BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_P21 (914 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g38140.1 68418.m04596 histone-like transcription factor (CBF/... 30 1.9 >At5g38140.1 68418.m04596 histone-like transcription factor (CBF/NF-Y) family protein similar to CCAAT-binding transcription factor subunit AAB-1 (GI:2583171) [Neurospora crassa]; contains a CBF/NF-Y subunit signature (PDOC00578) presernt in members of histone-like transcription factor family; contains Pfam PF00808 : Histone-like transcription factor (CBF/NF-Y) and archaeal histone Length = 195 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = -3 Query: 609 DRPSLSTSLGXTVLGHSSHIFHFQSQRSEFGQFSRXTHLPLSSFR 475 + P S G + L + +F + +QR + G F+ THLPLS R Sbjct: 31 NHPETSKIEGVSSLDTALKVF-WNNQREQLGNFAGQTHLPLSRVR 74 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,404,775 Number of Sequences: 28952 Number of extensions: 220844 Number of successful extensions: 397 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 358 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 397 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2168774904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -