPPPYYS-PSP 989 Score = 29.5 bits (63), Expect = 3.3 Identities = 24/82 (29%), Positives = 31/82 (37%), Gaps = 3/82 (3%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPX--PXXRATXPSPPPXXP-XXPPPPFXTP 544 PP P ++ PPP PP P + SPPP PPPP+ +P Sbjct: 548 PPPYYSPSPKVVYKSPPPPYVYSSP---PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP 604 Query: 545 XXXPPQXPTXPPPXPXFXLPRP 610 P+ PP P + P P Sbjct: 605 ---SPKVYYKSPPSP-YHAPSP 622 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/47 (29%), Positives = 15/47 (31%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 + P P C PPP P PPP PP P P Sbjct: 627 KSPPHPHVCVCPPPPPCYSPSPKVVYKSSPPPYVYSSPPPPYHSPSP 673 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRP 803 + P P PPP +PTP PP PPP P Sbjct: 311 KSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSP 354 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRP 803 + P P PPP TP+P PP PPP P Sbjct: 386 KSPPPPYVYSSPPPPYYTPSPKVVYKSPPPPYVYSSPPPPYYSP 429 Score = 27.9 bits (59), Expect = 10.0 Identities = 21/80 (26%), Positives = 26/80 (32%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPP-PXXPXXPPPPFXTPXX 550 PP P + PPP P + SPP P PPP + +P Sbjct: 122 PPPPIYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPSPYVYNSPPPSYYSP-- 179 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 180 SPKVDYKSPPPPYVYSSPPP 199 Score = 27.9 bits (59), Expect = 10.0 Identities = 22/86 (25%), Positives = 30/86 (34%), Gaps = 14/86 (16%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXG--APPXPXXRATXPSP-----PPXXPXXPPPPFXTPXX 550 P P + PPP +PP P ++ P P P PPPP+ +P Sbjct: 930 PPPPYVYSSPPPPYYSPAPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYYSPSP 989 Query: 551 X-------PPQXPTXPPPXPXFXLPR 607 PP + PPP P+ Sbjct: 990 KVDYKSPPPPYVYSSPPPPSYSPSPK 1015 Score = 27.9 bits (59), Expect = 10.0 Identities = 16/49 (32%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP--XXXRPPXP 812 + P P PPP +P+P PPPP P P PP P Sbjct: 953 KSPPPPYVYSSPPPPYYSPSPKV--DYKSPPPPYYSPSPKVDYKSPPPP 999 >At2g43800.1 68415.m05445 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 894 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP PPP P P + P S + PP AP P Sbjct: 87 PPPPPPSPPHPNPFFPSSDPTSTASHPPPAPPP 119 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 491 PSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXP 589 P PPP P P P F P P + PPP P Sbjct: 87 PPPPPPSPPHPNPFF--PSSDPTSTASHPPPAP 117 Score = 29.1 bits (62), Expect = 4.3 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXF 595 PPP A P P PSPP P P + PP P P P F Sbjct: 73 PPPHEKHLFSSVANPPPPP----PSPPHPNPFFPSSDPTSTASHPPPAPPPPASLPTF 126 >At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PLDBETA1) identical to SP|P93733 Phospholipase D beta 1 (EC 3.1.4.4) (AtPLDbeta1) (PLD beta 1) (PLDbeta) {Arabidopsis thaliana}; contains Pfam profiles: PF00614 phospholipase D.active site motif, PF00168 C2 domain Length = 1083 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +3 Query: 687 PXFCPXXPPPX-PTPTPPXX----PXXXXPPPPXXXPPPXXXRPP 806 P P PP P P PP P PPPP PPP PP Sbjct: 20 PYPAPYRPPSSEPYPPPPTNQYSAPYYPYPPPPYATPPPYASPPP 64 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +2 Query: 752 PXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXKHN 859 P PPPP PPP P + P HN Sbjct: 47 PYPPPPYATPPPYASPPPPHQHTSGSHSGPLDYSHN 82 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 33.1 bits (72), Expect = 0.26 Identities = 33/145 (22%), Positives = 35/145 (24%), Gaps = 6/145 (4%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-----XXPPP 529 KK P P P+ P P P + P PPP P P Sbjct: 529 KKASPQCPQSPTPVHSNGPPSAEAAVTSSPLPPLKPLRILSRPPPPPPPPPISSLRSTPS 588 Query: 530 PFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXG-XGGLXXXXXXXXXXRXXPXPSXFLXXX 706 P T Q P PPP P R P P L Sbjct: 589 PSSTSNSIATQGPPPPPPPPPLQSHRSALSSSPLPPPLPPKKLLATTNPPPPPPPPLHSN 648 Query: 707 XXXXXXXXXXXXXXPPXPPPPXXXP 781 PP PPPP P Sbjct: 649 SRMGAPTSSLVLKSPPVPPPPAPAP 673 >At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to glycine-rich protein; atGRP (GI:259447) [Arabidopsis thaliana] Length = 145 Score = 33.1 bits (72), Expect = 0.26 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXG---XXGGVGVGXGGGXXGQKXG 686 G +G GG GGG GGGG G GG G GGG Q G Sbjct: 56 GYQGGGGNYQGGGGNYQGGGGNYQGGGGRYQGGGGRYQGGGGRYQGGG 103 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGG 710 G +G GGR GGG GGGG G G G GG Sbjct: 73 GGGGNYQGGGGRYQGGGGRYQGGGGRYQGGGGRQGGGGSGG 113 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXG---XXGGVGVGXGGGXXG 698 G +G GG GGG GGGG G GG G GGG G Sbjct: 66 GGGGNYQGGGGNYQGGGGRYQGGGGRYQGGGGRYQGGGGRQGGGGSGG 113 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G +G GG GGG GGGG G GG G GG G Sbjct: 59 GGGGNYQGGGGNYQGGGGNYQGGGGRYQGG--GGRYQGGGGRYQG 101 Score = 30.3 bits (65), Expect = 1.9 Identities = 25/72 (34%), Positives = 27/72 (37%) Frame = -2 Query: 582 GGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPPKR 403 GGG G GG G GGG G G +G R G GG GGG Sbjct: 54 GGGYQGG-GGNYQG---GGGNYQGGGGNYQGGGGRYQGGGG------RYQGGGGRYQGGG 103 Query: 402 GXXGXGRXGGFF 367 G G G GG + Sbjct: 104 GRQGGGGSGGSY 115 >At1g77030.1 68414.m08970 glycine-rich protein Length = 349 Score = 33.1 bits (72), Expect = 0.26 Identities = 25/75 (33%), Positives = 26/75 (34%), Gaps = 1/75 (1%) Frame = -2 Query: 594 KXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXX 415 K G GG G GG G +GG G GGG GG GG Sbjct: 203 KRGGRGGRGGARGGRGGGA-RGGRGGSRDFGGGGRDFGSSSDRGGRSGGRDFGGRRGGAS 261 Query: 414 PPKR-GXXGXGRXGG 373 R G G GR GG Sbjct: 262 TSSRGGKRGGGRGGG 276 Score = 29.1 bits (62), Expect = 4.3 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G RG G R GG GGGG G G GG G + G Sbjct: 211 GGARGGRGGGARGGRGGSRDFGGGG-RDFGSSSDRGGRSGGRDFGGRRG 258 >At1g65440.1 68414.m07424 glycine-rich protein Length = 1647 Score = 33.1 bits (72), Expect = 0.26 Identities = 24/81 (29%), Positives = 26/81 (32%), Gaps = 4/81 (4%) Frame = -2 Query: 603 GRXKXGXGGGXVGXWGGXXXGVXKGG---GGXXGXXGGGEGXVARXXGXG-GAPXPXXXX 436 G G G G WG G GG GG GG + A G G G Sbjct: 1517 GTADGGWGNSGGGGWGSESAGKKTGGGSTGGWGSESGGNKSDGAGSWGSGSGGGGSGGWG 1576 Query: 435 XXGGGXXPPKRGXXGXGRXGG 373 GG + G G G GG Sbjct: 1577 NDSGGKKSSEDGGFGSGSGGG 1597 Score = 31.9 bits (69), Expect = 0.61 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEG 490 G G G GGG G WG G G G GG G Sbjct: 1559 GAGSWGSGSGGGGSGGWGNDSGGKKSSEDGGFGSGSGGGG 1598 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 33.1 bits (72), Expect = 0.26 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -2 Query: 582 GGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGG 421 GGG VG GG G GGG G GG G A G GG G G Sbjct: 96 GGGDVGGGGGGYGGGTPGGG---GGGGGDTGAGAGGGGYGGGGDTGAGGGVGSG 146 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -1 Query: 805 GGRXXXGGGXXXGGGGXXXXGXXGG-VGVGXGGGXXG 698 GG GGG GGG G GG G G GGG G Sbjct: 96 GGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYG 132 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -2 Query: 618 PXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEG 490 P G G GG G +GG G GGGG G GG G Sbjct: 88 PLYGTTPPGGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGG 130 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G GG GG GGGG G G G GGG G G Sbjct: 98 GDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGGG 142 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGG-GEG 490 G G G GGG G G G GGGG G GG G G Sbjct: 106 GYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGGGVGSG 146 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 802 GRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G GGG GGGG G GG G G G G G Sbjct: 91 GTTPPGGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGG 129 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = -2 Query: 633 PPXPXPXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXG 463 PP G G G GGG G GG G GG G GGG+ G G Sbjct: 94 PPGGGDVGGGG---GGYGGGTPGGGGGGGGDTGAGAGGG-GYGGGGDTGAGGGVGSG 146 Score = 29.1 bits (62), Expect = 4.3 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXG-GGXXXGGGGXXXXGXXGGVGVG 719 G + G G G GG G GG GGGG G GGVG G Sbjct: 105 GGYGGGTPGGGGGGGGDTGAGAGGGGYGGGG--DTGAGGGVGSG 146 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G+ G G GG GGG G G G G G G G G Sbjct: 106 GYGGGTPGGGG---GGGGDTGAGAGGGGYGGGGDTGAGGGVG 144 >At5g49080.1 68418.m06074 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 609 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/49 (36%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ TP P PPP + P P Sbjct: 64 PSPKVNYKSP-PPPYVYSSPPPPYYTP--SPKVDYKSPPPPYEYSSPPP 109 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 132 PPLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSP-- 189 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 190 SPKVDYKSPPPPYVYSSPPP 209 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 157 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 214 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 215 SPKVDYKSPPPPYVYSSPPP 234 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 182 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 239 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 240 TPKVDYKSPPPPYVYSSPPP 259 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 282 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 339 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 340 SPKVDYKSPPPPYVYSSPPP 359 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 307 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 364 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 365 TPKVDYKSPPPPYVYSSPPP 384 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 332 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSP-- 389 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 390 SPKVDYKSPPPPYVYSSPPP 409 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 357 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 414 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 415 SPKVDYKSPPPPYVYSSPPP 434 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 382 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 439 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 440 SPKVDYKSPPPPYVYNSPPP 459 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 407 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSP-- 464 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 465 SPKVDYKSPPPPYVYSSPPP 484 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 432 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 489 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 490 SPKVDYKSPPPPYVYSSPPP 509 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 457 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 514 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 515 SPKVDYKSPPPPYVYSSPPP 534 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 482 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 539 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 540 SPKVDYKSPPPPYVYNSPPP 559 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 507 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSP-- 564 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 565 SPKVDYKSPPPPYVYSSPPP 584 Score = 31.1 bits (67), Expect = 1.1 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 107 PPPPYYSPSPKIDYKSPPPPYVYSSPPLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 164 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 165 TPKVDYKSPPPPYVYSSPPP 184 Score = 31.1 bits (67), Expect = 1.1 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPP-PXXPXXPPPPFXTPXX 550 PP P + PPP P + SPP P PPPP+ +P Sbjct: 232 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPLPYVYSSPPPPYYSP-- 289 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 290 SPKVDYKSPPPPYVYSSPPP 309 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/73 (27%), Positives = 25/73 (34%), Gaps = 1/73 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 57 PPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYTPSPKVDYKSPPPPYEYSSPPPPYYSP-- 114 Query: 551 XPPQXPTXPPPXP 589 P+ PP P Sbjct: 115 -SPKIDYKSPPPP 126 Score = 29.9 bits (64), Expect = 2.5 Identities = 22/85 (25%), Positives = 27/85 (31%), Gaps = 6/85 (7%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTP-- 544 PP P + PPP P + SPPP PPPP+ +P Sbjct: 207 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSP 266 Query: 545 ---XXXPPQXPTXPPPXPXFXLPRP 610 PP P P + P P Sbjct: 267 KVDYKSPPLPYVYSSPPPPYYSPSP 291 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRP 803 + P LP PPP +P+P PP PPP P Sbjct: 271 KSPPLPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 314 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRP 803 + P P PPP TP+P PP PPP P Sbjct: 71 KSPPPPYVYSSPPPPYYTPSPKVDYKSPPPPYEYSSPPPPYYSP 114 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP--XXXRPPXP 812 P LP + P +P PP PPPP P P PP P Sbjct: 132 PPLPYYSPSPKVDYKSPPPPY--VYSSPPPPYYSPTPKVDYKSPPPP 176 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRP 803 + P P PPP +PTP PP PPP P Sbjct: 146 KSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSP 189 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRP 803 + P P PPP +PTP PP PPP P Sbjct: 221 KSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSP 264 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRP 803 + P P PPP +PTP PP PPP P Sbjct: 346 KSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSP 389 Score = 27.9 bits (59), Expect = 10.0 Identities = 18/70 (25%), Positives = 22/70 (31%), Gaps = 1/70 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 532 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 591 Query: 551 XPPQXPTXPP 580 PP Sbjct: 592 KVTYKSLPPP 601 >At5g35190.1 68418.m04170 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 328 Score = 32.7 bits (71), Expect = 0.35 Identities = 25/88 (28%), Positives = 31/88 (35%), Gaps = 15/88 (17%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXG--APPXPXXRATXPSPPPXXPXX-------PPPPFXTP 544 P P + PPP +PP P ++ P PP P PPPP+ +P Sbjct: 223 PPPPYVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPEVSYKSPPPPPYYSP 282 Query: 545 XXX------PPQXPTXPPPXPXFXLPRP 610 PP PP P F P P Sbjct: 283 SLEVSYKSPPPLFVYNFPPPPPFYSPSP 310 Score = 31.9 bits (69), Expect = 0.61 Identities = 25/82 (30%), Positives = 30/82 (36%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTP 544 ++ P P P P L PPP P P P PPP PPPP+ +P Sbjct: 65 RQGPKYTPHPK-PYLFNSPPPPYYS--------PSPKEDYKSP-PPPYVYNSPPPPYYSP 114 Query: 545 XXXPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 115 --SPKVDYKSPPPPYVYNSPPP 134 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 6/55 (10%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTP------XXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P PP PP P + P P Sbjct: 214 PSPKVDYKSP-PPPYVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPPPPPYYSPSP 267 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 114 PSPKVDYKSP-PPPYVYNSPPPPYYSP--SPKVEYKSPPPPYVYNSPPP 159 Score = 29.5 bits (63), Expect = 3.3 Identities = 34/157 (21%), Positives = 41/157 (26%), Gaps = 7/157 (4%) Frame = +2 Query: 392 PXXPLLGGXXPPPXXXXXXGXG--APPXPXXRATXPSP-----PPXXPXXPPPPFXTPXX 550 P P + PPP +PP P + P P P PPPP+ Sbjct: 123 PPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSLSPKVDYKSPPPPYVYNSP 182 Query: 551 XPPQXPTXPPPXPXFXLPRPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXX 730 PP P F P P + P P + Sbjct: 183 PPPYYSPSPKVDYKFS-PPPYVYNSPSPPYYSPSPKVDYKSPPPPYVYNSPPPPYFSPSP 241 Query: 731 XXXXXXPPXPPPPXXXPPPXPXXAXPXSXSXXPPGAP 841 PP PP PPP P + S P P Sbjct: 242 KVDYKSPP-PPYVYSSPPPPPYYSPSPEVSYKSPPPP 277 Score = 28.7 bits (61), Expect = 5.7 Identities = 23/84 (27%), Positives = 29/84 (34%), Gaps = 5/84 (5%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXP-----SPPPXXPXXPPPPFX 538 PP P + PPP +PP P + SPPP P PP+ Sbjct: 157 PPPPYYSLSPKVDYKSPPPPYVY----NSPPPPYYSPSPKVDYKFSPPPYVYNSPSPPYY 212 Query: 539 TPXXXPPQXPTXPPPXPXFXLPRP 610 +P P PPP + P P Sbjct: 213 SP--SPKVDYKSPPPPYVYNSPPP 234 Score = 28.3 bits (60), Expect = 7.5 Identities = 18/73 (24%), Positives = 21/73 (28%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTP 544 K + P P PP G P P PPP P + +P Sbjct: 39 KHESSYSPKKYSPYYSASPLPPLQYRRQGPKYTPHPKPYLFNSPPPPYYSPSPKEDYKSP 98 Query: 545 XXXPPQXPTXPPP 583 PP PPP Sbjct: 99 --PPPYVYNSPPP 109 Score = 27.9 bits (59), Expect = 10.0 Identities = 14/47 (29%), Positives = 17/47 (36%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 + P P PPP +P+P PP PPP P P Sbjct: 221 KSPPPPYVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPPPPPYYSPSP 267 Score = 27.9 bits (59), Expect = 10.0 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P F P +P PP PPPP P P P P P Sbjct: 232 PPPPYFSPSPKVDYKSPPPPYVYS-SPPPPPYYSPSPEVSYKSPPPPPYYSP 282 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 PPP P +PP P PPPP R P P + GR P Sbjct: 37 PPPPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPPSKY-GRVYP 82 Score = 31.9 bits (69), Expect = 0.61 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 521 PPPPFXTPXXXPPQXPTXPPP 583 PPPP +P PP P PPP Sbjct: 38 PPPPVYSPPISPPPPPPPPPP 58 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/54 (33%), Positives = 20/54 (37%) Frame = +2 Query: 458 APPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXG 619 +PP P + SPPP P PPPP P PP P P G Sbjct: 36 SPPPPPVYSPPISPPPPPP--PPPPQSHAAAYKRYSPPPPPSKYGRVYPPPPPG 87 Score = 27.9 bits (59), Expect = 10.0 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXR--PPXP 812 P P PPP P P PPP PP R PP P Sbjct: 45 PPISPPPPPPPPPPQSHAAAYKRYSPPP---PPSKYGRVYPPPP 85 >At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containing protein similar to Hsc70-interacting protein (Hip) from {Homo sapiens} SP|P50502, {Rattus norvegicus} SP|P50503; contains Pfam profile PF00515: tetratricopeptide repeat (TPR) domain Length = 441 Score = 32.7 bits (71), Expect = 0.35 Identities = 19/56 (33%), Positives = 21/56 (37%) Frame = -1 Query: 853 FXGXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 F G G+ G G G G G G G G GG+ G GGG G G Sbjct: 301 FPGGMPGGFPGGMGGMPGGFPGGMGGMGGMPGGFPGGMGGGMPAGMGGGMPGMGGG 356 Score = 31.1 bits (67), Expect = 1.1 Identities = 30/93 (32%), Positives = 31/93 (33%), Gaps = 4/93 (4%) Frame = -2 Query: 630 PXPXPXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPX 451 P P G G GG G GG G+ G GG G GG G GG P Sbjct: 294 PGGMPGGFPGGMPGGFPGGMGGMPGGFPGGMG-GMGGMPGGFPGGMGGGMPAGMGGGMPG 352 Query: 450 PXXXXXXG-GGXXPPKRG---XXGXGRXGGFFF 364 G GG P G G G GG F Sbjct: 353 MGGGMPAGMGGGGMPGAGGGMPGGGGMPGGMDF 385 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 835 PGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 PG G G G GGG G GG G GG G GGG G Sbjct: 331 PGGFPGGMGGGMPAGMGGGMP-GMGGGMPAGMGGGGMPGAGGGMPG 375 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 32.7 bits (71), Expect = 0.35 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPP 770 P P P PP P+P PP PPPP Sbjct: 40 PCQPNPSPPPPPSNPSPPPPSPTTTACPPPP 70 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +2 Query: 491 PSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLP 604 P PPP P PPPP T PP P+ P + P Sbjct: 47 PPPPPSNP-SPPPPSPTTTACPP-PPSSSGGGPYYYYP 82 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/51 (33%), Positives = 19/51 (37%) Frame = +3 Query: 696 CPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 C P P+P PP P PPPP P PP P P + P Sbjct: 37 CDNPCQPNPSPPPP--PSNPSPPPP---SPTTTACPPPPSSSGGGPYYYYP 82 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +2 Query: 458 APPXPXXRATXPSPPPXXPXXPPPP 532 +PP P + P P P PPPP Sbjct: 46 SPPPPPSNPSPPPPSPTTTACPPPP 70 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 503 PXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXGXGG 634 P P PPP PP P+ PPP P P GG Sbjct: 40 PCQPNPSPPP-------PPSNPSPPPPSPTTTACPPPPSSSGGG 76 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 32.7 bits (71), Expect = 0.35 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 2/68 (2%) Frame = +2 Query: 413 GXXPPPXXXXXXGXGAP-PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXP 589 G P P GA P P PSPP PPP PP P P P Sbjct: 425 GRSPSPVARLRDPTGARLPSPSIEQRLPSPPVAQRLPSPPPRRAGLPSPPPAQRLPSPPP 484 Query: 590 -XFXLPRP 610 LP P Sbjct: 485 RRAGLPSP 492 >At2g16630.1 68415.m01909 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 359 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +3 Query: 687 PXFCPXXPPPX-PTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P PPP P PP P P P P P PP P P P Sbjct: 151 PPTAPVMPPPQVPVMPPPQVPVKPHPKVPVISPDPPATLPP-PKVPVISP 199 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 500 PPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 PP P PPP P PPQ P P P P P Sbjct: 151 PPTAPVMPPPQ--VPVMPPPQVPVKPHPKVPVISPDP 185 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 1/62 (1%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPP-XPXFX 598 PPP P P + SP P P PPP P P T PPP P Sbjct: 158 PPPQVPVMPPPQVPVKPHPKVPVISPDP--PATLPPP-KVPVISPDPPTTLPPPLVPVIN 214 Query: 599 LP 604 LP Sbjct: 215 LP 216 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P +P P P P P P PP PP PP P Sbjct: 192 PKVPVISPDPPTTLPPPLVPVINLPPVTSPPQFKLPPLPQIPPMP 236 Score = 28.3 bits (60), Expect = 7.5 Identities = 19/61 (31%), Positives = 20/61 (32%), Gaps = 4/61 (6%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXX----RPPXPLXPXXHPGRHXPXN 854 P P PPP P P PP PPP PP L P P + P Sbjct: 159 PPQVPVMPPPQVPVKPHPKVPVISPDPPATLPPPKVPVISPDPPTTLPPPLVPVINLPPV 218 Query: 855 T 857 T Sbjct: 219 T 219 Score = 27.9 bits (59), Expect = 10.0 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 693 FCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 FCP PP P PP P P P P P P Sbjct: 147 FCPK-PPTAPVMPPPQVPVMPPPQVPVKPHPKVPVISPDP 185 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P P P PP P PP PPP P L P P Sbjct: 179 PVISPDPPATLPPPKVPVISPDPPTTLPPPLV--PVINLPPVTSP 221 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = +3 Query: 699 PXXP-PPXPTPTPPXXPXXXXPPPPXXXPP--PXXXRPPXPLXP 821 P P PP P T P PPPP PP RPP P P Sbjct: 198 PLPPLPPLPPTTGLTLPHSPFPPPPPGPPPKEQDFVRPPLPPPP 241 Score = 31.5 bits (68), Expect = 0.81 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 9/80 (11%) Frame = +2 Query: 422 PPPXXXXXXGXGA-------PPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPP 580 PPP G A PP P T P P PPPP P P PP Sbjct: 180 PPPLPPLPDGDNALSASLPLPPLPPLPPTTGLTLPHSPFPPPPPGPPPKEQDFVRPPLPP 239 Query: 581 P--XPXFXLPRPXXGXGXGG 634 P P P P G G Sbjct: 240 PPQLPQSSQPPPPGLSGSQG 259 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +2 Query: 470 PXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXP 589 P P PPP PP P P+ P PPP P Sbjct: 349 PPGMLRFPPPPPPLDMHPPHPGMFVGHLIPRPPYGPPPGP 388 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 PPP P P PP PP P P +PP P Sbjct: 219 PPPPPGP-PPKEQDFVRPPLPPPPQLPQSSQPPPP 252 Score = 29.5 bits (63), Expect = 3.3 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 6/51 (11%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXX----PPPPXXXP--PPXXXRPPXPLXP 821 P PPP P P P P PP P PP RPP P P Sbjct: 350 PGMLRFPPPPPPLDMHPPHPGMFVGHLIPRPPYGPPPGPPPMMRPPLPPGP 400 >At5g52470.1 68418.m06510 fibrillarin 1 (FBR1) (FIB1) (SKIP7) identical to fibrillarin 1 GI:9965653 from [Arabidopsis thaliana]; C-terminus identical to SKP1 interacting partner 7 GI:10716959 from [Arabidopsis thaliana]; contains Pfam domain PF01269: Fibrillarin Length = 308 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/54 (35%), Positives = 21/54 (38%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G +R G G RG+GG GGG G G G G GG G G Sbjct: 12 GGFRGGRDGGGRGFGGGRSFGGGRSGDRGRSGPRGRGRGAPRGRGGPPRGGMKG 65 Score = 29.1 bits (62), Expect = 4.3 Identities = 22/62 (35%), Positives = 24/62 (38%), Gaps = 1/62 (1%) Frame = -2 Query: 636 RPPXPXPXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGG-GXXGXXGGGEGXVARXXGXGG 460 RPP G G + G GG G GG G + G G G G G G G GG Sbjct: 2 RPPVTGGRGGGG-FRGGRDGGGRGFGGGRSFGGGRSGDRGRSGPRGRGRG---APRGRGG 57 Query: 459 AP 454 P Sbjct: 58 PP 59 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 32.3 bits (70), Expect = 0.46 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPP 770 PP P+P PP P PPPP Sbjct: 50 PPPPSPPPPSTPTTACPPPP 69 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPF 535 P P G PPP G P P P+PPP P P PF Sbjct: 83 PPPSQSGGGSKYPPPYGGGGQGYYYP--PPYSGNYPTPPPPNPIVPYFPF 130 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 494 SPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXG 625 SPPP P PPP T PP P + P P G Sbjct: 49 SPPPPSP--PPPSTPTTACPPPPSPPSSGGGSSYYYPPPSQSGG 90 Score = 27.9 bits (59), Expect = 10.0 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +3 Query: 735 PXXPXXXXPPPPXXXPP--PXXXRPPXPLXP 821 P P PPPP PP P PP P P Sbjct: 42 PCSPVQSSPPPPSPPPPSTPTTACPPPPSPP 72 >At5g06630.1 68418.m00749 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 440 Score = 32.3 bits (70), Expect = 0.46 Identities = 25/81 (30%), Positives = 29/81 (35%) Frame = +2 Query: 368 KKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPX 547 K P P P P + PPP P P P PPP PPPP+ +P Sbjct: 47 KGPKYAPHPK-PYVYSSPPPPYYT--------PSPKVNYKSP-PPPYVYNSPPPPYYSP- 95 Query: 548 XXPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 96 -SPKVYYKSPPPPYVYSSPPP 115 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 63 PPPPYYTPSPKVNYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP-- 120 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 121 SPKVYYKSPPPPYVYSSPPP 140 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 370 PSPKVHYKSP-PPPYVYSSPPPPYYSP--SPKVHYKSPPPPYVYSSPPP 415 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 145 PSPKVYYKSP-PPPYVYSSPPPPYYSP--SPKVYYKSPPPPYVYSSPPP 190 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 170 PSPKVYYKSP-PPPYVYSSPPPPYYSP--SPKVYYKSPPPPYVYSSPPP 215 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 195 PSPKVYYKSP-PPPYVYSSPPPPYYSP--SPKVYYKSPPPPYVYSSPPP 240 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 220 PSPKVYYKSP-PPPYVYSSPPPPYYSP--SPKVYYKSPPPPYVYSSPPP 265 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 245 PSPKVYYKSP-PPPYVYSSPPPPYYSP--SPKVYYKSPPPPYVYSSPPP 290 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 270 PSPKVYYKSP-PPPYVYSSPPPPYYSP--SPKVYYKSPPPPYVYSSPPP 315 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 295 PSPKVYYKSP-PPPYVYSSPPPPYYSP--SPKVYYKSPPPPYVYSSPPP 340 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 345 PSPNVYYKSP-PPPYVYSSPPPPYYSP--SPKVHYKSPPPPYVYSSPPP 390 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 320 PSPKVYYKSP-PPPYVYSSPPPPYYSP--SPNVYYKSPPPPYVYSSPPP 365 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/47 (34%), Positives = 19/47 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLP 604 P P P PPP PPPP+ +P P PPP + P Sbjct: 395 PSPKVHYKSP-PPPYVYSSPPPPYYSP--SPKVTYKSPPPPYVYKTP 438 >At4g32640.1 68417.m04646 sec23/sec24 transport protein-related Length = 1069 Score = 32.3 bits (70), Expect = 0.46 Identities = 27/93 (29%), Positives = 29/93 (31%), Gaps = 7/93 (7%) Frame = +2 Query: 368 KKPPXRPX--PXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPP--XXPXXPPP-- 529 + PP P P P G P P GAP + P PP P PPP Sbjct: 45 RPPPMMPGSGPRPPPPFGQSPQPFPQQSPSYGAPQRGPSPMSRPGPPAGMARPGGPPPVS 104 Query: 530 -PFXTPXXXPPQXPTXPPPXPXFXLPRPXXGXG 625 P P PT PP RP G Sbjct: 105 QPAGFQSNVPLNRPTGPPSRQPSFGSRPSMPGG 137 >At4g14750.1 68417.m02270 calmodulin-binding family protein contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 387 Score = 32.3 bits (70), Expect = 0.46 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 455 GAPPXPXXRATXPSPPPXXPXXPPPPFXTP 544 G PP SPPP P PPPP P Sbjct: 53 GPPPPACAITLKDSPPPPPPPPPPPPLQQP 82 Score = 27.9 bits (59), Expect = 10.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 415 GXPPPXXXXXLGXGXPPXPPXXXXXPLXPP 504 G PPP L PP PP PL P Sbjct: 53 GPPPPACAITLKDSPPPPPPPPPPPPLQQP 82 >At3g54590.1 68416.m06040 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 743 Score = 32.3 bits (70), Expect = 0.46 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 80 PPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSP-- 137 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 138 SPKVDYKSPPPPYVYSSPPP 157 Score = 32.3 bits (70), Expect = 0.46 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 330 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 387 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 388 SPKVEYKSPPPPYVYSSPPP 407 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 6/56 (10%) Frame = +2 Query: 461 PPXPXXRATXPS------PPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 PP P + P PPP PPPP+ +P P+ PP P + P P Sbjct: 671 PPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP---SPKVYYKSPPPPSYYSPSP 723 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 105 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 162 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 163 SPKVEYKSPPPPYVYSSPPP 182 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 130 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSP-- 187 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 188 SPKVDYKSPPPPYVYSSPPP 207 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 180 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSP-- 237 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 238 SPKVDYKSPPPPYVYSSPPP 257 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 230 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 287 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 288 SPKVDYKSPPPPYVYSSPPP 307 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 255 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 312 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 313 SPKVDYKSPPPPYVYSSPPP 332 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 280 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 337 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 338 SPKVDYKSPPPPYVYSSPPP 357 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 380 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSP-- 437 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 438 SPKVYYKSPPPPYVYSSPPP 457 Score = 31.1 bits (67), Expect = 1.1 Identities = 23/80 (28%), Positives = 28/80 (35%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P P + PPP P + SPPP PPPP+ +P Sbjct: 56 PPPTYTPA-PEVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 112 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 113 SPKVDYKSPPPPYVYNSPPP 132 Score = 31.1 bits (67), Expect = 1.1 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 155 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 212 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 213 SPKVEYKSPPPPYVYSSPPP 232 Score = 31.1 bits (67), Expect = 1.1 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 205 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP-- 262 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 263 SPKVDYKSPPPPYVYSSPPP 282 Score = 31.1 bits (67), Expect = 1.1 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 405 PPPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP-- 462 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 463 SPKVYYKSPPPPYVYSSPPP 482 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 537 PSPKVHYKSP-PPPYVYSSPPPPYYSP--SPKVHYKSPPPPYVYNSPPP 582 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 562 PSPKVHYKSP-PPPYVYNSPPPPYYSP--SPKVYYKSPPPPYVYSSPPP 607 Score = 30.7 bits (66), Expect = 1.4 Identities = 22/80 (27%), Positives = 27/80 (33%), Gaps = 1/80 (1%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXP-XXPPPPFXTPXX 550 PP P + PPP P + SPPP PPPP+ +P Sbjct: 555 PPPPYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP-- 612 Query: 551 XPPQXPTXPPPXPXFXLPRP 610 P PPP + P P Sbjct: 613 SPKVYYKSPPPPYVYSSPPP 632 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 462 PSPKVYYKSP-PPPYVYSSPPPPYYSP--SPKVYYKSPPPPYVYSSPPP 507 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 487 PSPKVYYKSP-PPPYVYSSPPPPYYSP--SPKVYYKSPPPPYVYSSPPP 532 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P PPP + P P Sbjct: 512 PSPKVYYKSP-PPPYVYSSPPPPYYSP--SPKVHYKSPPPPYVYSSPPP 557 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRP 803 + P LP + PPP TP P PP PPP P Sbjct: 45 KTPPLP-YVDSSPPPTYTPAPEVEYKSPPPPYVYSSPPPPTYSP 87 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPP--XXXPPPXXXRP 803 + P P C PPP P +P PPPP PPP P Sbjct: 660 KSPPHPHVCVC-PPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 704 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/49 (34%), Positives = 21/49 (42%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P P P PPP PPPP+ +P P+ PP P + P P Sbjct: 612 PSPKVYYKSP-PPPYVYSSPPPPYYSP---SPKVYYKSPPPPYYS-PSP 655 Score = 27.9 bits (59), Expect = 10.0 Identities = 16/49 (32%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +3 Query: 672 RXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP--XXXRPPXP 812 + P P PPP +P+P PPPP P P PP P Sbjct: 619 KSPPPPYVYSSPPPPYYSPSPKV--YYKSPPPPYYSPSPKVYYKSPPHP 665 >At2g34870.1 68415.m04281 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 116 Score = 32.3 bits (70), Expect = 0.46 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +3 Query: 669 GRXPXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP 788 G P LP P P P P+ P P PP P PPP Sbjct: 77 GNIPRLPFPFPFPTSP-PAPSLPGFPGFTFPPLPFLTPPP 115 Score = 27.9 bits (59), Expect = 10.0 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = +2 Query: 386 PXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQX 565 P P GG P P P R P P P P P P PP Sbjct: 50 PFPPGLPFGGVPPLPSLFPPFVPSPFPGNIPRLPFPFPFPTSPPAPSLPGFPGFTFPPLP 109 Query: 566 PTXPPP 583 PPP Sbjct: 110 FLTPPP 115 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXP 568 PP P +A P PPP PPPP P P Sbjct: 233 PPPPPHQAQPPPPPPSGLFPPPPPPMANNGFRPMPP 268 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 449 GXGAPPXPXXRATXPSPPPXXPXXPPPP 532 G PP P P PPP PPPP Sbjct: 228 GLPPPPPPPPHQAQPPPPPPSGLFPPPP 255 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P PPP PP P PPP RP P HP Sbjct: 231 PPPPPPPHQAQPPPPPPSGLFPPPPPPMANNGFRPMPPAGGFGHP 275 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P P P PP PPP +PP P Sbjct: 212 PTKPEPNKPQSAVGANGLPPPPPPPPHQAQPPPP 245 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 512 PXXPPPPFXTPXXXPPQXPTXPPPXP 589 P PPPP PP PPP P Sbjct: 231 PPPPPPPHQAQPPPPPPSGLFPPPPP 256 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 491 PSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXP 589 P PPP PPPP PP PPP P Sbjct: 232 PPPPPPHQAQPPPP-------PPSGLFPPPPPP 257 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPG 835 PP PPP PPP P A P G Sbjct: 242 PPPPPPSGLFPPPPPPMANNGFRPMPPAG 270 >At1g76930.2 68414.m08956 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 256 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = +3 Query: 693 FCPXXPPPXPTPTPPXXPXXXXPPPPXXX--PPPXXXRPPXPL 815 F PPP +PP P PPPP PPP PP P+ Sbjct: 26 FYSSPPPPVKHYSPP--PVYKSPPPPVKHYSPPPVYKSPPPPV 66 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXX--PPPXXXRPPXPLXPXXHP 833 PPP +PP P PPPP PPP PP P+ P Sbjct: 63 PPPVKHYSPP--PVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPP 104 Score = 31.9 bits (69), Expect = 0.61 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXX--PPPXXXRPPXPL 815 PPP +PP P PPPP PPP PP P+ Sbjct: 47 PPPVKHYSPP--PVYKSPPPPVKHYSPPPVYKSPPPPV 82 Score = 31.9 bits (69), Expect = 0.61 Identities = 25/81 (30%), Positives = 30/81 (37%), Gaps = 4/81 (4%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXP----SPPPXXPXXPPPPFXT 541 PP P P+ PPP +PP P + P SPPP PPPP Sbjct: 56 PPVYKSPPPPVKH-YSPPPVYK------SPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKH 108 Query: 542 PXXXPPQXPTXPPPXPXFXLP 604 PP + PPP + P Sbjct: 109 -YSPPPVYKSPPPPVKHYSPP 128 Score = 31.9 bits (69), Expect = 0.61 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXX--PPPXXXRPPXPL 815 PPP +PP P PPPP PPP PP P+ Sbjct: 103 PPPVKHYSPP--PVYKSPPPPVKHYSPPPVYKSPPPPV 138 Score = 31.9 bits (69), Expect = 0.61 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXX--PPPXXXRPPXPL 815 PPP +PP P PPPP PPP PP P+ Sbjct: 119 PPPVKHYSPP--PVYKSPPPPVKHYSPPPVYKSPPPPV 154 Score = 31.5 bits (68), Expect = 0.81 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXX--PPPXXXRPPXPL 815 PPP PP P PPPP PPP PP P+ Sbjct: 87 PPPVYKSPPP--PVYKSPPPPVKHYSPPPVYKSPPPPV 122 Score = 30.7 bits (66), Expect = 1.4 Identities = 23/76 (30%), Positives = 28/76 (36%), Gaps = 6/76 (7%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGX-GAPPXPXXRATXP----SPPPXXPXXPPPP-F 535 PP P P+ PP +PP P + P SPPP PPP + Sbjct: 88 PPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVY 147 Query: 536 XTPXXXPPQXPTXPPP 583 +P PP PPP Sbjct: 148 KSP--PPPVKHYSPPP 161 Score = 30.3 bits (65), Expect = 1.9 Identities = 22/83 (26%), Positives = 29/83 (34%), Gaps = 6/83 (7%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGX-GAPPXPXXRATXP-----SPPPXXPXXPPPPF 535 PP + P+ PP +PP P ++ P SPPP PPP Sbjct: 64 PPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPP-- 121 Query: 536 XTPXXXPPQXPTXPPPXPXFXLP 604 PP + PPP + P Sbjct: 122 VKHYSPPPVYKSPPPPVKHYSPP 144 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPL 815 PPP PP PP PPP PP P+ Sbjct: 71 PPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPV 106 Score = 28.7 bits (61), Expect = 5.7 Identities = 23/76 (30%), Positives = 28/76 (36%), Gaps = 6/76 (7%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGX-GAPPXPXXRATXP----SPPPXXPXXPPPP-F 535 PP P P+ PP +PP P + P SPPP PPP + Sbjct: 72 PPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVY 131 Query: 536 XTPXXXPPQXPTXPPP 583 +P PP PPP Sbjct: 132 KSP--PPPVKHYSPPP 145 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPP--XXXPPPXXXRPPXPLXPXXHP 833 PPP +PP P PPPP PPP P P+ P Sbjct: 79 PPPVKYYSPP--PVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPP 120 Score = 28.3 bits (60), Expect = 7.5 Identities = 19/61 (31%), Positives = 24/61 (39%), Gaps = 10/61 (16%) Frame = +2 Query: 458 APPXPXXRATXP----SPPPXXPXXPPPP-FXTP-----XXXPPQXPTXPPPXPXFXLPR 607 +PP P + P SPPP PPP + +P PP PPP + P Sbjct: 29 SPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPP 88 Query: 608 P 610 P Sbjct: 89 P 89 >At1g76930.1 68414.m08955 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 293 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = +3 Query: 693 FCPXXPPPXPTPTPPXXPXXXXPPPPXXX--PPPXXXRPPXPL 815 F PPP +PP P PPPP PPP PP P+ Sbjct: 26 FYSSPPPPVKHYSPP--PVYKSPPPPVKHYSPPPVYKSPPPPV 66 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXX--PPPXXXRPPXPLXPXXHP 833 PPP +PP P PPPP PPP PP P+ P Sbjct: 63 PPPVKHYSPP--PVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPP 104 Score = 31.9 bits (69), Expect = 0.61 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXX--PPPXXXRPPXPL 815 PPP +PP P PPPP PPP PP P+ Sbjct: 47 PPPVKHYSPP--PVYKSPPPPVKHYSPPPVYKSPPPPV 82 Score = 31.9 bits (69), Expect = 0.61 Identities = 25/81 (30%), Positives = 30/81 (37%), Gaps = 4/81 (4%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXP----SPPPXXPXXPPPPFXT 541 PP P P+ PPP +PP P + P SPPP PPPP Sbjct: 56 PPVYKSPPPPVKH-YSPPPVYK------SPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKH 108 Query: 542 PXXXPPQXPTXPPPXPXFXLP 604 PP + PPP + P Sbjct: 109 -YSPPPVYKSPPPPVKHYSPP 128 Score = 31.9 bits (69), Expect = 0.61 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXX--PPPXXXRPPXPL 815 PPP +PP P PPPP PPP PP P+ Sbjct: 103 PPPVKHYSPP--PVYKSPPPPVKHYSPPPVYKSPPPPV 138 Score = 31.9 bits (69), Expect = 0.61 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXX--PPPXXXRPPXPL 815 PPP +PP P PPPP PPP PP P+ Sbjct: 119 PPPVKHYSPP--PVYKSPPPPVKHYSPPPVYKSPPPPV 154 Score = 31.5 bits (68), Expect = 0.81 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXX--PPPXXXRPPXPL 815 PPP PP P PPPP PPP PP P+ Sbjct: 87 PPPVYKSPPP--PVYKSPPPPVKHYSPPPVYKSPPPPV 122 Score = 30.7 bits (66), Expect = 1.4 Identities = 23/76 (30%), Positives = 28/76 (36%), Gaps = 6/76 (7%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGX-GAPPXPXXRATXP----SPPPXXPXXPPPP-F 535 PP P P+ PP +PP P + P SPPP PPP + Sbjct: 88 PPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVY 147 Query: 536 XTPXXXPPQXPTXPPP 583 +P PP PPP Sbjct: 148 KSP--PPPVKHYSPPP 161 Score = 30.3 bits (65), Expect = 1.9 Identities = 22/83 (26%), Positives = 29/83 (34%), Gaps = 6/83 (7%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGX-GAPPXPXXRATXP-----SPPPXXPXXPPPPF 535 PP + P+ PP +PP P ++ P SPPP PPP Sbjct: 64 PPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPP-- 121 Query: 536 XTPXXXPPQXPTXPPPXPXFXLP 604 PP + PPP + P Sbjct: 122 VKHYSPPPVYKSPPPPVKHYSPP 144 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPL 815 PPP PP PP PPP PP P+ Sbjct: 71 PPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPV 106 Score = 28.7 bits (61), Expect = 5.7 Identities = 23/76 (30%), Positives = 28/76 (36%), Gaps = 6/76 (7%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGX-GAPPXPXXRATXP----SPPPXXPXXPPPP-F 535 PP P P+ PP +PP P + P SPPP PPP + Sbjct: 72 PPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVY 131 Query: 536 XTPXXXPPQXPTXPPP 583 +P PP PPP Sbjct: 132 KSP--PPPVKHYSPPP 145 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPP--XXXPPPXXXRPPXPLXPXXHP 833 PPP +PP P PPPP PPP P P+ P Sbjct: 79 PPPVKYYSPP--PVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPP 120 Score = 28.3 bits (60), Expect = 7.5 Identities = 19/61 (31%), Positives = 24/61 (39%), Gaps = 10/61 (16%) Frame = +2 Query: 458 APPXPXXRATXP----SPPPXXPXXPPPP-FXTP-----XXXPPQXPTXPPPXPXFXLPR 607 +PP P + P SPPP PPP + +P PP PPP + P Sbjct: 29 SPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPP 88 Query: 608 P 610 P Sbjct: 89 P 89 >At1g47660.1 68414.m05295 hypothetical protein Length = 275 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 500 PPXXPXXPPPPFXTPXXXPPQXPTXPPP 583 PP P PPP P PP PT PPP Sbjct: 30 PPARPTTPPPA--RPTTPPPVWPTTPPP 55 >At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identical to gi_3883128_gb_AAC77827 Length = 133 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +2 Query: 464 PXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXP 589 P RAT P+P P PPP T Q PT PP P Sbjct: 39 PSQSPRATAPAPSPSA--NPPPSAPTTAPPVSQPPTESPPAP 78 Score = 29.1 bits (62), Expect = 4.3 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 3/52 (5%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXP-PPPXXXPPP--XXXRPPXPLXPXXHP 833 P P P TPTP P P P P PPP PP P P Sbjct: 24 PGPAPTISPLPATPTPSQSPRATAPAPSPSANPPPSAPTTAPPVSQPPTESP 75 >At1g21310.1 68414.m02662 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 431 Score = 32.3 bits (70), Expect = 0.46 Identities = 25/88 (28%), Positives = 28/88 (31%) Frame = +2 Query: 347 KKXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP 526 KK K PP P + PPP +PP P SPPP PP Sbjct: 89 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK--SPPPPVKHY---SPPPVYHSPPP 143 Query: 527 PPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P PP P P + P P Sbjct: 144 PKKHYVYKSPPPPVKHYSPPPVYHSPPP 171 Score = 32.3 bits (70), Expect = 0.46 Identities = 25/88 (28%), Positives = 28/88 (31%) Frame = +2 Query: 347 KKXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP 526 KK K PP P + PPP +PP P SPPP PP Sbjct: 117 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK--SPPPPVKHY---SPPPVYHSPPP 171 Query: 527 PPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P PP P P + P P Sbjct: 172 PKKHYVYKSPPPPVKHYSPPPVYHSPPP 199 Score = 32.3 bits (70), Expect = 0.46 Identities = 25/88 (28%), Positives = 28/88 (31%) Frame = +2 Query: 347 KKXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP 526 KK K PP P + PPP +PP P SPPP PP Sbjct: 145 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK--SPPPPVKHY---SPPPVYHSPPP 199 Query: 527 PPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P PP P P + P P Sbjct: 200 PKKHYVYKSPPPPVKHYSPPPVYHSPPP 227 Score = 32.3 bits (70), Expect = 0.46 Identities = 25/88 (28%), Positives = 28/88 (31%) Frame = +2 Query: 347 KKXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP 526 KK K PP P + PPP +PP P SPPP PP Sbjct: 173 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK--SPPPPVKHY---SPPPVYHSPPP 227 Query: 527 PPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P PP P P + P P Sbjct: 228 PKKHYVYKSPPPPVKHYSPPPVYHSPPP 255 Score = 32.3 bits (70), Expect = 0.46 Identities = 25/88 (28%), Positives = 28/88 (31%) Frame = +2 Query: 347 KKXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP 526 KK K PP P + PPP +PP P SPPP PP Sbjct: 201 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK--SPPPPVKHY---SPPPVYHSPPP 255 Query: 527 PPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P PP P P + P P Sbjct: 256 PKKHYVYKSPPPPVKHYSPPPVYHSPPP 283 Score = 32.3 bits (70), Expect = 0.46 Identities = 25/88 (28%), Positives = 28/88 (31%) Frame = +2 Query: 347 KKXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP 526 KK K PP P + PPP +PP P SPPP PP Sbjct: 229 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK--SPPPPVKHY---SPPPVYHSPPP 283 Query: 527 PPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P PP P P + P P Sbjct: 284 PKKHYVYKSPPPPVKHYSPPPVYHSPPP 311 Score = 32.3 bits (70), Expect = 0.46 Identities = 25/88 (28%), Positives = 28/88 (31%) Frame = +2 Query: 347 KKXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP 526 KK K PP P + PPP +PP P SPPP PP Sbjct: 257 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK--SPPPPVKHY---SPPPVYHSPPP 311 Query: 527 PPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P PP P P + P P Sbjct: 312 PKKHYVYKSPPPPVKHYSPPPVYHSPPP 339 Score = 32.3 bits (70), Expect = 0.46 Identities = 25/88 (28%), Positives = 28/88 (31%) Frame = +2 Query: 347 KKXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP 526 KK K PP P + PPP +PP P SPPP PP Sbjct: 285 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK--SPPPPVKHY---SPPPVYHSPPP 339 Query: 527 PPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P PP P P + P P Sbjct: 340 PKKHYVYKSPPPPVKHYSPPPVYHSPPP 367 Score = 32.3 bits (70), Expect = 0.46 Identities = 25/88 (28%), Positives = 28/88 (31%) Frame = +2 Query: 347 KKXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP 526 KK K PP P + PPP +PP P SPPP PP Sbjct: 313 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK--SPPPPVKHY---SPPPVYHSPPP 367 Query: 527 PPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P PP P P + P P Sbjct: 368 PKKHYVYKSPPPPVKHYSPPPVYHSPPP 395 Score = 31.9 bits (69), Expect = 0.61 Identities = 25/88 (28%), Positives = 28/88 (31%) Frame = +2 Query: 347 KKXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP 526 KK K PP P + PPP +PP P SPPP PP Sbjct: 61 KKHYEYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK--SPPPPVKHY---SPPPVYHSPPP 115 Query: 527 PPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P PP P P + P P Sbjct: 116 PKKHYVYKSPPPPVKHYSPPPVYHSPPP 143 Score = 31.5 bits (68), Expect = 0.81 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 4/55 (7%) Frame = +2 Query: 458 APPXPXXRATXP----SPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 +PP P T P SPPP PPP PP P P + P P Sbjct: 33 SPPPPVKHYTPPVKHYSPPPVYHSPPPPKKHYEYKSPPPPVKHYSPPPVYHSPPP 87 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +2 Query: 458 APPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPT--XPPPXP 589 +PP P SPPP PPP P + PPP P Sbjct: 364 SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKEKYVYKSPPPPP 409 Score = 29.1 bits (62), Expect = 4.3 Identities = 21/79 (26%), Positives = 25/79 (31%) Frame = +2 Query: 374 PPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXX 553 PP + P+ PP +PP P SPPP PPP Sbjct: 43 PPVKHYSPPPVYHSPPPPKKHYEYK---SPPPPVKHY---SPPPVYHSPPPPKKHYVYKS 96 Query: 554 PPQXPTXPPPXPXFXLPRP 610 PP P P + P P Sbjct: 97 PPPPVKHYSPPPVYHSPPP 115 Score = 28.3 bits (60), Expect = 7.5 Identities = 25/90 (27%), Positives = 28/90 (31%), Gaps = 2/90 (2%) Frame = +2 Query: 347 KKXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP 526 KK K PP P + PPP +PP P SPPP PP Sbjct: 341 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK--SPPPPVKHY---SPPPVYHSPPP 395 Query: 527 PPFXTPXXXPPQXP--TXPPPXPXFXLPRP 610 P PP P PP + P Sbjct: 396 PKEKYVYKSPPPPPVHHYSPPHHPYLYKSP 425 Score = 27.9 bits (59), Expect = 10.0 Identities = 18/63 (28%), Positives = 21/63 (33%) Frame = +2 Query: 347 KKXXTXKKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPP 526 KK K PP P + PPP +PP P P P PP Sbjct: 369 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKEKYVYK--SPPPPPVHHYSPPHHPYLYKSPP 426 Query: 527 PPF 535 PP+ Sbjct: 427 PPY 429 >At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) Length = 130 Score = 31.9 bits (69), Expect = 0.61 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRP 803 PPP TP P P PPP P P P Sbjct: 34 PPPVATPPPAATPAPTTTPPPAVSPAPTSSPP 65 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 482 ATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPP 583 A P+P P PPP P P T PPP Sbjct: 21 AQAPAPSPTTTVTPPPVATPPPAATPAPTTTPPP 54 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 9/56 (16%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPP---------PXXXRPPXPLXPXXHPGRHXP 848 PPP TP P P P P PP PP P P PG P Sbjct: 40 PPPAATPAPTTTPPPAVSPAPTSSPPSSAPSPSSDAPTASPPAPEGPGVSPGELAP 95 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 714 PXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 P P+PT P PPP P P PP Sbjct: 24 PAPSPTTTVTPPPVATPPPAATPAPTTTPPP 54 >At5g22560.1 68418.m02635 hypothetical protein contains Pfam profile PF03140: Plant protein of unknown function Length = 517 Score = 31.9 bits (69), Expect = 0.61 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 PPP T TPP P PPP P P PP Sbjct: 299 PPPIETKTPPLPP----PPPTLTQPHPKPLTPP 327 Score = 27.9 bits (59), Expect = 10.0 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPP 767 P + P PPP PT T P P PPP Sbjct: 300 PPIETKTPPLPPPPPTLTQP-HPKPLTPPP 328 >At5g10550.1 68418.m01221 DNA-binding bromodomain-containing protein low similarity to kinase [Gallus gallus] GI:1370092; contains Pfam profile PF00439: Bromodomain Length = 678 Score = 31.9 bits (69), Expect = 0.61 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +2 Query: 494 SPPPXXPXXPPPPF--XTPXXXPPQXPTXPPPXP 589 S P P PPPP T PP P PPP P Sbjct: 401 SVKPLLPTLPPPPVIEITRDPSPPPSPVQPPPPP 434 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +2 Query: 461 PPXPXXRATX-PSPPPXXPXXPPPPFXTP 544 PP P T PSPPP PPPP P Sbjct: 410 PPPPVIEITRDPSPPPSPVQPPPPPSPPP 438 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 401 PLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPP 505 PLL PPP PP P PSPPP Sbjct: 404 PLLPTLPPPPVIEITRDPSPPPSPVQPPPPPSPPP 438 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 485 TXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXP 589 T P PP P P +P PP P PPP P Sbjct: 408 TLPPPPVIEITRDPSPPPSPVQPPP--PPSPPPQP 440 Score = 27.9 bits (59), Expect = 10.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP 788 P LP P PP P P PPP PPP Sbjct: 404 PLLPTLPP--PPVIEITRDPSPPPSPVQPPPPPSPPP 438 Score = 27.9 bits (59), Expect = 10.0 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +3 Query: 711 PPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPL 815 P P P PPP PPP PP P+ Sbjct: 407 PTLPPPPVIEITRDPSPPPSPVQPPPPPSPPPQPV 441 >At4g39680.1 68417.m05614 SAP domain-containing protein contains Pfam domain PF02037: SAP domain Length = 633 Score = 31.9 bits (69), Expect = 0.61 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +2 Query: 461 PPXPXXR--ATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPP 583 PP P + A S PP PPPP P + P PPP Sbjct: 544 PPQPQHQPQAQTLSRPPPTALPPPPPLAKPPHVVERLPLPPPP 586 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P T + P P PPPP PP R P P P P P Sbjct: 547 PQHQPQAQTLSRPP-PTALPPPPPLAKPPHVVERLPLPPPPPIAPEEQEP 595 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXT 541 PP PP R P PPP P PP T Sbjct: 560 PPTALPPPPPLAKPPHVVERLPLPPPPPIAPEEQEPPIVT 599 >At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibrillarin 2 GI:9965655 from [Arabidopsis thaliana] Length = 320 Score = 31.9 bits (69), Expect = 0.61 Identities = 22/66 (33%), Positives = 24/66 (36%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPP 409 G GGG G G +G GG G GGG G GG G G PP Sbjct: 7 GSGGGFSGGRGRGGYSGGRGDGGFSGGRGGG--------GRGGGRGFSDRGGRGRGRGPP 58 Query: 408 KRGXXG 391 + G G Sbjct: 59 RGGARG 64 Score = 31.9 bits (69), Expect = 0.61 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXX 430 GRGR G G G GG G GG G G G G G G P Sbjct: 15 GRGRGGYSGGRGDGGFSGGRGGGGRGGGRGFSDRGGRGRGRGPPRGGARGGRGPAGRGGM 74 Query: 429 GGG 421 GG Sbjct: 75 KGG 77 Score = 30.7 bits (66), Expect = 1.4 Identities = 26/79 (32%), Positives = 28/79 (35%) Frame = -2 Query: 618 PXXGRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXX 439 P G G G G G G GG G GG G G GGG G R G G P Sbjct: 4 PLTGSGGGFSG-GRGRGGYSGGRGDGGFSGGRGG-GGRGGGRGFSDR-GGRGRGRGPPRG 60 Query: 438 XXXGGGXXPPKRGXXGXGR 382 GG + G G + Sbjct: 61 GARGGRGPAGRGGMKGGSK 79 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = -1 Query: 853 FXGXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXG-GGXXGQKXG 686 + G G G RG GGR G GG G GG G G G G K G Sbjct: 21 YSGGRGDGGFSGGRGGGGRGGGRGFSDRGGRGRGRGPPRGGARGGRGPAGRGGMKGG 77 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 5/50 (10%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPP---PPXXXPPPXXXR--PPXPLXPXXHP 833 P PP P+P P P PP PP P PP PL P P Sbjct: 148 PSSPPSPPSPPSPSLPPSSLPPSASPPTNGTPDSETLTPPPAPLPPSLSP 197 Score = 31.5 bits (68), Expect = 0.81 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +3 Query: 699 PXXPPPXP-TPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 P PP P TP+ P PP PP PP L P P Sbjct: 128 PSSPPSTPSTPSSPPSTPSTPSSPPSPPSPPSPSLPPSSLPPSASP 173 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 491 PSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLP 604 PS PP P P P TP P P PP P LP Sbjct: 128 PSSPPSTPSTPSSPPSTP--STPSSPPSPPSPPSPSLP 163 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPP--QXPTXPPPXPXFXLPRP 610 P P + PS PP P PP P P PP PT P P P Sbjct: 138 PSSPPSTPSTPSSPPS-PPSPPSPSLPPSSLPPSASPPTNGTPDSETLTPPP 188 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/49 (36%), Positives = 21/49 (42%), Gaps = 6/49 (12%) Frame = +2 Query: 461 PPXPXXRATXPSPP-PXXPXXPP---PPFXTPXXX--PPQXPTXPPPXP 589 P P ++ PSPP P P PP PP +P P PPP P Sbjct: 142 PSTPSTPSSPPSPPSPPSPSLPPSSLPPSASPPTNGTPDSETLTPPPAP 190 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/47 (29%), Positives = 15/47 (31%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P P +PP P PP P PP P P P P Sbjct: 123 PSPSTPSSPPSTPSTPSSPPSTPSTPSSPPSPPSPPSPSLPPSSLPP 169 Score = 27.9 bits (59), Expect = 10.0 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +2 Query: 494 SPPPXXPXXPPPPFXTPXXXP--PQXPTXPPPXP 589 +P P P PP TP P P P+ PP P Sbjct: 122 APSPSTPSSPPSTPSTPSSPPSTPSTPSSPPSPP 155 >At3g16510.1 68416.m02107 C2 domain-containing protein contains similarity to shock protein SRC2 [Glycine max] gi|2055230|dbj|BAA19769 ; contains Pfam profile PF00168:C2 domain Length = 360 Score = 31.9 bits (69), Expect = 0.61 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +2 Query: 482 ATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPP 583 A P PPP PPP+ + PPQ + PPP Sbjct: 240 AVYPPPPPSASNLYPPPYYS--TSPPQHQSYPPP 271 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 5/46 (10%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXP-PP----XXXRPPXPLXP 821 P PP P PP PPP P PP RPP PL P Sbjct: 542 PLPPPARARPLPPPARARPMPPPARARPLPPPARSYDRRPPVPLYP 587 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXP-XXPPPPFXTPXXXPPQXPTXPPPXPXF 595 PP P P PPP PPP P P + PP P + Sbjct: 541 PPLPPPARARPLPPPARARPMPPPARARPLPPPARSYDRRPPVPLY 586 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = +2 Query: 449 GXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 G AP RA+ P PPP P P + PPP LP P Sbjct: 520 GSRAPSSSAKRASGSRGRRPRPPLPPPARARPLPPPARARPMPPPARARPLPPP 573 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 31.9 bits (69), Expect = 0.61 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRP 803 P PPP PTP PP PPP PP P Sbjct: 193 PPPPPPPPTPRPPRLLSSQPAPPP--TPPVSLPSP 225 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 512 PXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 P PPPP P P PPP P LP P Sbjct: 194 PPPPPPPTPRPPRLLSSQPA-PPPTPPVSLPSP 225 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 491 PSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXP 589 P PPP P PP + PP P P P Sbjct: 193 PPPPPPPPTPRPPRLLSSQPAPPPTPPVSLPSP 225 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXP 847 PP PPPP PP + P P P P Sbjct: 193 PPPPPPPPTPRPPRLLSSQPAPPPTPPVSLPSP 225 >At2g28670.1 68415.m03485 disease resistance-responsive family protein / fibroin-related contains similarity to silk fibroin heavy chain [Bombyx mori] gi|765323|gb|AAB31861; contains disease resistance response protien domain Pfam:FP03018 Length = 447 Score = 31.9 bits (69), Expect = 0.61 Identities = 21/70 (30%), Positives = 21/70 (30%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXX 430 G G G G GG G GGG G GG G GGA Sbjct: 128 GTGSALGGGPGAGSALGGGAGAGPALGGGAGAGPALGGGAGAGSALGGGGAGAGPALGGG 187 Query: 429 GGGXXPPKRG 400 G G P G Sbjct: 188 GAGAGPALGG 197 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 31.9 bits (69), Expect = 0.61 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 787 GGGXXXGGGGXXXXGXXGGVGVGXGGG 707 GGG G GG G GG G G GGG Sbjct: 63 GGGDGGGDGGGGGCGGGGGCGGGGGGG 89 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 787 GGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 GGG G GG G G G G GGG G Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGGGGG 88 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 582 GGGXVGXWGGXXXGVXKGGGGXXGXXGGG 496 GG G GG G GGGG G GGG Sbjct: 60 GGDGGGDGGGDGGGGGCGGGGGCGGGGGG 88 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGG 496 G GGG G GG G GGGG G GGG Sbjct: 61 GDGGGDGGGDGGG--GGCGGGGGCGGGGGGG 89 >At1g31280.1 68414.m03828 PAZ domain-containing protein / piwi domain-containing protein similar to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}, SP|Q9XGW1 PINHEAD protein (ZWILLE protein) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1013 Score = 31.9 bits (69), Expect = 0.61 Identities = 21/56 (37%), Positives = 22/56 (39%) Frame = -2 Query: 567 GXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXGGGXXPPKRG 400 G GG G +GG G G GGGE R G GG GGG RG Sbjct: 5 GYRGGRGDGRGRGGRGYGGGGGGGEQGRDRGYG-GGEQGRGRGSERGGGNRGQGRG 59 Score = 29.5 bits (63), Expect = 3.3 Identities = 22/51 (43%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKG-GGGXXGXXGGGE-GXVARXXGXG 463 GRGR G GGG GG G +G GGG G G E G R G G Sbjct: 13 GRGRGGRGYGGGG----GGGEQGRDRGYGGGEQGRGRGSERGGGNRGQGRG 59 Score = 29.1 bits (62), Expect = 4.3 Identities = 24/59 (40%), Positives = 25/59 (42%), Gaps = 5/59 (8%) Frame = -1 Query: 847 GXWRPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGV-----GVGXGGGXXGQKXG 686 G +R G G RG GGR GGG GG G GG G GGG GQ G Sbjct: 4 GGYRGGRGDG-RGRGGRGYGGGGG--GGEQGRDRGYGGGEQGRGRGSERGGGNRGQGRG 59 >At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein similar to SP|Q15459 Splicing factor 3 subunit 1 (Spliceosome associated protein 114) {Homo sapiens}; contains Pfam profiles PF00240: Ubiquitin family, PF01805: Surp module Length = 785 Score = 31.9 bits (69), Expect = 0.61 Identities = 34/131 (25%), Positives = 35/131 (26%), Gaps = 7/131 (5%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPP--XXPXXPPP---PFXTPXXXPPQXP-TXPPP 583 PPP PP P P PPP P P P P P Q PP Sbjct: 546 PPPRPGVPIVRPLPPPPNLALNLPRPPPSAQYPGAPRPLGVPMMQPMHQQHQLTMPGPPG 605 Query: 584 XPXFXLPR-PXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXXXXXXPPXP 760 P + R P G P P L P P Sbjct: 606 HPQMMMNRPPQMQPGMHVPPPPGSQFAHHMQIPRPYGQLPPSAMGMMQPPPMPGMAP--P 663 Query: 761 PPPXXXPPPXP 793 PPP PPP P Sbjct: 664 PPPEEAPPPLP 674 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 732 PPXXPXXXXPPPPXXXPPPXXXRP 803 PP P PPPP PPP P Sbjct: 654 PPPMPGMAPPPPPEEAPPPLPEEP 677 >At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly identical to RNA helicase [Arabidopsis thaliana] GI:1488521; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 671 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVG 725 G G G R GGG GGGG G GG G Sbjct: 637 GGGGRGNRFGGGGGNRFGGGGGRGRGGSGGRG 668 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -1 Query: 787 GGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQK 692 G G GGGG G GG G G G G GQ+ Sbjct: 640 GRGNRFGGGGGNRFGGGGGRGRG-GSGGRGQR 670 >At5g61660.1 68418.m07736 glycine-rich protein Length = 134 Score = 31.5 bits (68), Expect = 0.81 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -1 Query: 832 GWXXGXR-GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 GW G G+G G G G GG G GG G G G G G G Sbjct: 68 GWGRGSGYGYGSGSGSGTGYGYGSGGGGARG--GGYGYGSGNGRSGGGGG 115 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQ 695 G G GGG GGG G G G GGG G+ Sbjct: 84 GTGYGYGSGGGGARGGGYGYGSGNGRSGGGGGGGGFNGE 122 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 31.5 bits (68), Expect = 0.81 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P L + P PP P+P PPPP PP PP P Sbjct: 54 PRLQRYSPYGNPPPPSPQ------YSPPPPPSQSSPPRSRCPPVP 92 >At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ZF-HD homeobox protein-related predicted proteins, Arabidopsis thaliana Length = 334 Score = 31.5 bits (68), Expect = 0.81 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPP 767 PPP P P PP P PPP Sbjct: 135 PPPPPPPPPPRSPNSASPPP 154 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 31.5 bits (68), Expect = 0.81 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = -1 Query: 847 GXWRPGWXXGXRGWG--GRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G R G G R + G GGG GGGG G G G G GG G Sbjct: 550 GKKRSGGRFGGRDFRREGSYSRGGGGGGGGGGSDYYGGGGYGGGGYGGAPSG 601 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 814 RGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 RG GG GG GGGG G G G G G Sbjct: 571 RGGGGGGGGGGSDYYGGGGYGGGGYGGAPSGGYGAG 606 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 603 GRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEG 490 G G GGG G G GGGG G GG G Sbjct: 567 GSYSRGGGGGGGGGGSDYYGGGGYGGGGYGGAPSGGYG 604 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 784 GGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 GG GGG G G G G GGG G Sbjct: 62 GGGGASGGGYRNDGGRTGYGYGAGGGGGG 90 Score = 28.3 bits (60), Expect = 7.5 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 4/53 (7%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGG----GGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G R W GGG GG GG G G G G GGG + G Sbjct: 49 GQPAGSR-WAPPSSGGGGASGGGYRNDGGRTGYGYGAGGGGGGGGGWNNRSGG 100 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 31.5 bits (68), Expect = 0.81 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = -1 Query: 847 GXWRPGWXXGXRGWG--GRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G R G G R + G GGG GGGG G G G G GG G Sbjct: 550 GKKRSGGRFGGRDFRREGSYSRGGGGGGGGGGSDYYGGGGYGGGGYGGAPSG 601 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 814 RGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 RG GG GG GGGG G G G G G Sbjct: 571 RGGGGGGGGGGSDYYGGGGYGGGGYGGAPSGGYGAG 606 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 603 GRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEG 490 G G GGG G G GGGG G GG G Sbjct: 567 GSYSRGGGGGGGGGGSDYYGGGGYGGGGYGGAPSGGYG 604 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 784 GGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 GG GGG G G G G GGG G Sbjct: 62 GGGGASGGGYRNDGGRTGYGYGAGGGGGG 90 Score = 28.3 bits (60), Expect = 7.5 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 4/53 (7%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGG----GGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G R W GGG GG GG G G G G GGG + G Sbjct: 49 GQPAGSR-WAPPSSGGGGASGGGYRNDGGRTGYGYGAGGGGGGGGGWNNRSGG 100 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 31.5 bits (68), Expect = 0.81 Identities = 20/62 (32%), Positives = 22/62 (35%), Gaps = 1/62 (1%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPP-PXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFX 598 PPP P P + P P P PPPP T P + T PP P Sbjct: 124 PPPSKTHERSRPITPSPPPPSKTHEPSRPNTPPPPPPPSKT--HEPSRRITPSPPPPSKI 181 Query: 599 LP 604 LP Sbjct: 182 LP 183 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 461 PPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPP 583 P P T P P PPPP T P P PPP Sbjct: 121 PSPPPPSKTHERSRPITP-SPPPPSKTHEPSRPNTPPPPPP 160 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 P PPP T P PPPP P P P P Sbjct: 138 PSPPPPSKTHEPSRPNTPPPPPPPSKTHEPSRRITPSPPPP 178 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 479 RATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXLPRP 610 R PSPPP P TP PP T P P P Sbjct: 134 RPITPSPPPPSKTHEPSRPNTPPPPPPPSKTHEPSRRITPSPPP 177 >At3g26400.1 68416.m03292 eukaryotic translation initiation factor 4B, putative/ eIF-4B, putative similar to eukaryotic initiation factor 4B [Arabidopsis thaliana] GI:6739518 Length = 532 Score = 31.5 bits (68), Expect = 0.81 Identities = 23/87 (26%), Positives = 26/87 (29%) Frame = -2 Query: 780 GXXXGGGGXGGXXXXXXXXXXXXXXXXGKKXEGXGXXRXXXXXXXXXGRPPXPXPXXGRG 601 G GGGG GG + + R + P P GR Sbjct: 130 GSWSGGGGGGGRRPYGGGFDDDRRGNQSRVSDFPQPSRADEVDDWGKEKKPLPSFDQGRQ 189 Query: 600 RXKXGXGGGXVGXWGGXXXGVXKGGGG 520 G GGG G G G GGGG Sbjct: 190 GRYSGDGGGFGGGGSGFGGGGGGGGGG 216 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -2 Query: 576 GXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVAR 478 G G + G G GG G G GGG G ++R Sbjct: 187 GRQGRYSGDGGGFGGGGSGFGGGGGGGGGGLSR 219 >At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) similar to RNA helicases GI:3775995, GI:3775987 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 610 Score = 31.5 bits (68), Expect = 0.81 Identities = 21/80 (26%), Positives = 23/80 (28%) Frame = -2 Query: 606 RGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVARXXGXGGAPXPXXXXXXG 427 R G G G +G + GGG G GG G G G G Sbjct: 505 RSGGSFGGGRSGGGGYGSYGSSSGRSGGGSYGGYGGSSGRSGGGGGSYGGSGGSSSRYSG 564 Query: 426 GGXXPPKRGXXGXGRXGGFF 367 G G G G G F Sbjct: 565 GSDRSSGFGSFGSGGSSGGF 584 >At3g07195.1 68416.m00858 proline-rich family protein Length = 225 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -1 Query: 784 GGXXXGGGGXXXXGXXGGVGVGXGGGXXGQK 692 GG GGGG G GG+ G GGG G + Sbjct: 95 GGGGSGGGGRSGSGSAGGLYGGYGGGSVGNQ 125 >At2g05530.1 68415.m00585 glycine-rich protein Length = 115 Score = 31.5 bits (68), Expect = 0.81 Identities = 19/48 (39%), Positives = 21/48 (43%) Frame = -1 Query: 838 RPGWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQ 695 +P G G G GGG GGGG G GG G GGG G+ Sbjct: 37 QPDQYNGGHGGNGGYNGGGGY-NGGGGHNGGGYNGGGGYN-GGGHGGR 82 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 609 GRGRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEGXVAR 478 G G GGG GG G GGGG G GG R Sbjct: 44 GHGGNGGYNGGGGYNGGGGHNGGGYNGGGGYNGGGHGGRHGYCR 87 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 787 GGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G GGGG G G G GGG G G Sbjct: 47 GNGGYNGGGGYNGGGGHNGGGYNGGGGYNGGGHG 80 >At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical to cDNA glycine-rich protein 3 short isoform (GRP3S) GI:4206766 Length = 116 Score = 31.5 bits (68), Expect = 0.81 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 567 GXWGGXXXGVXKGGGGXXGXXGGG-EGXVARXXGXGG 460 G +G G +GGGG G GGG +G R G GG Sbjct: 42 GGFGDNGGGRYQGGGGHGGHGGGGYQGGGGRYQGGGG 78 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 805 GGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXGR 683 GG GGG GGGG G GG G GGG GR Sbjct: 42 GGFGDNGGGRYQGGGG---HGGHGGGGYQGGGGRYQGGGGR 79 Score = 28.3 bits (60), Expect = 7.5 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 832 GWXXGXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G G G GGR GGG GGG G GG G GGG Sbjct: 41 GGGFGDNG-GGRYQGGGGHGGHGGG----GYQGGGGRYQGGG 77 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -1 Query: 814 RGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 +G GG GGG GGGG GG G GGG Sbjct: 53 QGGGGHGGHGGGGYQGGGGR----YQGGGGRQGGGG 84 Score = 27.9 bits (59), Expect = 10.0 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXG 743 G +G GGR GGG GGG G Sbjct: 65 GYQGGGGRYQGGGGRQGGGGSYCRHG 90 >At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family protein weak similarity to SP|Q00765 Polyposis locus protein 1 (TB2 protein) {Homo sapiens}; contains Pfam profile PF03134: TB2/DP1, HVA22 family Length = 315 Score = 31.5 bits (68), Expect = 0.81 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPP 832 PP PPPP PPP P A + P Sbjct: 234 PPGPPPPPPPPPPSPTTAAKRNADPAQP 261 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 485 TXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPP 583 T P PPP P PPPP T P P P Sbjct: 233 TPPGPPP--PPPPPPPSPTTAAKRNADPAQPSP 263 >At1g11850.1 68414.m01363 expressed protein Length = 93 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEG 490 G GG +G G G+ GGGG G GGG G Sbjct: 58 GLGGLGIGAGIGAGAGLGLGGGGFGGGAGGGLG 90 Score = 29.5 bits (63), Expect = 3.3 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G G G GGG GG G G G G+G GGG G G Sbjct: 43 GGSGDGLGLGLGGGAGLGGLGIGA-GIGAGAGLGLGGGGFGGGAG 86 >At1g61750.1 68414.m06964 expressed protein contains Pfam profile: PF01657 domain of unknown function Length = 352 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 749 PPXPPPPXXXPPPXP 793 PP PPPP PPP P Sbjct: 247 PPPPPPPPPPPPPPP 261 Score = 28.3 bits (60), Expect(2) = 0.83 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 479 RATXPSPPPXXPXXPPPP 532 +AT +PPP P PPPP Sbjct: 241 KATFLAPPPPPPPPPPPP 258 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 745 PPXXXPPPPXPXPPXXXXG 801 PP PPPP P PP G Sbjct: 248 PPPPPPPPPPPPPPQRLYG 266 Score = 21.8 bits (44), Expect(2) = 0.83 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 554 PPQXPTXPPPXP 589 PP P PPP P Sbjct: 250 PPPPPPPPPPPP 261 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPP---PXXXRPPXPLXPXXHPG 836 PPP P P P PPPP PP P PP P PG Sbjct: 22 PPPGAYP-PAGYPQQGYPPPPGAYPPAGYPPGAYPPAPGGYPPAPG 66 >At5g13760.1 68418.m01604 expressed protein similar to unknown protein (gb AAF63775.1) Length = 569 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 4/45 (8%) Frame = +2 Query: 461 PPXPXX----RATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPP 583 PP P R++ PPP P PP P PQ P PPP Sbjct: 72 PPPPNLAQPLRSSSRQPPPPPPRPQTPPTFVPEETQPQTP--PPP 114 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/73 (28%), Positives = 24/73 (32%), Gaps = 2/73 (2%) Frame = -2 Query: 633 PPXPXPXXGRGRXKXGXGGGXVGXWGGXXXGVX--KGGGGXXGXXGGGEGXVARXXGXGG 460 PP RG G G G +G G + GGG GGG G G GG Sbjct: 178 PPKREESFSRGPRSGGYGSERGGGYGSERGGGYGSERGGGYGSERGGGYGSQRSGGGYGG 237 Query: 459 APXPXXXXXXGGG 421 + G G Sbjct: 238 SQRSSYGSGSGSG 250 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G+G G G GGG G GG G GGG Q+ G Sbjct: 193 GYGSERGGGYGSERGGGYGSERG--GGYGSERGGGYGSQRSG 232 >At3g49300.1 68416.m05388 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 86 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPP 788 P + + P P PT P PPPP PPP Sbjct: 46 PTIMDYPEPGPDPKHDPTKPGYGFPPPPPPPLSPPPP 82 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +3 Query: 714 PXPTPTP---PXXPXXXXPPPPXXXPPPXXXRPP 806 P P P P P P PPPP PPP PP Sbjct: 52 PEPGPDPKHDPTKPGYGFPPPP---PPPLSPPPP 82 Score = 27.9 bits (59), Expect = 10.0 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +3 Query: 708 PPPXPTPT-PPXXPXXXXPPPPXXXPPPXXXRPPXP 812 P P P P P P PPPP PPP PP P Sbjct: 52 PEPGPDPKHDPTKPGYGFPPPP---PPPL--SPPPP 82 >At3g43583.1 68416.m04636 hypothetical protein Length = 100 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/62 (29%), Positives = 20/62 (32%) Frame = +2 Query: 422 PPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQXPTXPPPXPXFXL 601 PPP + P + P PPP P PP P P P PP F Sbjct: 6 PPPHCRGFHCHRSNHRPPEKPPSPEPPPS-PEPPPSPEKPTSPEQPSSPEPPPHCQGFHC 64 Query: 602 PR 607 R Sbjct: 65 HR 66 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +2 Query: 749 PPXPPPPXXXPPPXPXXAXPXSXSXXPPGAPXPXKHNSSF 868 P PP P P P P + S P +P P H F Sbjct: 23 PEKPPSPEPPPSPEPPPSPEKPTSPEQPSSPEPPPHCQGF 62 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPP--PPXXXPPP 788 P P P P+P PP P P P PPP Sbjct: 26 PPSPEPPPSPEPPPSPEKPTSPEQPSSPEPPP 57 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPP 788 P P P P P P PPP PPP Sbjct: 52 PYPPPPPLPDFAPQPLLPPPSPPPPPP 78 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 729 TPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXPXNTI 860 TPP P P PPP P PL P P P TI Sbjct: 39 TPPVDPSPSSVHRPYPPPPPLPDFAPQPLLPPPSPPPPPPAYTI 82 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXP 821 PP P+P+ P PP P P P P P P Sbjct: 40 PPVDPSPSSVHRPYPPPPPLPDFAPQPLLPPPSPPPPP 77 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 491 PSPPPXX-PXXPPPPFXTPXXXPPQXPTXPPPXP 589 PSP P PPPP P P PPP P Sbjct: 44 PSPSSVHRPYPPPPPLPDFAPQPLLPPPSPPPPP 77 >At2g21140.1 68415.m02508 hydroxyproline-rich glycoprotein family protein identical to proline-rich protein 2 [Arabidopsis thaliana] gi|7620011|gb|AAF64549 Length = 321 Score = 31.1 bits (67), Expect = 1.1 Identities = 23/76 (30%), Positives = 26/76 (34%), Gaps = 3/76 (3%) Frame = +2 Query: 365 KKKPPXRPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXP--SPPPXXPXXP-PPPF 535 K K P P P++ P P PP P + P PP P P PP Sbjct: 179 KIKKPCPPIYKPPVVIPKKPCPPKIAHKPIYKPPVPIYKPPVPIYKPPVVIPKKPCPPKI 238 Query: 536 XTPXXXPPQXPTXPPP 583 P PP P PP Sbjct: 239 HKPIYKPP-VPIYKPP 253 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/57 (26%), Positives = 19/57 (33%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXP 848 P +P + P P P P P P PP +PP + P H P Sbjct: 211 PPVPIYKPPVPIYKPPVVIPKKPCPPKIHKPIYKPPVPIYKPPVVIPKKTFPPLHKP 267 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +3 Query: 699 PXXPPPXPTPTPPXX-PXXXXPPPPXXXPPPXXXRPPXP 812 P P P P PP P P PP PP + P P Sbjct: 162 PKFPLPPPLNLPPLTFPKIKKPCPPIYKPPVVIPKKPCP 200 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/59 (32%), Positives = 21/59 (35%), Gaps = 4/59 (6%) Frame = +3 Query: 669 GRXPXLPXFCPXXPPPXPTPT----PPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHP 833 G +P P PPP P PP P P PPP RPP + P P Sbjct: 244 GSMQPVPIPAPRQPPPPPPQVYQTQPPSWPSQ--PQQHSMVPPPMQFRPPQGMPPPPPP 300 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G G GG GGG GGGG G GG G G GG G Sbjct: 780 GHHGGGG---CGGGHHGGGGG--GCGGCGGGGCGGGGDGGG 815 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGG 496 G GGG G GG G GGG G GGG Sbjct: 786 GCGGGHHGGGGGGCGGCG-GGGCGGGGDGGG 815 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 PPP P P PP PPPP P P P Sbjct: 98 PPPQPPP-PPQPLNLFSPPPPPPPPDPFSWTNP 129 >At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family protein similar to SP|P42925 22 kDa peroxisomal membrane protein {Mus musculus}; contains Pfam profile PF04117: Mpv17 / PMP22 family Length = 288 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 834 PGGXXXXEXGXAXXGXGGGXXXGGGGXG 751 PGG G G GGG GGGG G Sbjct: 77 PGGNSGGSGGLGGSGGGGGGSGGGGGDG 104 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -2 Query: 603 GRXKXGXGGGXVGXWGGXXXGVXKGGGGXXGXXGGG 496 G+ G GGG G G GGGG G GGG Sbjct: 103 GKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGG 138 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -1 Query: 820 GXRGWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G +G GG GGG G G GG G G GGG G Sbjct: 102 GGKGGGG---GGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 831 GGXXXXEXGXAXXGXGGGXXXGGGGXGG 748 GG G G GGG GGGG GG Sbjct: 111 GGPANNNKGQKIGGGGGGGGGGGGGGGG 138 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 582 GGGXVGXWGGXXXGVXKGGGGXXGXXGGGEG 490 GGG G G GGGG G GGG G Sbjct: 106 GGGGGGGPANNNKGQKIGGGGGGGGGGGGGG 136 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -1 Query: 466 WGGXPPXGXXXXGGGXXPPQKGXXXXGPPGG 374 +GG P G GG P G GPPGG Sbjct: 125 FGGRPSTGPLVGGGSSFPQPGGFPASGPPGG 155 Score = 30.3 bits (65), Expect = 1.9 Identities = 37/159 (23%), Positives = 39/159 (24%), Gaps = 8/159 (5%) Frame = +2 Query: 383 RPXPXXPLLGGXXPPPXXXXXXGXGAPPXPXXRATXPSPPPXXPXXPPPPFXTPXXXPPQ 562 RP P P G PP G P + P P P PPPP P Sbjct: 47 RPPPPMPGSGPRPSPPF-----GQSPQSFPQQQQQQPRPSPMARPGPPPPAAMARPGGPP 101 Query: 563 XPTXPPPXPXFXLP--RPXXGXGXGGLXXXXXXXXXXRXXPXPSXFLXXXXXXXXXXXXX 736 + P P P P GG P P F Sbjct: 102 QVSQPGGFPPVGRPVAPPSNQPPFGGRPSTGPLVGGGSSFPQPGGFPASGPPGGVPSGPP 161 Query: 737 XXXXP----PXPP--PPXXXPPPXPXXAXPXSXSXXPPG 835 P PP P PPP P S P G Sbjct: 162 SGARPIGFGSPPPMGPGMSMPPPSGMPGGPLSNGPPPSG 200 >At3g42130.1 68416.m04326 glycine-rich protein Length = 65 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXGQKXG 686 G GGR GGG GGGG G GGG G++ G Sbjct: 19 GGGGRYRKGGGNVYGGGGGYERHSR---GYRSGGGCGGKRYG 57 >At3g21215.1 68416.m02681 RNA-binding protein, putative contains RNA recognition motif, Pfam:PF00076; contains AT-AC splice sites at intron 8 Length = 339 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = +2 Query: 455 GAPPXPXX--RATXPSPPPXXPXXPPPP 532 GAPP P A P PPP PPPP Sbjct: 17 GAPPPPAAVSSAAPPHPPPIHHHPPPPP 44 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/57 (31%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +3 Query: 699 PXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPL---XPXXHPGRHXPXNTI 860 P PPP P PP P PP P PP P+ P P + P I Sbjct: 172 PFHPPPPPVWGPPH--GYMAPAPPPYDPYAGYHAPPVPMPTPPPIAAPSSYVPVQNI 226 Score = 27.9 bits (59), Expect = 10.0 Identities = 17/61 (27%), Positives = 21/61 (34%) Frame = +3 Query: 678 PXLPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPPXPLXPXXHPGRHXPXNT 857 P P + P P P PP P PP P P P P + + P NT Sbjct: 176 PPPPVWGPPHGYMAPAP-PPYDPYAGYHAPPVPMPTPPPIAAPSSYVPVQNIKDNPPCNT 234 Query: 858 I 860 + Sbjct: 235 L 235 >At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related similar to U4/U6 small nuclear ribonucleoprotein hPrp4 (GP:2708305) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (7 copies)|19877698|gb|AU238529.1|AU238529 Length = 554 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 684 LPXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 LP F P P+ PP P P PP PP RPP Sbjct: 29 LPGFSAIPPVVPPSFPPPMAPIPMMPHPPVARPP--TFRPP 67 >At1g63550.1 68414.m07184 hypothetical protein low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 299 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +3 Query: 708 PPPXPTPTPPXXPXXXXPPP---PXXXPPPXXXRPP 806 PPP P+ PP P PP P PP PP Sbjct: 226 PPPSPSAPPPRSPPPKSSPPSSLPQTPSPPLVFTPP 261 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +2 Query: 494 SPPPXXPXXPPPPFXTPXXXPP-QXPTXPPPXPXFXLPR 607 SPPP P PPP P PP P P P F P+ Sbjct: 225 SPPPS-PSAPPPRSPPPKSSPPSSLPQTPSPPLVFTPPQ 262 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 752 PXPPPPXXXPPPXPXXAXPXS 814 P PPPP PPP P + P S Sbjct: 27 PLPPPPPLPPPPPPRQSHPES 47 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 687 PXFCPXXPPPXPTPTPPXXPXXXXPPPPXXXPPPXXXRPP 806 P + P P P PP P PPPP PPP P Sbjct: 8 PTYDPWNSPYSPHLHPPSAPL--PPPPPLPPPPPPRQSHP 45 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 811 GWGGRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGG 707 G GGR GGG GGG G GG G GGG Sbjct: 73 GGGGRGYGGGGRREGGG---YGGGDGGSYGGGGGG 104 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 802 GRXXXGGGXXXGGGGXXXXGXXGGVGVGXGGGXXG 698 G GGG GGGG G GG G GG G Sbjct: 69 GSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGG 103 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 588 GXGGGXVGXWGGXXXGVXKGGGGXXGXXGGGEG 490 G GGG G GG GGG G GGG G Sbjct: 71 GGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGG 103 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,127,638 Number of Sequences: 28952 Number of extensions: 407649 Number of successful extensions: 27524 Number of sequences better than 10.0: 362 Number of HSP's better than 10.0 without gapping: 1322 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10424 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2178500352 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -