BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_P19 (996 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 41 0.001 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 41 0.002 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.051 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.051 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 36 0.051 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.051 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 36 0.068 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 35 0.12 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 35 0.12 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 35 0.12 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 35 0.12 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 35 0.12 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 34 0.16 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 34 0.21 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 34 0.21 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 33 0.36 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 33 0.36 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 33 0.36 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 33 0.36 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 33 0.36 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 33 0.36 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 33 0.48 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 33 0.48 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 33 0.48 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.63 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 32 0.63 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 32 0.83 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 32 0.83 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.83 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.83 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 31 1.1 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 31 1.1 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 31 1.1 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 31 1.5 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 31 1.9 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 31 1.9 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 30 2.5 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 30 2.5 SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) 30 3.4 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.4 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 30 3.4 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.4 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 30 3.4 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.4 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 30 3.4 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 30 3.4 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.4 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.4 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 30 3.4 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 29 4.4 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 29 4.4 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 29 4.4 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 29 5.9 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 29 5.9 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 29 5.9 SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) 29 5.9 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 29 5.9 SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) 29 5.9 SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) 29 5.9 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 29 5.9 SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) 29 5.9 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 29 7.8 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 29 7.8 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 29 7.8 SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.8 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 29 7.8 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +1 Query: 814 PXPPXXXXXXXXXPXXXXXXXXXXXXXXXXXPXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP P P PPP PP PPP PP P PPP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +1 Query: 814 PXPPXXXXXXXXXPXXXXXXXXXXXXXXXXXPXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP P P PPP PP PPP PP P PPP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +1 Query: 814 PXPPXXXXXXXXXPXXXXXXXXXXXXXXXXXPXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP P P PPP PP PPP PP P PPP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 37.9 bits (84), Expect = 0.013 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +1 Query: 814 PXPPXXXXXXXXXPXXXXXXXXXXXXXXXXXPXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP P P PPP PP PP PP P PPP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 37.9 bits (84), Expect = 0.013 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +1 Query: 814 PXPPXXXXXXXXXPXXXXXXXXXXXXXXXXXPXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP P P PPP PP P P PP P PPP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 37.9 bits (84), Expect = 0.013 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +1 Query: 814 PXPPXXXXXXXXXPXXXXXXXXXXXXXXXXXPXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP P P PPP PP PP PP P PPP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 37.5 bits (83), Expect = 0.017 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP PP PPP PPP PPP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPP 393 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 40.7 bits (91), Expect = 0.002 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP PP P PPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 40.7 bits (91), Expect = 0.002 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP PP P PPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP PPP PPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 36.3 bits (80), Expect = 0.039 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PPP PPP P P Sbjct: 473 PPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 35.9 bits (79), Expect = 0.051 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP PPP PP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP PPP PP P PPP Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPP 708 Score = 37.5 bits (83), Expect = 0.017 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP P P PPP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 37.1 bits (82), Expect = 0.022 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP P P PPP P Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP P PPP P Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 28.7 bits (61), Expect = 7.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 P P PPP PPP PPP Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPP 698 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 37.1 bits (82), Expect = 0.022 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PP PPP PPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 36.3 bits (80), Expect = 0.039 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP P PPP PPP PPP Sbjct: 225 PPPPAAPAPPPPPAAAPPPPPPPP 248 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP P PP PPP PPP Sbjct: 226 PPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 32.7 bits (71), Expect = 0.48 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP P PP PP P PPP Sbjct: 225 PPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 P P PP PPP PPP P Sbjct: 231 PAPPPPPAAAPPPPPPPPPVKKP 253 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 35.9 bits (79), Expect = 0.051 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 P P PP PPP PPP PPP Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 32.7 bits (71), Expect = 0.48 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPP 990 P P PP PPP PP P PP Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 32.7 bits (71), Expect = 0.48 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 922 PPXXXPPXXXPPPXXPPXPXXPPP 993 P PP PPP PP P PPP Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 31.9 bits (69), Expect = 0.83 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 P P P PPP PP P PPP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPP 884 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 911 PXXPPXXXPPPXXXPPPXXPPP 976 P P PPP PPP PPP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPP 881 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXP 978 P PP PP PPP PP P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPP 885 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 35.9 bits (79), Expect = 0.051 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PP PP PPP PP P PPP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP P PPP PPP PPP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPP 119 Score = 32.3 bits (70), Expect = 0.63 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 P PP PPP PPP PPP Sbjct: 97 PACCAPPPPPPPPPPPPPPPPPPP 120 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPP 990 P P PP PPP PP P PP Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPPP 120 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 35.9 bits (79), Expect = 0.051 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP PPP PPP P Sbjct: 304 PPPPPPPGGAPPPP--PPPPPPPPGDGGAP 331 Score = 34.3 bits (75), Expect = 0.16 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP PP PP Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPP 332 Score = 32.7 bits (71), Expect = 0.48 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PP PP PPP Sbjct: 314 PPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +1 Query: 907 PXXXPPP----XXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PP PP P PPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPP 322 Score = 29.9 bits (64), Expect = 3.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPP 990 P P PP PP PP P PP Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPPP 325 Score = 29.9 bits (64), Expect = 3.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP PP PPP P PPP Sbjct: 305 PPPPPPGGAPPPPPPPPPPPPGDGGAPPP 333 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP P PPP Sbjct: 310 PGGAPPP--PPPPPPPPPGDGGAPPPPPP 336 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 5/29 (17%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPP-----PXXPPP 976 PPP P PPP PP P PPP Sbjct: 308 PPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 35.9 bits (79), Expect = 0.051 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPP-PXXPPPXXXXXP 994 PPP PP PPP PP P PPP P Sbjct: 95 PPPPYPPYPPPPPYPPPPNPPYPPPPNAPYP 125 Score = 35.9 bits (79), Expect = 0.051 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP PPP PPP P Sbjct: 149 PPPPNPPY--PPPLYPPPPNPPPPNAPYPP 176 Score = 35.1 bits (77), Expect = 0.089 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 906 PXPXXPPXXXPPPXXPPPXXXPXPXXP 986 P P PP PPP PPP P P P Sbjct: 152 PNPPYPPPLYPPPPNPPPPNAPYPPPP 178 Score = 33.9 bits (74), Expect = 0.21 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +1 Query: 814 PXPPXXXXXXXXXPXXXXXXXXXXXXXXXXXPXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP P P PPP P PPP P P PPP Sbjct: 178 PYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPP 237 Score = 33.5 bits (73), Expect = 0.27 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP PP PPP PP P P P Sbjct: 165 PNPPPPNAPYPPPPYPPPPNPPYPPPPNP 193 Score = 33.1 bits (72), Expect = 0.36 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP P P P P PPP Sbjct: 100 PPYPPPPPYPPPPNPPYPPPPNAPYPPPP 128 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 PPP PP PP PPP PP Sbjct: 109 PPPPNPPYPPPPNAPYPPPPNPP 131 Score = 33.1 bits (72), Expect = 0.36 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +1 Query: 814 PXPPXXXXXXXXXPXXXXXXXXXXXXXXXXXPXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP P P PP PP PP PP P PPP Sbjct: 139 PYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPP 198 Score = 32.7 bits (71), Expect = 0.48 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PP P P PPP P Sbjct: 175 PPPPYPPPPNPPYPPPPNPPYPPPPNAPNP 204 Score = 32.7 bits (71), Expect = 0.48 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP P P PP PPP P Sbjct: 176 PPPYPPPPNPPYPPPPNPPYPPPPNAPNPP 205 Score = 32.3 bits (70), Expect = 0.63 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPP-XXPPXPXXPPP 993 P PP PP PPP PP P PPP Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPPYPPP 119 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = +1 Query: 919 PPPXXXPPXXX-PPPXXPPXPXXPPP 993 PPP PP PPP PP P PPP Sbjct: 176 PPPYPPPPNPPYPPPPNPPYP--PPP 199 Score = 29.9 bits (64), Expect = 3.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP PP P PP P PPP Sbjct: 107 PYPPPPNPPYPPPPNAPYPPPPNPPYPPP 135 Score = 29.9 bits (64), Expect = 3.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP PP P P PP PPP P Sbjct: 114 PPYPPPPNAPYPPPPNPPYPPPPNAPYPP 142 Score = 29.9 bits (64), Expect = 3.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP PP P PP P PPP Sbjct: 131 PYPPPPNAPYPPSPNAPYPPPPNPPYPPP 159 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPP 990 PP P PPP PP P PP Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPP 107 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PP P PPP P Sbjct: 104 PPPPYPPPPNPPYPPPPNAPYPPPPNPPYP 133 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP P P P PPP P Sbjct: 105 PPPYPPPPNPPYPPPPNAPYPPPPNPPYPP 134 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Frame = +2 Query: 905 PPPXXPPXXXPP-PXXXPPPXXPPPXXXXXP 994 PPP P PP P PPP P P P Sbjct: 117 PPPPNAPYPPPPNPPYPPPPNAPYPPSPNAP 147 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP P P P P PPP Sbjct: 123 PYPPPPNPPYPPPPNAPYPPSPNAPYPPPP 152 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 35.5 bits (78), Expect = 0.068 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP PPP PP P P P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRP 229 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXP---PPXXPPPXXXXXP 994 PPP PP PPP P PP PPP P Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 Score = 34.3 bits (75), Expect = 0.16 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPP 990 P PPP PP PP PP P PP Sbjct: 211 PPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP PP PP PP P PPP Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPPP 234 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP P P P P PPP Sbjct: 207 PPPRPPPSPPPPPPPPSPSPPRPPPPPPP 235 Score = 33.5 bits (73), Expect = 0.27 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PP P P PPP P Sbjct: 211 PPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP PP P P PPP P P P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPP 232 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PP PPP PP P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPP 233 Score = 29.9 bits (64), Expect = 3.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P P P PPP P P P Sbjct: 217 PPPPPPSPSPPRPPPPPPPSPPRPLAAKLP 246 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 160 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 161 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 162 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 140 GGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG G G Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP PPP PP P PPP Sbjct: 75 PPPPAAPPAAPPPP--PPLPAPPPP 97 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP P P PP P Sbjct: 76 PPPAAPPAAPPPPPPLPAPPPPPAQPAPQP 105 Score = 32.7 bits (71), Expect = 0.48 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP P PPP PP PPP Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPP 89 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP P PP P P PPP Sbjct: 62 PAAPPPPAAAPAAPPPPAAPPAAPPPPPP 90 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PPP PP PPP P Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPPPLPAP 94 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PPP P PPP P Sbjct: 66 PPPAAAPAAPPPPAAPPAAPPPPPPLPAPP 95 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP PP P P PPP P P P Sbjct: 81 PPAAPPPPPPLPAPPPPPAQPAPQPPPAP 109 Score = 29.9 bits (64), Expect = 3.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PPP P P PP P Sbjct: 85 PPPPPPLPAPPPPPAQPAPQPPPAPPHFLP 114 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PPP PPP PP P Sbjct: 75 PPPPAAPPAAPPP---PPPLPAPPPPPAQP 101 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGG 797 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 847 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 848 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 841 GYADGDGGGGGGGGGGGGGGGGGGGGGGGG 870 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGG 874 Score = 32.3 bits (70), Expect = 0.63 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 989 GGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GG G GG GGG GG GGG G Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGG 806 Score = 32.3 bits (70), Expect = 0.63 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 989 GGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GG G GG GGG GG GGG G Sbjct: 812 GGGGGGGGGGGGGGDGGGYGDGGGFGDG 839 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG G G GG GGG G Sbjct: 772 GGGDGGDGGGGGDGGGGGGGGGGGGGGGG 800 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGG 907 G GGG GGG GGG GG GG Sbjct: 774 GDGGDGGGGGDGGGGGGGGGGGGGGGGGG 802 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG G G G Sbjct: 780 GGGGDGGGGGGGGGGGGGGGGGGDGGGYG 808 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GG G GG GGG GG GGG G Sbjct: 782 GGDGGGGGGGGGGGGGGGGGGDGGGYGDG 810 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG G G G Sbjct: 788 GGGGGGGGGGGGGGGDGGGYGDGDGGGGG 816 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG G GGG G Sbjct: 793 GGGGGGGGGGDGGGYGDGDGGGGGGGGGG 821 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG G G GG GGG G Sbjct: 797 GGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GG GGG GGG GG GGG Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGG 799 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GG GGG GG GGG Sbjct: 773 GGDGGDGGGGGDGGGGGGGGGGGGGGGGGG 802 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G G G GGG GGG GG GGG Sbjct: 777 GDGGGGGDGGGGGGGGGGGGGGGGGGDGGG 806 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG G G Sbjct: 781 GGGDGGGGGGGGGGGGGGGGGGDGGGYGDG 810 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG G GGG Sbjct: 787 GGGGGGGGGGGGGGGGDGGGYGDGDGGGGG 816 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG G G Sbjct: 810 GDGGGGGGGGGGGGGGDGGGYGDGGGFGDG 839 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G G G GGG GGG GG GGG Sbjct: 839 GGGYADGDGGGGGGGGGGGGGGGGGGGGGG 868 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG G G GGG GG GGG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGG 792 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GG G GG GGG GG GGG G Sbjct: 805 GGYGDGDGGGGGGGGGGGGGGDGGGYGDG 833 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GG GG GGG G Sbjct: 817 GGGGGGGGGDGGGYGDGGGFGDGGGYADG 845 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG G G GG GGG Sbjct: 789 GGGGGGGGGGGGGGDGGGYGDGDGGGGGGG 818 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG G GGG Sbjct: 806 GYGDGDGGGGGGGGGGGGGGDGGGYGDGGG 835 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GGG G GG GGG GG GG Sbjct: 816 GGGGGGGGGGDGGGYGDGGGFGDGG 840 Score = 29.9 bits (64), Expect = 3.4 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = -1 Query: 993 GXXXXXGGGXXGG-GXXXGGGXXXGGXXGGG 904 G GGG GG G GGG GG GGG Sbjct: 794 GGGGGGGGGDGGGYGDGDGGGGGGGGGGGGG 824 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GG G G GGG GG GGG G Sbjct: 776 GGDGGGGGDGGGGGGGGGGGGGGGGGGDG 804 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG G G G G Sbjct: 786 GGGGGGGGGGGGGGGGGDGGGYGDGDGGG 814 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG G G G GGG G Sbjct: 791 GGGGGGGGGGGGDGGGYGDGDGGGGGGGG 819 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GG G GGG G Sbjct: 792 GGGGGGGGGGGDGGGYGDGDGGGGGGGGG 820 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GG G G GGG GG GGG G Sbjct: 801 GGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG G G G GGG Sbjct: 785 GGGGGGGGGGGGGGGGGGDGGGYGDGDGGG 814 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G G G GGG GGG GG G G Sbjct: 804 GGGYGDGDGGGGGGGGGGGGGGDGGGYGDG 833 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG G GGG GG GGG Sbjct: 833 GGGFGDGGGYADGDGGGGGGGGGGGGGGGG 862 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPP---PXXPPXPXXPPP 993 P PPP PP PP P PP P PPP Sbjct: 219 PGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPP 250 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PPP PPP PP Sbjct: 208 PPNAPPGLMPPPGMLPPPGGMPP 230 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPP---XPXXPPP 993 P PPP PP PPP PP P PPP Sbjct: 211 PMGGPPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 PP PP PP PPP PP Sbjct: 210 PPMGGPPPMGGPPGGYPPPPPPP 232 Score = 29.1 bits (62), Expect = 5.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 P P P PPP PPP PP P Sbjct: 199 PYPGQPGMWGPPPMGGPPPMGGPPGGYPPP 228 Score = 28.7 bits (61), Expect = 7.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPP 990 PPP PP PP P P PP Sbjct: 209 PPPMGGPPPMGGPPGGYPPPPPPP 232 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 177 GGGGYGGGGHGGGGYGGGGYGGGGGGYGG 205 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 187 GGGGYGGGGYGGGGGGYGGSGYGGGGGYG 215 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GG GGG Sbjct: 167 GGGGYGGGGYGGGGYGGGGHGGGG 190 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GG GGG Sbjct: 172 GGGGYGGGGYGGGGHGGGGYGGGG 195 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GG GGG Sbjct: 177 GGGGYGGGGHGGGGYGGGGYGGGG 200 Score = 32.3 bits (70), Expect = 0.63 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GG G Sbjct: 182 GGGGHGGGGYGGGGYGGGGGGYGGSGYGG 210 Score = 32.3 bits (70), Expect = 0.63 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GG GG GGG G Sbjct: 193 GGGYGGGGGGYGGSGYGGGGGYGGGGYGG 221 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GG GGG GGG GG GGG Sbjct: 198 GGGGGYGGSGYGGGGGYGGGGYGGGRSGGG 227 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG G GGG G Sbjct: 145 GGGYRGGGGYRGGGGGYRGRGRGGGGYGG 173 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGG 921 GGG G GG GGG GG GG Sbjct: 167 GGGGYGGGGYGGGGYGGGGHGGGG 190 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGG 921 GGG G GG GGG GG GG Sbjct: 172 GGGGYGGGGYGGGGHGGGGYGGGG 195 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GG G GG GGG GG GGG Sbjct: 204 GGSGYGGGGGYGGGGYGGGRSGGGG 228 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 985 GXXGXGXXXGGGXXGGGXXXGGXXGXG 905 G G G GGG GGG GG G G Sbjct: 169 GGYGGGGYGGGGYGGGGHGGGGYGGGG 195 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 985 GXXGXGXXXGGGXXGGGXXXGGXXGXG 905 G G G GGG GGG GG G G Sbjct: 174 GGYGGGGYGGGGHGGGGYGGGGYGGGG 200 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 989 GGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GG G G GGG GG GGG G Sbjct: 129 GGGYGGGRGGGGGYRSGGGYRGGGGYRG 156 Score = 28.7 bits (61), Expect = 7.8 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = -2 Query: 992 GGGXXGXG---GXXGGGXXXGGXXXGGGXXXG 906 GGG G G G GGG GG GGG G Sbjct: 158 GGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGG 189 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G G G GGG GGG G GGG Sbjct: 199 GGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 690 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 691 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 692 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 693 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 694 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 695 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 696 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 697 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 698 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 671 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 673 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 675 GGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 676 GGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGG 686 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGG 688 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGG 689 Score = 32.3 bits (70), Expect = 0.63 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GG G Sbjct: 678 GGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 32.3 bits (70), Expect = 0.63 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GG G Sbjct: 680 GGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 32.3 bits (70), Expect = 0.63 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG G G G Sbjct: 682 GGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 32.3 bits (70), Expect = 0.63 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG G G G Sbjct: 686 GGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG G G Sbjct: 674 GGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG G G Sbjct: 677 GGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG G G G Sbjct: 679 GGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG G G G Sbjct: 681 GGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGG 103 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GGG G GG GGG GG GGG Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGGGG 104 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GG GG GGG Sbjct: 75 GGDTDGGGGCGGGGGGGGGVGGGGGGGGGG 104 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GGG G GG GG GG GGG Sbjct: 81 GGGCGGGGGGGGGVGGGGGGGGGGG 105 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG G GG G Sbjct: 88 GGGGGGVGGGGGGGGGGGDDCEDGGGDDG 116 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 34.3 bits (75), Expect = 0.16 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP PP PP PP P PPP Sbjct: 966 PGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 33.5 bits (73), Expect = 0.27 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PPP PP PPP P Sbjct: 954 PPPPPPGGSAPPPGGGAPPLPPPPGGSAPP 983 Score = 32.3 bits (70), Expect = 0.63 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PPP PPP Sbjct: 971 PPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP P PPP P PPP Sbjct: 931 PLPPPPPGGSAPSQPPPPGGNAPPPPPPP 959 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +1 Query: 919 PPPXXXPPXXXPPP--XXPPXPXXPPP 993 PPP P PPP PP P PPP Sbjct: 964 PPPGGGAPPLPPPPGGSAPPPPPPPPP 990 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP P PPP PP PPP P Sbjct: 936 PPGGSAPSQPPPPGGNAPPPPPPPGGSAPP 965 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXP---PPXXPPPXXXXXP 994 PPP PP PPP P PP PPP P Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPP 406 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PPP PPP PP P Sbjct: 368 PPPTNKPPPPPPPTNGPPPPPPPTNGPPPP 397 Score = 33.5 bits (73), Expect = 0.27 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PPP PPP PP P Sbjct: 378 PPPTNGPPPPPPPTNGPPPPPPPTNGPPPP 407 Score = 33.1 bits (72), Expect = 0.36 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PP PP P PPP Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPP--PPP 400 Score = 33.1 bits (72), Expect = 0.36 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PP PP P PPP Sbjct: 384 PPPPPPPTNGPPPPPPPTNGPPPP--PPP 410 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 PPP P PPP PPP PP Sbjct: 388 PPPTNGPPPPPPPTNGPPPPPPP 410 Score = 31.9 bits (69), Expect = 0.83 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 906 PXPXXPPXXXPPPXXPPPXXXPXPXXP 986 P P PP PPP PP P P P Sbjct: 384 PPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PPP PP PP P Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPP 377 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PPP PPP PP P Sbjct: 358 PPPTNNTPPPPPPTNKPPPPPPPTNGPPPP 387 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP P PP PP P PPP Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPP--PPP 380 Score = 29.9 bits (64), Expect = 3.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PPP PP PPP P Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPPPPTNGPPP 386 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 912 PXXPPXXXPPPXXPPPXXXPXPXXP 986 P PP PP PPP P P P Sbjct: 365 PPPPPPTNKPPPPPPPTNGPPPPPP 389 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 912 PXXPPXXXPPPXXPPPXXXPXPXXP 986 P PP PPP PP P P P Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPPP 390 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPP 990 PPP P PPP P P PP Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPPPP 390 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP PP PPP PP P PP Sbjct: 389 PPTNGPPPPPPPTNGPPP--PPPPTNGPP 415 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PP PP P P P Sbjct: 1575 PITPPPPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 28.7 bits (61), Expect = 7.8 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 1/25 (4%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPP-PXXPPP 976 PPP P PPP PP P P P Sbjct: 1579 PPPTPSPPQTPPPVNTPPRPETPEP 1603 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GG GGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GG GGG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GGG G GG GGG GG GGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GG G G Sbjct: 56 GGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GGG G GG GGG GG G G Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 985 GXXGXGXXXGGGXXGGGXXXGGXXGXG 905 G G G GGG GGG GG G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG G G Sbjct: 56 GGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GG GGG Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGG 48 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G G GGG GG GGG G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGG 53 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GG GGG Sbjct: 105 GGGYGGGGGYGGGGRSYGGGGGGG 128 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GGG G GG GGG GG GGG Sbjct: 105 GGGYGGGGGYGGGGRSYGGGGGGGG 129 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GGG GG GGG GG GGG Sbjct: 93 GGGRRERGGRGGGGGYGGGGGYGGG 117 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG G GGG Sbjct: 104 GGGGYGGGGGYGGGGRSYGGGGGG 127 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GGG G GG GGG G GGG Sbjct: 104 GGGGYGGGGGYGGGGRSYGGGGGGG 128 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 33.9 bits (74), Expect = 0.21 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPP 973 PP PP PPP PPP PP Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PPP PPP P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 922 PPXXXPPXXXPPPXXPPXPXXPPP 993 PP PP PPP PP P P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 921 PPXXXPPPXXPPPXXXPXPXXP 986 PP PPP PPP P P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 33.5 bits (73), Expect = 0.27 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P P P PP PPP P P PPP Sbjct: 302 PQYMPHPRMRPPTRIPPPGMGPPPRIPPP 330 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPP 990 P PP PP PPP PP P P Sbjct: 308 PRMRPPTRIPPPGMGPPPRIPPPPIRAP 335 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 922 PPXXXPPXXXPPPXXPPXPXXPPP 993 PP PP PPP P P PPP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 32.7 bits (71), Expect = 0.48 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PPP P PPP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 29.9 bits (64), Expect = 3.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 371 PPPPPPGRRPPSGKINPPPPPPP 393 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 PP PP PPP PPP PP Sbjct: 243 PPHSMPPPGMPPPGMMPPPGFPP 265 Score = 32.7 bits (71), Expect = 0.48 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPP 990 PPP PP PPP P P PP Sbjct: 242 PPPHSMPPPGMPPPGMMPPPGFPP 265 Score = 32.3 bits (70), Expect = 0.63 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP P PPP PPP Sbjct: 259 PPPGFPPMGMPGMGGMPPPGMPPP 282 Score = 29.9 bits (64), Expect = 3.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PP P PPP Sbjct: 249 PPGMPPPGMMPPPGFPPMGMPGMGGMPPP 277 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP P PPP PPP PPP P Sbjct: 236 PPMGAP---PPPHSMPPPGMPPPGMMPPP 261 Score = 28.7 bits (61), Expect = 7.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PPP PPP Sbjct: 280 PPPMPPGGMPPNMEQPPP--PPP 300 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PPP PPP P P Sbjct: 232 PPTAPPNTPPPPVTPPPPNTPGP 254 Score = 32.3 bits (70), Expect = 0.63 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 P P PP PPP PP P P P Sbjct: 230 PKPPTAPPNTPPPPVTPPPPNTPGP 254 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 922 PPXXXPPXXXPPPXXPPXPXXPPP 993 P PP PPP PP P PPP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPP 82 Score = 32.7 bits (71), Expect = 0.48 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 P PP PPP PPP PPP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPP 82 Score = 29.1 bits (62), Expect = 5.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXP 978 P PP PP PPP PP P Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPP 82 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 922 PPXXXPPXXXPPPXXPPXPXXPPP 993 P PP PPP PP P PPP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPP 306 Score = 32.7 bits (71), Expect = 0.48 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 P PP PPP PPP PPP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPP 306 Score = 29.1 bits (62), Expect = 5.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXP 978 P PP PP PPP PP P Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPP 306 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPP 990 PPP PP PPP PP PP Sbjct: 363 PPPPPPPPVGGPPPPPPPIEGRPP 386 Score = 29.9 bits (64), Expect = 3.4 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +2 Query: 905 PPPXX---PPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP PPP PPP P Sbjct: 355 PPPVGGAAPPPPPPPPVGGPPP--PPPPIEGRP 385 Score = 29.9 bits (64), Expect = 3.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP P PP P Sbjct: 364 PPPPPPPVGGPPPPPPPIEGRPPSSLGNPP 393 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PP P PPP P Sbjct: 374 PPPPPPPIEGRPPSSLGNPPPPPPPGRGAP 403 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PP PP PPP P Sbjct: 375 PPPPPPIEGRPPSSLGNPPPPPPPGRGAPP 404 Score = 29.1 bits (62), Expect = 5.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PP PP PP P Sbjct: 363 PPPPPPPPVGGPPPPPPPIEGRPPSSLGNP 392 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 32.7 bits (71), Expect = 0.48 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 920 PPXXXPPPXXXPPPXXPPPXXXXXP 994 PP PPP PPP PPP P Sbjct: 74 PPLCAPPPPPPPPPPPPPPPGAKKP 98 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXP 978 PPP PP PPP PP P Sbjct: 73 PPPLCAPPPPPPPPPPPPPP 92 Score = 29.1 bits (62), Expect = 5.9 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 PPP P PPP PPP PP Sbjct: 73 PPPLCAPPPPPPPP--PPPPPPP 93 Score = 28.7 bits (61), Expect = 7.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 937 PPXXXPPPXXPPXPXXPPP 993 PP PP PP P PPP Sbjct: 73 PPPLCAPPPPPPPPPPPPP 91 Score = 28.7 bits (61), Expect = 7.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXP 987 P PPP PP PPP P P Sbjct: 75 PLCAPPPPPPPPPPPPPPPGAKKPDDP 101 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 32.7 bits (71), Expect = 0.48 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP P PPP PP PPP Sbjct: 196 PPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 28.7 bits (61), Expect = 7.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 PPP PP P PPP PP Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPP 217 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 32.7 bits (71), Expect = 0.48 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 920 PPXXXPPPXXXPPPXXPPPXXXXXP 994 PP PPP PPP PPP P Sbjct: 275 PPLCAPPPPPPPPPPPPPPPGAKKP 299 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXP 978 PPP PP PPP PP P Sbjct: 274 PPPLCAPPPPPPPPPPPPPP 293 Score = 29.1 bits (62), Expect = 5.9 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 PPP P PPP PPP PP Sbjct: 274 PPPLCAPPPPPPPP--PPPPPPP 294 Score = 28.7 bits (61), Expect = 7.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 937 PPXXXPPPXXPPXPXXPPP 993 PP PP PP P PPP Sbjct: 274 PPPLCAPPPPPPPPPPPPP 292 Score = 28.7 bits (61), Expect = 7.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXP 987 P PPP PP PPP P P Sbjct: 276 PLCAPPPPPPPPPPPPPPPGAKKPDDP 302 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 32.3 bits (70), Expect = 0.63 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG G G GG GGG G Sbjct: 156 GGGEGGWGGRGGNGGGRGGGEGGGGRGRG 184 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG G G G G GG GGG Sbjct: 150 GGGRGRGGGEGGWGGRGGNGGGRGGGEGGG 179 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 32.3 bits (70), Expect = 0.63 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PPP PPP PPP Sbjct: 188 PP--PPSGGPPPPPPPPPPPPPP 208 Score = 31.9 bits (69), Expect = 0.83 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP P PPP PPP PPP Sbjct: 188 PPP--PSGGPPPPPPPPPPPPPPP 209 Score = 31.9 bits (69), Expect = 0.83 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 937 PPXXXPPPXXPPXPXXPPP 993 PP PPP PP P PPP Sbjct: 190 PPSGGPPPPPPPPPPPPPP 208 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXP 978 PPP PP PPP PP P Sbjct: 189 PPPSGGPPPPPPPPPPPPPP 208 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP PPP Sbjct: 191 PSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 4/29 (13%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXP----XXPPP 993 PP PP PPP PP P PPP Sbjct: 190 PPSGGPPPPPPPPPPPPPPPILELAAPPP 218 Score = 29.1 bits (62), Expect = 5.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PPP PPP Sbjct: 196 PPPPPPPPPPPPPPILELAAPPPP 219 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG G G GG GGG G Sbjct: 82 GGGGDGDGGGGGDGDGGGGGDGGGGGDGG 110 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GG G GGG G Sbjct: 77 GGGCDGGGGDGDGGGGGDGDGGGGGDGGG 105 Score = 28.7 bits (61), Expect = 7.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG GGG GGG GG G G Sbjct: 73 GGGDGGGCDGGGGDGDGGGGGDG 95 Score = 28.7 bits (61), Expect = 7.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG G G GGG GG GGG Sbjct: 89 GGGGGDGDGGGGGDGGGGGDGGG 111 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GG G Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGGDG 93 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG G GGG G Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGG 94 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GG GG GGG G Sbjct: 71 GGGGGGGGGGGGGDDGDGGGGDGGGGGGG 99 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GG GG GGG G Sbjct: 81 GGGDDGDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 G G G GG GGG GG GGG G Sbjct: 86 GDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG G GGG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGG 91 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GG GG GGG Sbjct: 70 GGGGGGGGGGGGGGDDGDGGGGDGGGGGGG 99 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GG GG GGG Sbjct: 82 GGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG G G GG GGG Sbjct: 83 GDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = -2 Query: 992 GGGXXGXGGXXG-GGXXXGGXXXGGGXXXG 906 GGG G GG G GG GG GGG G Sbjct: 75 GGGGGGGGGDDGDGGGGDGGGGGGGGDGGG 104 Score = 29.1 bits (62), Expect = 5.9 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGG--XXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGG 95 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GGG G Sbjct: 67 GGGGGGGGGGGGGGGGGDDGDGGGGDGGG 95 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG G GG G Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGG 96 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G G GGG GG G G G Sbjct: 78 GGGGGGDDGDGGGGDGGGGGGGGDGGGGG 106 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG G G GG GGG G Sbjct: 97 GGGGDGDGGGGGDGDGGGGGDGGGGGDGG 125 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GG G GGG G Sbjct: 92 GGGCDGGGGDGDGGGGGDGDGGGGGDGGG 120 Score = 28.7 bits (61), Expect = 7.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG GGG GGG GG G G Sbjct: 88 GGGDGGGCDGGGGDGDGGGGGDG 110 Score = 28.7 bits (61), Expect = 7.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG G G GGG GG GGG Sbjct: 104 GGGGGDGDGGGGGDGGGGGDGGG 126 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGG 907 G GGG GGG GGG GG GG Sbjct: 768 GGGGYRGGGGYGGGHRGGGGYGGGGHRGG 796 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GG GG GGG G Sbjct: 762 GGGYGGGGGGYRGGGGYGGGHRGGGGYGG 790 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GG GG GGG Sbjct: 763 GGYGGGGGGYRGGGGYGGGHRGGGGYGGGG 792 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GG GGG GGG GG GGG Sbjct: 757 GGYRGGGGYGGGGGGYRGGGGYGGGHRGGG 786 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 750 GYGNRSGGGYRGGGGYGGGG---GGYRGGG 776 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP P PPP PP P PPP Sbjct: 959 PPPI--PATQVPPPPLPPLPPPPPP 981 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPP 976 PP P PPP P P PPP Sbjct: 959 PPPIPATQVPPPPLPPLPPPPPP 981 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG GGG GGG GG GGG Sbjct: 342 GGGGGGGGGGGGGGGGGGRGGGG 364 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 989 GGXXGXGGXXGGGXXXGGXXXGGG 918 GG G GG GGG GG GGG Sbjct: 342 GGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 G G GGG GGG GG GGG Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGGG 363 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG G GGG Sbjct: 342 GGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 G G G GG GGG GG GGG Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGGGG 364 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 986 GXXGXGGXXGGGXXXGGXXXGGGXXXG 906 G G GG GGG GG GGG G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGG 363 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GG G GG GGG GG G G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGG 365 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG GGG GGG GG GGG Sbjct: 94 GGGGGGGFGGGGGGGFGGGGGGG 116 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG G GGG G Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFGGG 112 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG G G GG GGG G Sbjct: 89 GGGGFGGGGGGGFGGGGGGGFGGGGGGGG 117 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GG GG GGG G Sbjct: 90 GGGFGGGGGGGFGGGGGGGFGGGGGGGGG 118 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G G GGG GG GGG G Sbjct: 94 GGGGGGGFGGGGGGGFGGGGGGGGGFGGG 122 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GG GG GGG G Sbjct: 98 GGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 G G G GG GGG GG GGG G Sbjct: 100 GFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GG GGG GG GGG Sbjct: 88 GGGGGFGGGGGGGFGGGGGGGFGGGGGGGG 117 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG G G GGG GG GGG Sbjct: 97 GGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG G G Sbjct: 99 GGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 29.9 bits (64), Expect = 3.4 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 91 GGFGGGGGGGFGGG--GGGGFGGGGGGGGG 118 Score = 29.9 bits (64), Expect = 3.4 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = -1 Query: 993 GXXXXXGGG-XXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 92 GFGGGGGGGFGGGGGGGFGGGGGGGGGFGGG 122 Score = 29.9 bits (64), Expect = 3.4 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 96 GGGGGFGGG--GGGGFGGGGGGGGGFGGGG 123 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG G GGG Sbjct: 195 GGGDYGGGPGYGGGQGYGSYSGGG 218 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG GGG GGG GG GGG Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGG 334 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 989 GGXXGXGGXXGGGXXXGGXXXGGG 918 GG G GG GGG GG GGG Sbjct: 322 GGGGGYGGGRGGGRGYGGGRGGGG 345 Score = 29.9 bits (64), Expect = 3.4 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 317 GGYRSGGGGGYGGGR--GGGRGYGGGRGGG 344 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GG GGG Sbjct: 117 GGGRGGGGY--GGGRGGGGSYGGG 138 Score = 29.1 bits (62), Expect = 5.9 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGG 907 GGG GGG GGG G GG Sbjct: 93 GGGSQGGGYRSGGGGYGGSSRGG 115 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG GG GG GG GGG G Sbjct: 316 GGGYRSGGGGGYGGGRGGGRGYGGGRGGG 344 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP PPP PP PPP Sbjct: 189 PPPA--PPGVLPPPPAPPGALIPPP 211 Score = 29.9 bits (64), Expect = 3.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PPP P PPP Sbjct: 189 PPPAPPGVLPPPPAPPGALIPPP 211 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 PP PP PP PPP PP Sbjct: 193 PPGVLPPPPAPPGALIPPPPAPP 215 Score = 29.1 bits (62), Expect = 5.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 912 PXXPPXXXPPPXXPPPXXXPXPXXP 986 P PP PPP PP P P P Sbjct: 190 PPAPPGVLPPPPAPPGALIPPPPAP 214 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 906 PXPXXPPXXXPPPXXPPPXXXPXPXXP 986 P P PP PPP P P P P P Sbjct: 434 PLPQPPPSIIPPPTTPLPQTVPTPPRP 460 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 P PP PPP PPP P P P Sbjct: 429 PSHPPPLPQPPPSIIPPPTTPLPQTVPTP 457 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPP 990 P PPP PP P P P P PP Sbjct: 434 PLPQPPPSIIPPPTTPLPQTVPTPPRPP 461 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +2 Query: 905 PPPXXPPX--XXPPPXXXPPPXXPPP 976 PPP PP PPP PP PPP Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPP 455 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GG G GG GGG GG GGG G Sbjct: 1771 GGMAGGGGGMGGGGMAAGGGEFGGGEGMG 1799 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G G GGG GG GGG G Sbjct: 1777 GGGMGGGGMAAGGGEFGGGEGMGGGGMAG 1805 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG G G Sbjct: 1782 GGGMAAGGGEFGGGEGMGGGGMAGGGGGMG 1811 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG G GGG Sbjct: 1801 GGMAGGGGGMGGGGGGMGGGGEGMGAAGGG 1830 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GG GG Sbjct: 1759 GGGGGGGGMGGGGGMAGGGGGMGG 1782 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GGG G G GGG GG GGG Sbjct: 1759 GGGGGGGGMGGGGGMAGGGGGMGGG 1783 Score = 29.9 bits (64), Expect = 3.4 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 1794 GGEGMGGGGMAGGGGGMGGG--GGGMGGGG 1821 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = -2 Query: 992 GGGXXGXGG--XXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 1764 GGGMGGGGGMAGGGGGMGGGGMAAGGGEFGG 1794 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGG 907 G GG GGG GGG GG GG Sbjct: 1788 GGGEFGGGEGMGGGGMAGGGGGMGGGGGG 1816 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 906 PXPXXPPXXXPPPXXPPPXXXP 971 P P PP PPP PPP P Sbjct: 461 PIPPPPPMSPPPPTPPPPATSP 482 Score = 29.1 bits (62), Expect = 5.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 923 PXXXPPPXXXPPPXXPPP 976 P PPP PPP PPP Sbjct: 461 PIPPPPPMSPPPPTPPPP 478 Score = 29.1 bits (62), Expect = 5.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 940 PXXXPPPXXPPXPXXPPP 993 P PPP PP P PPP Sbjct: 461 PIPPPPPMSPPPPTPPPP 478 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXP 970 PPP PP PPP PP P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPP 973 PP PP PPP PPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 912 PXXPPXXXPPPXXPPPXXXPXPXXP 986 P PP PPP PPP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 920 PPXXXPPPXXXPPPXXPPPXXXXXP 994 PP PPP PPP PP P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GGG G GG GGG GG G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDG 65 Score = 28.7 bits (61), Expect = 7.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGG 907 GGG GGG GGG GG G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDG 63 Score = 28.7 bits (61), Expect = 7.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG GGG GGG GG G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDG 63 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP PP PP PP PPP Sbjct: 49 PPVTQPPVTQPPVTQPPVTQPPVTQPPPP 77 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 P P P PPP PPP PP P Sbjct: 522 PAPQPPSPPAPPPKPAPPPRSPPAAAPCNP 551 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPP--XXPPP 976 PPP P PPP PPP PPP Sbjct: 383 PPPMIGPVTVPPPPLIPPPQASIPPP 408 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 PPP PP P PPP PP Sbjct: 1034 PPPTEPPTPPPTEPPTPPPTDPP 1056 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P P P P P P PP P PPP Sbjct: 653 PPLAPYPPKTSPKTTPKPHIPPAPSRPPP 681 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PP PPP PP P Sbjct: 1255 PPPGMRPMPPQPPFMPPPPRMQPPGPPGPP 1284 Score = 29.1 bits (62), Expect = 5.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP P PP PP P PP Sbjct: 1254 PPPPGMRPMPPQPPFMPPPPRMQPP 1278 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP P PPP P PPP Sbjct: 324 PSQAPPPPKTIPSTLPPPPVPSATSAPPP 352 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 PPP P PPP PP PP Sbjct: 2174 PPPMGAPPSGPPPMGAPPSGPPP 2196 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 PPP P PPP PP PP Sbjct: 2184 PPPMGAPPSGPPPMGTPPSGHPP 2206 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PP P P PPP Sbjct: 2170 PPSVPPPMGAPPSGPPPMGAP--PSGPPP 2196 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PP P P PPP Sbjct: 2190 PPSGPPPMGTPPSGHPPMGAP--PMGPPP 2216 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GGG G GG GG GG GGG Sbjct: 217 GGGRGGGGGYGGGRRDYGGGSKGGG 241 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 G G GG GGG GG GGG G Sbjct: 201 GSSRGGYGGGRGGGGYGGGRGGGGGYGGG 229 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GG GGG Sbjct: 208 GGGRGGGGY--GGGRGGGGGYGGG 229 Score = 29.1 bits (62), Expect = 5.9 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGG 907 GGG GGG GGG G GG Sbjct: 184 GGGSQGGGYRSGGGGYGGSSRGG 206 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 911 PXXPPXXXPPPXXXPPPXXPPP 976 P P PPP PPP PPP Sbjct: 351 PKTHPQLGPPPPPPPPPPTPPP 372 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +1 Query: 919 PPPXXXP---PXXXPPPXXPPXPXXPPP 993 PP P P PPP PP P PPP Sbjct: 345 PPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 >SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) Length = 246 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXP---XXPPP 993 PPP PP PPP P P PPP Sbjct: 158 PPPSSSPPLSSPPPPPPSTPSSSLLPPP 185 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 29.9 bits (64), Expect = 3.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 PPP PP P PPP PP Sbjct: 84 PPPPPPPASNVPAPPPPPPVMPP 106 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPP 990 PPP PP P PP P PP Sbjct: 83 PPPPPPPPASNVPAPPPPPPVMPP 106 Score = 28.7 bits (61), Expect = 7.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP P PPP PP Sbjct: 83 PPPPPPPPASNVPAPPPPPPVMPP 106 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 29.9 bits (64), Expect = 3.4 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGG-GXXXGGXXGGG 904 G GGG GGG GG G GG GGG Sbjct: 110 GYGGGRGGGGYGGGRGGGGYGGGRGGGYGGG 140 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 989 GGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GG G GG G G GG GGG G Sbjct: 40 GGGGGNGGGAGNGVGAGGCGCGGGNDGG 67 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 29.9 bits (64), Expect = 3.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 283 PPPPPPGRRPPSGKINPPPPPPP 305 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 29.9 bits (64), Expect = 3.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP P PP PP PPP Sbjct: 182 PPPGAPAAPPAPPFGGPPSAPPPP 205 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP P P P PP PPP Sbjct: 181 PPPPGAPAAPPAPPFGGPPSAPPP 204 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 29.9 bits (64), Expect = 3.4 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 47 GGATGGGGGATGGGATGGGGGATGG--GGG 74 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 29.9 bits (64), Expect = 3.4 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXG-GGXXXGGXXGGG 904 G GGG GGG G GG GG GGG Sbjct: 197 GSKGGYGGGSGGGGYGGGRGGGGYGGGHGGG 227 Score = 29.9 bits (64), Expect = 3.4 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 201 GYGGGSGGGGYGGG--RGGGGYGGGHGGGG 228 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 985 GXXGXGXXXGGGXXGGGXXXGGXXGXG 905 G G G GGG GGG GG G G Sbjct: 207 GGGGYGGGRGGGGYGGGHGGGGYGGGG 233 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GG GGG Sbjct: 212 GGGRGGGGY--GGGHGGGGYGGGG 233 Score = 28.7 bits (61), Expect = 7.8 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXG--GXXGGG 904 GGG GGG GGG G G GGG Sbjct: 180 GGGSQGGGYRSGGGGYGGSKGGYGGG 205 Score = 28.7 bits (61), Expect = 7.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGG 921 GG G GG GGG GG GG Sbjct: 196 GGSKGGYGGGSGGGGYGGGRGGGG 219 Score = 28.7 bits (61), Expect = 7.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGG 921 G G G GG GGG GG GG Sbjct: 205 GSGGGGYGGGRGGGGYGGGHGGGG 228 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 29.9 bits (64), Expect = 3.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPP 976 PP PP P PPP PPP Sbjct: 755 PPPPPPPAVPGEGARPPPPPPPP 777 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 29.9 bits (64), Expect = 3.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPP 990 PPP PP PP PP PP Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPP 119 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PP PPP P P P Sbjct: 96 PPPATPPPPTMPPTP-PPPQTPAPPGPDTP 124 Score = 29.1 bits (62), Expect = 5.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP PP PP PP Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPP 119 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GG GGG Sbjct: 336 GGGDPGGGDP-GGGDPGGGDPGGG 358 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GG GGG Sbjct: 341 GGGDPGGGDP-GGGDPGGGDPGGG 363 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GG GGG Sbjct: 346 GGGDPGGGDP-GGGDPGGGDHGGG 368 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GG GGG Sbjct: 351 GGGDPGGGDP-GGGDHGGGDHGGG 373 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 1/23 (4%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPP-PXXPP 973 PP PP PPP PP P PP Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPP 51 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 922 PPXXXPPXXXPPPXXPPXPXXPP 990 PP P PPP PP P PP Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPP 51 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PPP PPP Sbjct: 696 PPPPPPPPLLSGTLPMPPPPPPPP 719 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP PPP P Sbjct: 697 PPPPPPPLLSGTLPMPPPPPPPPPGCAGLP 726 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 304 GDGDGGGGGDGGGG---GGGGGGGGGDGGG 330 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGG 907 G GGG GG GGG GG GG Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGG 330 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 G G G G GGG GG GGG G Sbjct: 306 GDGGGGGDGGGGGGGGGGGGGDGGGDGDG 334 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG GG GGG GG G G G Sbjct: 308 GGGGGDGGGGGGGGGGGGGDGGGDGDGDG 336 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG G G G G Sbjct: 310 GGGDGGGGGGGGGGGGGDGGGDGDGDGDG 338 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG G G G Sbjct: 311 GGDGGGGGGGGGGGGGDGGGDGDGDGDGDG 340 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PP PPP PPP P Sbjct: 1057 PPPRKPSP--PPSEPAPPPRQPPPPSTSQP 1084 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Frame = +2 Query: 905 PPPXXPPXXXPPP-XXXPPPXXPPPXXXXXP 994 PP PP PP PPP PPP P Sbjct: 279 PPRWGPPPHMPPDYRGFPPPNFPPPDFSRPP 309 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GG GG GGG GG GGG G Sbjct: 181 GGDGGDDGGGSGGGGDDGGSDGGGGGNDG 209 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPP-PXXPPPXXXXXP 994 PPP PPP PP P PPP P Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAP 152 Score = 28.7 bits (61), Expect = 7.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP PP P PPP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPP 146 Score = 28.7 bits (61), Expect = 7.8 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 1/25 (4%) Frame = +1 Query: 919 PPPXXXPP-XXXPPPXXPPXPXXPP 990 PPP PP PPP P P PP Sbjct: 132 PPPVTPPPGPETPPPPDTPAPPVPP 156 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXP--XXPPP 993 P PPP PPP PP P PPP Sbjct: 661 PPPPPPPPGGQAGGAPPPPPPPLPGGAAPPP 691 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 29.1 bits (62), Expect = 5.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 906 PXPXXPPXXXPPPXXPPP 959 P P PP PPP PPP Sbjct: 424 PPPPPPPAPLPPPPPPPP 441 Score = 29.1 bits (62), Expect = 5.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 923 PXXXPPPXXXPPPXXPPP 976 P PPP PPP PPP Sbjct: 424 PPPPPPPAPLPPPPPPPP 441 Score = 28.7 bits (61), Expect = 7.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP P PPP PP P P Sbjct: 424 PPPPPPPAPLPPPPPPPPQPTTALP 448 >SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 29.1 bits (62), Expect = 5.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 906 PXPXXPPXXXPPPXXPPP 959 P P PP PPP PPP Sbjct: 169 PNPSPPPSGAPPPPPPPP 186 Score = 29.1 bits (62), Expect = 5.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 923 PXXXPPPXXXPPPXXPPP 976 P PPP PPP PPP Sbjct: 169 PNPSPPPSGAPPPPPPPP 186 >SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) Length = 361 Score = 29.1 bits (62), Expect = 5.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 969 GXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GG GGG Sbjct: 151 GRGGGGRRGGGGCCGGGGGGGG 172 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 29.1 bits (62), Expect = 5.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXG 910 GGG GGG GGG GG G Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRGG 1024 >SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) Length = 185 Score = 29.1 bits (62), Expect = 5.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXG 910 GGG GGG GGG GG G Sbjct: 124 GGGDGGGGSDGGGGSDGGGGDG 145 >SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) Length = 278 Score = 29.1 bits (62), Expect = 5.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 969 GXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GG GGG Sbjct: 68 GRGGGGRRGGGGCCGGGGGGGG 89 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 29.1 bits (62), Expect = 5.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPP 990 PP PP PP PP P PP Sbjct: 1259 PPLPPLPPPDAQPPSLPPQPPQPP 1282 >SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G G GG GG GGG G Sbjct: 158 GGGDGGDDGDGGGDDDDGGDGDGGGDDGG 186 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG GG GG GG GGG G Sbjct: 168 GGGDDDDGGDGDGGGDDGGGADGGGADGG 196 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GG GG GGG GG GGG Sbjct: 163 GDDGDGGGDDDDGGDGDGGGDDGGGADGGG 192 >SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) Length = 224 Score = 29.1 bits (62), Expect = 5.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 969 GXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GG GGG Sbjct: 151 GRGGGGRRGGGGCCGGGGGGGG 172 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 28.7 bits (61), Expect = 7.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 P P P PPP PP PPP Sbjct: 566 PLPPSEDPKPPPPPPEPPEECPPPP 590 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 28.7 bits (61), Expect = 7.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGG 907 GGG GGG GG GG GG Sbjct: 446 GGGDGGGGGDGGGDGIDGGDGGG 468 Score = 28.7 bits (61), Expect = 7.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG GGG GGG G GGG Sbjct: 446 GGGDGGGGGDGGGDGIDGGDGGG 468 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 28.7 bits (61), Expect = 7.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXG 924 GGG G GG GGG GG G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGRG 536 >SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.7 bits (61), Expect = 7.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGG 907 GGG GG GGG GG GG Sbjct: 6 GGGDGDGGDGDGGGGGDGGGDGG 28 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PP PP P PP Sbjct: 79 PFPPPPPIYMPP---PPVYMPPPPVYMPP 104 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,954,090 Number of Sequences: 59808 Number of extensions: 144389 Number of successful extensions: 7735 Number of sequences better than 10.0: 96 Number of HSP's better than 10.0 without gapping: 516 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3325 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2967383049 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -