Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP02_F_P21
         (914 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g38140.1 68418.m04596 histone-like transcription factor (CBF/...    30   1.9  

>At5g38140.1 68418.m04596 histone-like transcription factor
           (CBF/NF-Y) family protein similar to CCAAT-binding
           transcription factor subunit AAB-1 (GI:2583171)
           [Neurospora crassa];  contains a CBF/NF-Y subunit
           signature (PDOC00578) presernt in members of
           histone-like transcription factor family; contains Pfam
           PF00808 : Histone-like transcription factor (CBF/NF-Y)
           and archaeal histone
          Length = 195

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = -3

Query: 609 DRPSLSTSLGXTVLGHSSHIFHFQSQRSEFGQFSRXTHLPLSSFR 475
           + P  S   G + L  +  +F + +QR + G F+  THLPLS  R
Sbjct: 31  NHPETSKIEGVSSLDTALKVF-WNNQREQLGNFAGQTHLPLSRVR 74


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,404,775
Number of Sequences: 28952
Number of extensions: 220844
Number of successful extensions: 397
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 358
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 397
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2168774904
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)