BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_P20 (921 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF469165-1|AAL68692.1| 226|Anopheles gambiae amylase protein. 24 7.5 AM690372-1|CAM84316.1| 353|Anopheles gambiae purine nucleoside ... 23 9.8 >AF469165-1|AAL68692.1| 226|Anopheles gambiae amylase protein. Length = 226 Score = 23.8 bits (49), Expect = 7.5 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +2 Query: 605 FHKVPRTWSRAYMTCLAEGGYLTIINSQQEAT 700 F+ P T + CL G Y II+ +++ T Sbjct: 161 FNAGPETSDGIWKACLPPGEYCDIISGERDGT 192 >AM690372-1|CAM84316.1| 353|Anopheles gambiae purine nucleoside phosphorylase protein. Length = 353 Score = 23.4 bits (48), Expect = 9.8 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +2 Query: 314 GIYTGIHALFSXGXFRSIEGVPLAK 388 G G+ + G F EG PLAK Sbjct: 136 GYLAGVPVMCMQGRFHHYEGYPLAK 160 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 726,560 Number of Sequences: 2352 Number of extensions: 13211 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 100055142 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -