BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_A01 (802 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 26 1.2 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 24 4.8 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 8.3 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 26.2 bits (55), Expect = 1.2 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = -1 Query: 457 GXPPPPXXXXGG--GGXXXGXPPNFFLXXPPXXNF*NPPRG 341 G P PP GG GG G PNF+ PP G Sbjct: 296 GPPRPPMPMQGGAPGGPPQGMRPNFYNRPMGDPQTSRPPSG 336 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +3 Query: 399 GXPXXXPPPPXXKXGGGGXP 458 G P PPPP GG P Sbjct: 781 GSPPPPPPPPPSSLSPGGVP 800 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.4 bits (48), Expect = 8.3 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 348 PGGGNFFRGXKNPGGG 301 PGGG G PGGG Sbjct: 212 PGGGGGSSGGPGPGGG 227 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 525,348 Number of Sequences: 2352 Number of extensions: 8883 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84408009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -