BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_P19 (996 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 41 0.001 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 40 0.003 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 40 0.003 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 40 0.003 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 40 0.003 At4g33660.1 68417.m04781 expressed protein 38 0.010 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 37 0.018 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 37 0.018 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 37 0.018 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 37 0.024 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 36 0.042 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 36 0.042 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 36 0.055 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 36 0.055 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 35 0.073 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 35 0.097 At1g75550.1 68414.m08780 glycine-rich protein 35 0.097 At5g46730.1 68418.m05757 glycine-rich protein 34 0.13 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 34 0.13 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 34 0.17 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 34 0.17 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 34 0.17 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 34 0.17 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 33 0.22 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 33 0.22 At2g05530.1 68415.m00585 glycine-rich protein 33 0.22 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 33 0.39 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 33 0.39 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 32 0.52 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 32 0.52 At4g08230.1 68417.m01358 glycine-rich protein 32 0.52 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 32 0.52 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 32 0.52 At1g70990.1 68414.m08190 proline-rich family protein 32 0.52 At1g61080.1 68414.m06877 proline-rich family protein 32 0.52 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 32 0.52 At1g10620.1 68414.m01204 protein kinase family protein contains ... 32 0.52 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 28 0.68 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 32 0.68 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 32 0.68 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 32 0.68 At4g01985.1 68417.m00265 expressed protein 32 0.68 At2g30560.1 68415.m03722 glycine-rich protein 32 0.68 At1g53625.1 68414.m06096 expressed protein 32 0.68 At1g27710.1 68414.m03387 glycine-rich protein 32 0.68 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 26 0.74 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 31 0.90 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 31 0.90 At4g30460.1 68417.m04325 glycine-rich protein 31 0.90 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 31 0.90 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 31 0.90 At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1... 31 0.90 At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ b... 31 0.90 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 31 0.90 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 31 0.90 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 31 0.90 At2g05510.1 68415.m00583 glycine-rich protein 31 0.90 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 31 0.90 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 31 0.90 At1g29380.1 68414.m03592 hypothetical protein 31 0.90 At3g43583.1 68416.m04636 hypothetical protein 31 1.2 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 31 1.2 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 31 1.2 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 31 1.2 At1g07135.1 68414.m00759 glycine-rich protein 31 1.2 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 31 1.2 At5g25550.1 68418.m03040 leucine-rich repeat family protein / ex... 31 1.6 At3g50180.1 68416.m05486 hypothetical protein 31 1.6 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 31 1.6 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 31 1.6 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 31 1.6 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 31 1.6 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 31 1.6 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 31 1.6 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 31 1.6 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 30 2.1 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 30 2.1 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 30 2.1 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 30 2.1 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 30 2.1 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 30 2.1 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 30 2.1 At2g05440.2 68415.m00575 glycine-rich protein 30 2.1 At2g05440.1 68415.m00574 glycine-rich protein 30 2.1 At1g11850.2 68414.m01364 expressed protein 30 2.1 At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) 30 2.8 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 30 2.8 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 30 2.8 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 30 2.8 At3g49840.1 68416.m05449 proline-rich family protein contains pr... 30 2.8 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 30 2.8 At1g62240.1 68414.m07021 expressed protein 30 2.8 At1g35617.1 68414.m04424 hypothetical protein 30 2.8 At5g67600.1 68418.m08524 expressed protein 29 3.6 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 29 3.6 At5g07190.1 68418.m00819 embryo-specific protein 3, putative sim... 29 3.6 At4g18570.1 68417.m02749 proline-rich family protein common fami... 29 3.6 At3g26400.1 68416.m03292 eukaryotic translation initiation facto... 29 3.6 At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein... 29 3.6 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 29 3.6 At1g71830.1 68414.m08301 leucine-rich repeat family protein / pr... 29 3.6 At1g53640.1 68414.m06100 hypothetical protein ; expression suppo... 29 3.6 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 29 3.6 At5g61660.1 68418.m07736 glycine-rich protein 29 4.8 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 29 4.8 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 29 4.8 At5g57290.1 68418.m07157 60S acidic ribosomal protein P3 (RPP3B) 29 4.8 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 29 4.8 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 29 4.8 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 29 4.8 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 29 4.8 At4g29030.1 68417.m04151 glycine-rich protein glycine-rich prote... 29 4.8 At4g16240.1 68417.m02464 hypothetical protein 29 4.8 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 29 4.8 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 29 4.8 At3g51290.1 68416.m05614 proline-rich family protein 29 4.8 At3g46270.1 68416.m05008 receptor protein kinase-related contain... 29 4.8 At2g28670.1 68415.m03485 disease resistance-responsive family pr... 29 4.8 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 29 4.8 At1g63570.1 68414.m07186 receptor-like protein kinase-related co... 29 4.8 At1g34210.1 68414.m04245 somatic embryogenesis receptor-like kin... 29 4.8 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 29 4.8 At1g04800.1 68414.m00476 glycine-rich protein 29 4.8 At1g02710.1 68414.m00222 glycine-rich protein 29 4.8 At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family prot... 29 6.4 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 29 6.4 At5g07150.1 68418.m00815 leucine-rich repeat family protein cont... 29 6.4 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 29 6.4 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 29 6.4 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 29 6.4 At3g24550.1 68416.m03083 protein kinase family protein contains ... 29 6.4 At1g63550.1 68414.m07184 hypothetical protein low similarity to ... 29 6.4 At1g26150.1 68414.m03192 protein kinase family protein similar t... 29 6.4 At5g59950.3 68418.m07518 RNA and export factor-binding protein, ... 28 8.4 At5g59950.2 68418.m07519 RNA and export factor-binding protein, ... 28 8.4 At5g59950.1 68418.m07517 RNA and export factor-binding protein, ... 28 8.4 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 28 8.4 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 28 8.4 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 28 8.4 At5g38560.1 68418.m04662 protein kinase family protein contains ... 28 8.4 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 28 8.4 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 28 8.4 At4g29240.1 68417.m04182 leucine-rich repeat family protein / ex... 28 8.4 At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi... 28 8.4 At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / he... 28 8.4 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 28 8.4 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 40.7 bits (91), Expect = 0.001 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP PP P PPP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 40.7 bits (91), Expect = 0.001 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP PP P PPP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 40.7 bits (91), Expect = 0.001 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP PP P PPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP PPP PPP P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPYVYP 411 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP PPP PPP P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSP 413 Score = 39.5 bits (88), Expect = 0.003 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PPP PPP PPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 39.5 bits (88), Expect = 0.003 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PPP PPP PPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 39.5 bits (88), Expect = 0.003 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PPP PPP PPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 37.1 bits (82), Expect = 0.018 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 P P PP PPP PPP PPP P Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 36.7 bits (81), Expect = 0.024 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP P P PPP Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 36.3 bits (80), Expect = 0.032 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PPP P P PPP Sbjct: 395 PPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 35.5 bits (78), Expect = 0.055 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPP--XPXXPPP 993 P PPP PP PPP PP P PPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 35.1 bits (77), Expect = 0.073 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 906 PXPXXPPXXXPPPXXPPPXXXPXPXXP 986 P P PP PPP PPP P P P Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 34.7 bits (76), Expect = 0.097 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPP---PXXPPXPXXPPP 993 P PPP PP PP P PP P PPP Sbjct: 391 PPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPP---XXPPPXXXXXP 994 PPP PP PPP PPP PPP P Sbjct: 389 PPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +2 Query: 905 PPPXXPPXXXPP---PXXXPPPXXPPPXXXXXP 994 PPP PP PP P PPP PPP P Sbjct: 396 PPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPP 428 Score = 33.9 bits (74), Expect = 0.17 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP P PPP PP PPP Sbjct: 401 PPPPPPPYVYPSPPPPPPSPPPYVYPPPP 429 Score = 33.5 bits (73), Expect = 0.22 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +1 Query: 814 PXPPXXXXXXXXXPXXXXXXXXXXXXXXXXXPXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP P P PPP PP PPP PP PPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPP-PPPYVYPPPP 438 Score = 33.1 bits (72), Expect = 0.30 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +1 Query: 814 PXPPXXXXXXXXXPXXXXXXXXXXXXXXXXXPXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP P P PPP PP PPP PP PPP Sbjct: 391 PPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPP--PPYVYPPPPSPPYVYPPPP 448 Score = 31.9 bits (69), Expect = 0.68 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP PP PP P P P Sbjct: 429 PPPYVYPPPPSPPYVYPPPPPSPQP 453 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 906 PXPXXPPXXXPPPXXPPPXXXPXPXXP 986 P P P PPP PPP P P P Sbjct: 405 PPPYVYPSPPPPPPSPPPYVYPPPPPP 431 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 PPP PP PPP P P P Sbjct: 435 PPPPSPPYVYPPPPPSPQPYMYP 457 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP PP PP PPP P P P Sbjct: 430 PPYVYPPPPSPPYVYPPPPPSPQPYMYPSP 459 Score = 28.7 bits (61), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 912 PXXPPXXXPPPXXPPPXXXPXPXXP 986 P PP PPP PP P P P Sbjct: 427 PPPPPYVYPPPPSPPYVYPPPPPSP 451 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 3/32 (9%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXP---PPXXPPPXXXXXP 994 PP PP PPP P PP P P P Sbjct: 426 PPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYP 457 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 39.5 bits (88), Expect = 0.003 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PPP PPP PPP Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPP 489 Score = 37.9 bits (84), Expect = 0.010 Identities = 22/90 (24%), Positives = 22/90 (24%) Frame = +1 Query: 724 PXXPXPXXXXXXXXXXXXXXPXXXXXXXXXPXPPXXXXXXXXXPXXXXXXXXXXXXXXXX 903 P P P P P PP P Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPP 485 Query: 904 XPXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP PP PPP Sbjct: 486 SPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 515 Score = 37.1 bits (82), Expect = 0.018 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PP PPP PPP P Sbjct: 455 PPPPPPPPVYSPPPPPPPPPPPPPVYSPPP 484 Score = 33.1 bits (72), Expect = 0.30 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PP PPP PPP P Sbjct: 410 PPPPAPIFSTPPTLTSPPPPSPPPPVYSPP 439 Score = 32.7 bits (71), Expect = 0.39 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP P PPP Sbjct: 566 PHSSPPPHSPPPPHSPPPPIYPYLSPPPP 594 Score = 32.3 bits (70), Expect = 0.52 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP PP PPP Sbjct: 497 PPPPPPPPPPPPVYSPPP--PPVYSSPPP 523 Score = 32.3 bits (70), Expect = 0.52 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PPP PPP PPP Sbjct: 563 PP--PPHSSPPPHSPPPPHSPPP 583 Score = 31.9 bits (69), Expect = 0.68 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 937 PPXXXPPPXXPPXPXXPPP 993 PP PPP PP P PPP Sbjct: 565 PPHSSPPPHSPPPPHSPPP 583 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXP 970 PP PP PPP PPP P Sbjct: 537 PPPPPPHSPPPPQFSPPPPEP 557 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +1 Query: 919 PPPXXXPPXXXPPP--XXPPXPXXPPP 993 PP PP PPP PP P PPP Sbjct: 420 PPTLTSPPPPSPPPPVYSPPPPPPPPP 446 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/60 (26%), Positives = 16/60 (26%) Frame = +1 Query: 814 PXPPXXXXXXXXXPXXXXXXXXXXXXXXXXXPXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP P P PP PP PPP P PPP Sbjct: 457 PPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP PPP P Sbjct: 502 PPPPPPPVYSPPPPPVYSSPPPPPSPAPTP 531 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXP 987 PP PP PPP PP P P Sbjct: 565 PPHSSPPPHSPPPPHSPPPPIYP 587 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PPP P PPP P Sbjct: 591 PPPPPTPVSSPPPTPVYSPPPPPPCIEPPP 620 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 P PP PPP PP PPP Sbjct: 421 PTLTSPPPPSPPPPVYSPPPPPPP 444 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP PP PPP P PPP P Sbjct: 492 PPVYSPPPPPPPPPPPPVYSPPPPPVYSSP 521 Score = 29.1 bits (62), Expect = 4.8 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 4/34 (11%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPP----XXPPPXXXXXP 994 PPP PP PPP PPP PPP P Sbjct: 498 PPPPPPP--PPPPVYSPPPPPVYSSPPPPPSPAP 529 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP PP P PPP Sbjct: 500 PPPPPPPPPVYSPPPPPVYSSPPPP 524 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 PP PP PPP PPP P Sbjct: 565 PPHSSPPPHSPPPPHSPPPPIYP 587 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP P PPP Sbjct: 605 PVYSPPP--PPPCIEPPPPPPCIEYSPPP 631 Score = 28.3 bits (60), Expect = 8.4 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 7/36 (19%) Frame = +1 Query: 907 PXXXPPPXXXPP-------XXXPPPXXPPXPXXPPP 993 P PPP PP PPP P P PPP Sbjct: 542 PHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPP 577 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PP P PPP Sbjct: 570 PPPHSPPPPHSPPPPIYPYLSPPP 593 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 39.5 bits (88), Expect = 0.003 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PPP PPP PPP Sbjct: 67 PPPTSPPPPSPPPPSPPPPSPPPP 90 Score = 39.5 bits (88), Expect = 0.003 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PPP PPP PPP Sbjct: 72 PPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP PPP PP P PPP Sbjct: 66 PPPPTSPPPPSPPPPSPPPPSPPPP 90 Score = 37.5 bits (83), Expect = 0.014 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP PP PPP PP P PPP Sbjct: 67 PPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 35.1 bits (77), Expect = 0.073 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PPP PPP PPP Sbjct: 64 PPP--PPPTSPPPPSPPPPSPPPP 85 Score = 32.7 bits (71), Expect = 0.39 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 912 PXXPPXXXPPPXXPPPXXXPXPXXP 986 P PP PPP PPP P P P Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPP 88 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 39.5 bits (88), Expect = 0.003 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PPP PPP PPP Sbjct: 80 PPPPSPPPSPPPPQLPPPPQLPPP 103 Score = 36.7 bits (81), Expect = 0.024 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP PP P PPP Sbjct: 76 PPPCPPPPSPPPSP-PPPQLPPPPQLPPP 103 Score = 36.3 bits (80), Expect = 0.032 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PPP PPP P P Sbjct: 85 PPPSPPPPQLPPPPQLPPPAPPKP 108 Score = 35.9 bits (79), Expect = 0.042 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP PPP PPP P Sbjct: 62 PPPPPPPPCPPPP--SPPPCPPPPSPPPSP 89 Score = 35.5 bits (78), Expect = 0.055 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPP--PXXPPXPXXPPP 993 P PPP PP PP P PP P PPP Sbjct: 67 PPPCPPPPSPPPCPPPPSPPPSPPPPQLPPP 97 Score = 35.1 bits (77), Expect = 0.073 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +2 Query: 905 PPPXXPPXXXP--PPXXXPPPXXPPPXXXXXP 994 PPP PP P PP PPP PPP P Sbjct: 67 PPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPP 98 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP PP P P P Sbjct: 58 PADCPPP-PPPPPCPPPPSPPPCPPPPSP 85 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PP PP P PP Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPP 90 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP P P P P PPP Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPSPPPSPPP 91 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP PP P P P Sbjct: 81 PPPSPPPSPPPPQLPPPPQLPP-PAPPKP 108 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PP PP P PP Sbjct: 85 PPPSPPPPQLPPPPQLPPPAPPKPQPSPP 113 Score = 33.1 bits (72), Expect = 0.30 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP P P P PPP PPP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPP 69 Score = 33.1 bits (72), Expect = 0.30 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPP---XPXXPPP 993 PPP PP PPP PP P PPP Sbjct: 65 PPPPPCPPPPSPPPCPPPPSPPPSPPPP 92 Score = 32.3 bits (70), Expect = 0.52 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPP--XPXXPPP 993 P P P PP PPP PP P PPP Sbjct: 52 PEPEPEPADCPPPPPPPPCPPPPSPPPCPPP 82 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P P P P PPP PP P P P Sbjct: 48 PSPSPEPEPEPADCPPPPPPPPCPPPPSP 76 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P P P P PP PP P PPP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPP 74 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 P P P PPP PPP PPP P Sbjct: 52 PEPEPEPADCPPP-PPPPPCPPPPSPPPCP 80 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PP P P PP Sbjct: 90 PPPQLPPPPQLPPPAPPKPQPSPP 113 Score = 28.7 bits (61), Expect = 6.4 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXP 987 P PPP PP P PP P P Sbjct: 92 PQLPPPPQLPPPAPPKPQPSPPTPDLP 118 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 39.5 bits (88), Expect = 0.003 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PPP PPP PPP Sbjct: 60 PPPSPPPPSPPPPACPPPPALPPP 83 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP PPP PP P PPP Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPP 83 Score = 35.5 bits (78), Expect = 0.055 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PPP PPP PP Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPP 82 Score = 33.1 bits (72), Expect = 0.30 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXP 978 P PPP PP PPP PP P Sbjct: 61 PPSPPPPSPPPPACPPPPALPPPP 84 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPP 990 P PPP PP PPP P P PP Sbjct: 60 PPPSPPPPSPPPPACPPP--PALPPPPP 85 Score = 28.7 bits (61), Expect = 6.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPP 961 PP PP PPP PPP Sbjct: 66 PPSPPPPACPPPPALPPPP 84 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 37.9 bits (84), Expect = 0.010 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPP 990 P PPP PP PPP PP P PP Sbjct: 17 PQGPPPPVGVPPQYYPPPPPPPPPPPPP 44 Score = 33.1 bits (72), Expect = 0.30 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 PP PP PPP PPP PP Sbjct: 22 PPVGVPPQYYPPPPPPPPPPPPP 44 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 P P P PPP PP PPP P Sbjct: 11 PAPGNYPQGPPPPVGVPPQYYPPPPPPPPP 40 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 906 PXPXXPPXXXPPPXXPPPXXXPXPXXP 986 P PP PP PPP P P P Sbjct: 17 PQGPPPPVGVPPQYYPPPPPPPPPPPP 43 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 37.1 bits (82), Expect = 0.018 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP PP PPP Sbjct: 67 PANPPPPVSSPPPASPPPATPPPVASPPP 95 Score = 35.1 bits (77), Expect = 0.073 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +2 Query: 905 PPPXXPP--XXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP PPP PPP P Sbjct: 82 PPPATPPPVASPPPPVASPPPATPPPVATPPP 113 Score = 34.3 bits (75), Expect = 0.13 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPP--XXPPP 976 PPP PP PPP PPP PPP Sbjct: 77 PPPASPPPATPPPVASPPPPVASPPP 102 Score = 33.9 bits (74), Expect = 0.17 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PP PP P PP Sbjct: 73 PVSSPPPASPPPATPPPVASPPPPVASPP 101 Score = 33.1 bits (72), Expect = 0.30 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPPPXXXPP-XXXPPPXXPPXPXXPPP 993 P PPP PP PPP P P PPP Sbjct: 78 PPASPPPATPPPVASPPPPVASPPPATPPP 107 Score = 32.7 bits (71), Expect = 0.39 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP PP P P PPP Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPP 89 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +1 Query: 919 PPPXXX--PPXXXPPPXXPPXPXXPPP 993 PPP PP PPP P P PPP Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPP 84 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PP PPP PP P Sbjct: 71 PPPVSSPPPASPPPATPPPVASPPPPVASP 100 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = +2 Query: 905 PPPXX---PPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP PP PPP P Sbjct: 87 PPPVASPPPPVASPPPATPPPVATPPPAPLASP 119 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 3/27 (11%) Frame = +2 Query: 905 PPPXX--PPX-XXPPPXXXPPPXXPPP 976 PPP PP PPP PPP PPP Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPP 84 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPP--XXPPPXXXXXP 994 P PP PPP PPP PPP P Sbjct: 36 PTTPPPAATPPPVSAPPPVTTSPPPVTTAPP 66 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 911 PXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 P P PPP PPP PP P Sbjct: 31 PAPPTPTTPPPAATPPPVSAPPPVTTSP 58 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 37.1 bits (82), Expect = 0.018 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP PP PPP Sbjct: 67 PANPPPPVSSPPPASPPPATPPPVASPPP 95 Score = 35.1 bits (77), Expect = 0.073 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +2 Query: 905 PPPXXPP--XXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP PPP PPP P Sbjct: 82 PPPATPPPVASPPPPVASPPPATPPPVATPPP 113 Score = 34.3 bits (75), Expect = 0.13 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPP--XXPPP 976 PPP PP PPP PPP PPP Sbjct: 77 PPPASPPPATPPPVASPPPPVASPPP 102 Score = 33.9 bits (74), Expect = 0.17 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PP PP P PP Sbjct: 73 PVSSPPPASPPPATPPPVASPPPPVASPP 101 Score = 33.1 bits (72), Expect = 0.30 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPPPXXXPP-XXXPPPXXPPXPXXPPP 993 P PPP PP PPP P P PPP Sbjct: 78 PPASPPPATPPPVASPPPPVASPPPATPPP 107 Score = 32.7 bits (71), Expect = 0.39 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP PP P P PPP Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPP 89 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +1 Query: 919 PPPXXX--PPXXXPPPXXPPXPXXPPP 993 PPP PP PPP P P PPP Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPP 84 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PP PPP PP P Sbjct: 71 PPPVSSPPPASPPPATPPPVASPPPPVASP 100 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = +2 Query: 905 PPPXX---PPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP PP PPP P Sbjct: 87 PPPVASPPPPVASPPPATPPPVATPPPAPLASP 119 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 3/27 (11%) Frame = +2 Query: 905 PPPXX--PPX-XXPPPXXXPPPXXPPP 976 PPP PP PPP PPP PPP Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPP 84 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPP--XXPPPXXXXXP 994 P PP PPP PPP PPP P Sbjct: 36 PTTPPPAATPPPVSAPPPVTTSPPPVTTAPP 66 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 911 PXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 P P PPP PPP PP P Sbjct: 31 PAPPTPTTPPPAATPPPVSAPPPVTTSP 58 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 37.1 bits (82), Expect = 0.018 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PPP PPP PPP P Sbjct: 578 PPPPLPSRSIPPPLAQPPPPRPPPPPPPPP 607 Score = 34.3 bits (75), Expect = 0.13 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP P PPP P P PPP Sbjct: 573 PPPPPPPPPLPSRSIPPPLAQPPPPRPPP 601 Score = 33.1 bits (72), Expect = 0.30 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP P PPP PPP Sbjct: 642 PPPPPPPTRIPAAKCAPPPPPPPP 665 Score = 32.7 bits (71), Expect = 0.39 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 920 PPXXXPPPXXXPPPXXPPPXXXXXP 994 PP PPP PPP PPP P Sbjct: 589 PPLAQPPPPRPPPPPPPPPSSRSIP 613 Score = 32.3 bits (70), Expect = 0.52 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +1 Query: 907 PXXXPPPXXXPPXXX--PPPXXPPXPXXPPP 993 P PPP PP P P PP P PPP Sbjct: 596 PPRPPPPPPPPPSSRSIPSPSAPPPPPPPPP 626 Score = 31.9 bits (69), Expect = 0.68 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXP--PXPXXPPP 993 P PPP PP PPP P P PPP Sbjct: 590 PLAQPPPPRPPPPPPPPPSSRSIPSPSAPPP 620 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +2 Query: 905 PPPXXPPXXX--PPPXXXPPPXXPPP 976 PPP PP P P PPP PPP Sbjct: 601 PPPPPPPSSRSIPSPSAPPPPPPPPP 626 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP P P P PPP Sbjct: 641 PPPPPPPPTRIPAAKCAPPPPPPPP 665 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP P PP PPP Sbjct: 641 PPPPPPPPTRIPAAKCAPPPPPPP 664 Score = 28.3 bits (60), Expect = 8.4 Identities = 15/60 (25%), Positives = 15/60 (25%) Frame = +1 Query: 814 PXPPXXXXXXXXXPXXXXXXXXXXXXXXXXXPXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP P P PPP PPP P PPP Sbjct: 683 PPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPP 742 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 36.7 bits (81), Expect = 0.024 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 PPP PP PPP PPP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPP 64 Score = 36.7 bits (81), Expect = 0.024 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PPP PPP PPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPP 64 Score = 35.9 bits (79), Expect = 0.042 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP PP P PPP Sbjct: 39 PQSPPPPPPPPP---PPPPPPPPPPPPPP 64 Score = 34.3 bits (75), Expect = 0.13 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP P PPP PPP PPP P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPP 63 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXP----PXPXXPPP 993 P PPP PP PPP P P PPP Sbjct: 87 PLSSPPPPQPPPRSQPPPKPPQKNLPRRHPPPP 119 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P P PPP PPP P Sbjct: 75 PPPPPPVTDMIKPLSSPPPPQPPPRSQPPP 104 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 35.9 bits (79), Expect = 0.042 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP P PPP PP P PPP Sbjct: 266 PPPPAAAPPPQPPPPPPPKPQPPPP 290 Score = 33.9 bits (74), Expect = 0.17 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PPP P P PPP P Sbjct: 267 PPPAAAPPPQPPPPPPPKPQPPPPPKIARP 296 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP PP PPP P PPP P Sbjct: 268 PPAAAPPPQPPPPPPPKPQPPPPPKIARPP 297 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 PPP P PPP PP PP Sbjct: 279 PPPPPKPQPPPPPKIARPPPAPP 301 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 PPP PP PPP PPP P Sbjct: 265 PPP--PPAAAPPPQPPPPPPPKP 285 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPPPXXXPPXXX-PPPXXPPXPXXPPP 993 P PPP PP P P PP PPP Sbjct: 269 PAAAPPPQPPPPPPPKPQPPPPPKIARPPP 298 Score = 28.7 bits (61), Expect = 6.4 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 906 PXPXXPPXXXPPPXXPPPXXXPXPXXP 986 P P PP P P PP P P P Sbjct: 275 PQPPPPPPPKPQPPPPPKIARPPPAPP 301 Score = 28.3 bits (60), Expect = 8.4 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 1/26 (3%) Frame = +3 Query: 912 PXXPPXXXPPP-XXPPPXXXPXPXXP 986 P PP PPP PPP P P P Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPPPP 290 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 35.9 bits (79), Expect = 0.042 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP PPP PPP P Sbjct: 77 PPP--PPDLTPPPSSPPPPDAPPPIPIVFP 104 Score = 33.9 bits (74), Expect = 0.17 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PPP PPP PPP P Sbjct: 69 PPPPLDSSPPPPPDLTPPPSSPPPPDAPPP 98 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PPP P P PPP Sbjct: 68 PPPPPLDSSPPPPPDLTPPPSSPPP 92 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +1 Query: 919 PPPXXXPPXXXPPPX--XPPXPXXPPP 993 PPP PP PPP PP P PP Sbjct: 79 PPPDLTPPPSSPPPPDAPPPIPIVFPP 105 Score = 28.3 bits (60), Expect = 8.4 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 6/36 (16%) Frame = +2 Query: 905 PPPXXPPXXX---PPPXXXPPP---XXPPPXXXXXP 994 PPP PP PPP PPP PPP P Sbjct: 91 PPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEP 126 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 35.5 bits (78), Expect = 0.055 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PP PP PPP PP P PPP Sbjct: 368 PPRRSPPPLQTPPPPPPPPPLAPPP 392 Score = 35.1 bits (77), Expect = 0.073 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +2 Query: 905 PPPXX--PPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP PPP PPP P Sbjct: 367 PPPRRSPPPLQTPPPPPPPPPLAPPPPPQKRP 398 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 35.5 bits (78), Expect = 0.055 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PPP PPP PPP Sbjct: 1101 PPLPPPPSQPPPPPLSPPPSPPPP 1124 Score = 34.7 bits (76), Expect = 0.097 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPP 990 P PPP PP PP PP P PP Sbjct: 1101 PPLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 33.1 bits (72), Expect = 0.30 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 922 PPXXXPPXXXPPPXXPPXPXXPPP 993 PP PP PPP P P PPP Sbjct: 1101 PPLPPPPSQPPPPPLSPPPSPPPP 1124 Score = 32.7 bits (71), Expect = 0.39 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PP PP PP PP P PPP Sbjct: 1095 PPAALFPPLPPPPSQPPPPPLSPPP 1119 Score = 32.3 bits (70), Expect = 0.52 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP P PPP PPP Sbjct: 1105 PPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 31.9 bits (69), Expect = 0.68 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +2 Query: 905 PPPXX--PPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PP PPP PPP P Sbjct: 1094 PPPAALFPPLPPPPSQPPPPPLSPPPSPPPPP 1125 Score = 31.9 bits (69), Expect = 0.68 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 906 PXPXXPPXXXPPPXXPPPXXXPXPXXP 986 P P P PPP PPP P P P Sbjct: 1102 PLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 31.5 bits (68), Expect = 0.90 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP P PPP PP P PP Sbjct: 1094 PPPAALFPPLPPPPSQPPPPPLSPP 1118 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXP-PXPXXPPP 993 P PPP P PPP P P PPP Sbjct: 1065 PQESPPPLPPLPPSPPPPSPPLPPSSLPPP 1094 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 P P PP PP PP PPP Sbjct: 1071 PLPPLPPSPPPPSPPLPPSSLPPP 1094 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 2/32 (6%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXP--PPXXPPPXXXXXP 994 P P PP PPP PP PPP P Sbjct: 1082 PSPPLPPSSLPPPPPAALFPPLPPPPSQPPPP 1113 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP P P PP P P P Sbjct: 1058 PEDSPPLPQESPPPLPPLPPSPPPPSPPLP 1087 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 35.1 bits (77), Expect = 0.073 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PPP PPP PPP Sbjct: 94 PPPEEPPREPPPP--PPPPEEPPP 115 Score = 33.1 bits (72), Expect = 0.30 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPPPXXX-PPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP PP PPP Sbjct: 78 PLFPPPPLPRLPPPLLPPPEEPPREPPPPP 107 Score = 32.3 bits (70), Expect = 0.52 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP PP P PPP Sbjct: 90 PPLLPPP-EEPPREPPPP--PPPPEEPPP 115 Score = 31.5 bits (68), Expect = 0.90 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 906 PXPXXPPXXXPPPXXPPPXXXPXPXXP 986 P P PP PPP PP P P P Sbjct: 84 PLPRLPPPLLPPPEEPPREPPPPPPPP 110 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPP 976 PP P PPP PP PPP Sbjct: 94 PPPEEPPREPPPPPPPPEEPPPP 116 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +1 Query: 919 PPPXXXPPXXXP---PPXXPPXPXXPPP 993 PPP PP P PP PP PPP Sbjct: 89 PPPLLPPPEEPPREPPPPPPPPEEPPPP 116 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 3/31 (9%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPP---XXPPXPXXPP 990 P PPP P PPP PP P PP Sbjct: 41 PPPSPPPSPSSPPRLPPPFPALFPPEPPLPP 71 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 34.7 bits (76), Expect = 0.097 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 155 GGGYGGGGGYGGGGGGYGGGGRGGGGGGG 183 Score = 32.3 bits (70), Expect = 0.52 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 989 GGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GG G GG GGG GG GGG G Sbjct: 92 GGRGGFGGGRGGGRGSGGGYGGGGGGYG 119 Score = 31.9 bits (69), Expect = 0.68 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GG GGG GG GGG Sbjct: 96 GFGGGRGGGRGSGGGYGGGGGGYGGRGGGG 125 Score = 31.5 bits (68), Expect = 0.90 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGG 907 GGG GGG GGG GG GG Sbjct: 148 GGGYGGGGGGYGGGGGYGGGGGG 170 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GG Sbjct: 149 GGYGGGGGGYGGGGGYGGGGGGYGGGGRGG 178 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GG GGG GGG GG GGG Sbjct: 150 GYGGGGGGYGGGGGYGGGGGGYGGGGRGGG 179 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GG GG GGG Sbjct: 154 GGGGYGGGGGYGGGGGGYGGGGRGGGGGGG 183 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 148 GGGYGGGGGGYGGGGGYGG--GGGGYGGG 174 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GG GGG Sbjct: 147 GGGGYGGG---GGGYGGGGGYGGG 167 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 34.7 bits (76), Expect = 0.097 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 74 GGGGGGGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 73 GGGGGGGGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GGG G GG GGG GG GGG Sbjct: 79 GGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 31.5 bits (68), Expect = 0.90 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 G G G GG GGG GG GGG G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWG 96 Score = 31.5 bits (68), Expect = 0.90 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG G G G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGG 98 Score = 31.5 bits (68), Expect = 0.90 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG GGG GGG GG GGG Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGG 92 Score = 31.5 bits (68), Expect = 0.90 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG G G G Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGWGWGGGGG 100 Score = 31.5 bits (68), Expect = 0.90 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG G GGG G Sbjct: 75 GGGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG G GGG Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGWGWGGGGG 100 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 G G GG GGG GG GGG G Sbjct: 63 GSYRWGWGGGGGGGGGGGGGGGGGGGGGG 91 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GGG G Sbjct: 89 GGGGWGWGGGGGGGGWYKWGCGGGGKGKG 117 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 213 GGGGSGGGGAYGGGGAHGGGYGSGGGEGGG 242 Score = 32.3 bits (70), Expect = 0.52 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 989 GGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GG G GG GGG GG GGG G Sbjct: 204 GGAGGYGGGGGGGSGGGGAYGGGGAHGG 231 Score = 31.9 bits (69), Expect = 0.68 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG G G Sbjct: 207 GGYGGGGGGGSGGGGAYGGGGAHGGGYGSG 236 Score = 31.9 bits (69), Expect = 0.68 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GG Sbjct: 208 GYGGGGGGGSGGGGAYGGGGAHGGGYGSGG 237 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 219 GGGAYGGGGAHGGGYGSGGGE-GGGYGGG 246 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GG GGG GGG GG GGG Sbjct: 249 GGYGGGGGGGEGGGGSYGGEHGGG 272 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG G GG GGG G Sbjct: 168 GGGHGGGGGGGSAGGAHGGSGYGGGEGGG 196 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGG 907 G GGG GGG G G GG GG Sbjct: 188 GYGGGEGGGAGGGGSHGGAGGYGGGGGGG 216 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG GGG GG GG GGG Sbjct: 194 GGGAGGGGSHGGAGGYGGGGGGG 216 Score = 29.1 bits (62), Expect = 4.8 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGG--GXXXGGXXGGG 904 G GGG GGG GG G GG GGG Sbjct: 249 GGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGG 280 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GG GG GG GGG Sbjct: 234 GSGGGEGGGYGGGAAGGYGGGGGGGEGGGG 263 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 34.3 bits (75), Expect = 0.13 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +2 Query: 905 PPPXXPP--XXXPPPXXXPPPXXPPP 976 PPP PP PPP PPP PPP Sbjct: 680 PPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP P PPP Sbjct: 675 PGGGPPPPPPPPGGGPPPPPGGGPPPPPP 703 Score = 32.3 bits (70), Expect = 0.52 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP P P PPP Sbjct: 680 PPPPPPPGGGPP---PPPGGGPPPPPPPP 705 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 33.9 bits (74), Expect = 0.17 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PPP PP PPP P Sbjct: 34 PPPPFSPPHHPPPPHFSPPHQPPPSPYPHP 63 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP P PPP P P PPP Sbjct: 40 PPHHPPPPHFSPPHQPPPSPYPHPHPPPP 68 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PPP P P PPP P Sbjct: 45 PPPHFSPPHQPPPSPYPHPHPPPPSPYPHP 74 Score = 33.1 bits (72), Expect = 0.30 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP P PPP P P PPP Sbjct: 51 PPHQPPPSPYPHPHPPPPSPYPHPHQPPP 79 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 P P P PPP PP PPP P Sbjct: 23 PVPPPPSHISPPPPPFSPPHHPPPPHFSPP 52 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP P PPP P P PPP P Sbjct: 56 PPSPYPHPHPPPPSPYPHPHQPPPPPHVLP 85 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP P PPP P PPP Sbjct: 33 PPPPPFSPPHHPPPPHFSPPHQPPP 57 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 906 PXPXXPPXXXPPPXXPPPXXXPXPXXP 986 P PP PP PPP P P P Sbjct: 40 PPHHPPPPHFSPPHQPPPSPYPHPHPP 66 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXP--XXPPP 993 P P P PP P P PP P PPP Sbjct: 57 PSPYPHPHPPPPSPYPHPHQPPPPPHVLPPP 87 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GG GGG Sbjct: 391 GGGGNGGGSFYGGGGGRGGYGGGG 414 Score = 31.5 bits (68), Expect = 0.90 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG GGG GGG GG GGG Sbjct: 362 GGAGGGGYRGGGGYDMGGVGGGG 384 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G G GGG G GGG G Sbjct: 381 GGGGAGGYGAGGGGNGGGSFYGGGGGRGG 409 Score = 28.7 bits (61), Expect = 6.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGG 921 GGG G G GGG GG GG Sbjct: 391 GGGGNGGGSFYGGGGGRGGYGGGG 414 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 33.9 bits (74), Expect = 0.17 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP PP PPP P P PPP Sbjct: 34 PATPPPVATPPPVATPPPAATPAPATPPP 62 Score = 31.9 bits (69), Expect = 0.68 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +2 Query: 905 PPPXX--PPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP P P PPP P Sbjct: 37 PPPVATPPPVATPPPAATPAPATPPPAATPAP 68 Score = 31.5 bits (68), Expect = 0.90 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPP 990 P PPP PP PPP P P P Sbjct: 28 PTATPPPATPPPVATPPPVATPPPAATP 55 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP P PPP P P PP Sbjct: 45 PVATPPPAATPAPATPPPAATPAPATTPP 73 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 P P PP PPP P P PP Sbjct: 26 PTPTATPPPATPPPVATPPPVATPP 50 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GG GGG Sbjct: 783 GGGGCGGGHHGGGGGGCGGCGGGG 806 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GG GG GGG Sbjct: 788 GGGHHGGGGGGCGGCGGGGCGGGG 811 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GGG G GG GGG GG GGG Sbjct: 793 GGGGGGCGGCGGGG--CGGGGDGGG 815 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PPP PPP PP P Sbjct: 612 PPPPPPVYSPPPPVFSPPPSQSPPVVYSPP 641 Score = 32.7 bits (71), Expect = 0.39 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP PP PPP P Sbjct: 533 PPPPPPPVHSPPPPVHSPP--PPPVYSPPP 560 Score = 32.3 bits (70), Expect = 0.52 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP PP PP P PP Sbjct: 527 PPPVYSPPPPPPPVHSPPPPVHSPP 551 Score = 32.3 bits (70), Expect = 0.52 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP PP PP P PP Sbjct: 552 PPPVYSPPPPPPPVHSPPPPVFSPP 576 Score = 32.3 bits (70), Expect = 0.52 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PPP PPP PPP P Sbjct: 596 PPPPAPVHSPPPPVHSPPP--PPPVYSPPP 623 Score = 31.9 bits (69), Expect = 0.68 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPP--XXPPPXXXXXP 994 PPP P PPP PPP PPP P Sbjct: 527 PPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSP 558 Score = 31.9 bits (69), Expect = 0.68 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPP--XXPPPXXXXXP 994 PPP P PPP PPP PPP P Sbjct: 552 PPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPP 583 Score = 31.9 bits (69), Expect = 0.68 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXX--PPPXXPPPXXXXXP 994 PPP PP PPP PPP PP P Sbjct: 558 PPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSP 589 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP P PP PP P PP Sbjct: 601 PVHSPPPPVHSPPPPPPVYSPPPPVFSPP 629 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPP 990 P PPP PP PP PP PP Sbjct: 624 PVFSPPPSQSPPVVYSPPPRPPKINSPP 651 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPP 973 PP P PPP PPP PP Sbjct: 518 PPPAPVNSPPPPVYSPPPPPPP 539 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PP PPP PP P Sbjct: 606 PPPVHSPPPPPPVYSPPPPVFSPPPSQSPP 635 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP P PP PPP Sbjct: 533 PPPPPPPVHSPPPPVHSPPPPPVYSPPPP 561 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PPP PP PPP P Sbjct: 544 PPPVHSP---PPPPVYSPPPPPPPVHSPPP 570 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP P PPP P Sbjct: 550 PPP--PPVYSPPPPPPPVHSPPPPVFSPPP 577 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP P PP PPP Sbjct: 590 PPPVHSPPPPAPVHSPPPPVHSPPP 614 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GGG G GG GGG GG GGG Sbjct: 591 GGGYGGGGGYGGGGGYGGGGGYGGG 615 Score = 31.9 bits (69), Expect = 0.68 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGG 907 G GGG GGG GGG GG GG Sbjct: 590 GGGGYGGGGGYGGGGGYGGGGGYGGGYGG 618 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GG G GG GGG GG GGG G Sbjct: 585 GGYGGGGGGYGGGGGYGGGGGYGGGGGYG 613 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GG GGG GGG GG GGG Sbjct: 586 GYGGGGGGYGGGGGYGGGGGYGGGGGYGGG 615 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 G G G GG GG GG GGG G Sbjct: 581 GSGRGGYGGGGGGYGGGGGYGGGGGYGGG 609 >At2g05530.1 68415.m00585 glycine-rich protein Length = 115 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GGG G GG GGG GG GGG Sbjct: 54 GGGYNGGGGHNGGGYNGGGGYNGGG 78 Score = 32.3 bits (70), Expect = 0.52 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 989 GGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GG G GG GGG GG GGG G Sbjct: 49 GGYNGGGGYNGGGGHNGGGYNGGGGYNG 76 Score = 31.5 bits (68), Expect = 0.90 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GG GG Sbjct: 54 GGGYNGGGGHNGGGYNGGGGYNGG 77 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GG GGG GGG GG GGG Sbjct: 43 GGHGGNGGYNGGGGYNGGGGHNGGGYNGGG 72 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGG 907 G GGG GG GGG GG GG Sbjct: 53 GGGGYNGGGGHNGGGYNGGGGYNGGGHGG 81 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 32.7 bits (71), Expect = 0.39 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP P PPP PPP P Sbjct: 11 PPPPPPPRLLVLPPLPPPPPPPPPQLPFGP 40 Score = 31.5 bits (68), Expect = 0.90 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP P PP P PPP Sbjct: 10 PPPPPPPPRLLVLPPLPPPPPPPPP 34 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 32.7 bits (71), Expect = 0.39 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP PPP P PPP Sbjct: 25 PPPSLPPPVPPPPPSHQPYSYPPPP 49 Score = 32.7 bits (71), Expect = 0.39 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP P PPP PPP Sbjct: 30 PPPVPPPPPSHQPYSYPPPPPPPP 53 Score = 32.3 bits (70), Expect = 0.52 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PPP P PPP Sbjct: 25 PPPSLPPPVPPPPPSHQPYSYPPP 48 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPP 990 P PPP PP P PP P PP Sbjct: 26 PPSLPPPVPPPPPSHQPYSYPPPPPPPP 53 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXP---PPXXPPP 976 PP PP PPP P PP PPP Sbjct: 26 PPSLPPPVPPPPPSHQPYSYPPPPPPP 52 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PPP PPP PPP Sbjct: 14 PPSQNSLAPPPPPPSLPPPVPPPP 37 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 PPP PP PPP PPP P Sbjct: 22 PPP--PPPSLPPPVPPPPPSHQP 42 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP PPP PPP Sbjct: 24 PPPPSLPPPVPPPPPSHQPYSYPPP 48 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 32.3 bits (70), Expect = 0.52 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PP PPP PPP P Sbjct: 77 PPPIYPPPIYSPP---PPPIYPPPIYSPPP 103 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP P PPP PPP PP P Sbjct: 67 PPPPPIYSPPPPPIYPPPIYSPPPPPIYP 95 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +1 Query: 907 PXXXPPPXXXPPXXX--PPPXX--PPXPXXPPP 993 P PPP PP PPP PP P PPP Sbjct: 78 PPIYPPPIYSPPPPPIYPPPIYSPPPTPISPPP 110 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 4/29 (13%) Frame = +1 Query: 919 PPPXXXPPXXXPPP----XXPPXPXXPPP 993 PPP P PPP PP P PPP Sbjct: 56 PPPVYSRPVAFPPPPPIYSPPPPPIYPPP 84 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PPP PP PPP P Sbjct: 69 PPPIYSPP--PPPIYPPPIYSPPPPPIYPP 96 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 32.3 bits (70), Expect = 0.52 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP PP PPP P Sbjct: 94 PPPLSPPQTTPPP---PPAITPPPPPAITP 120 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P P PP PPP PP PPP Sbjct: 79 PPVATTPPALPPKPLPPPLSPPQTTPPPP 107 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP PP PPP P PPP P Sbjct: 85 PPALPPKPLPPPLSPPQTTPPPPPAITPP 113 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP P PPP PP PPP P Sbjct: 104 PPPPPAITPPPPPAITPPLSPPPPAITPP 132 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P P PP PPP PP PPP Sbjct: 133 PPLATTPPALPPKPLPPPLSPPQTTPPPP 161 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP PP PPP P PPP P Sbjct: 139 PPALPPKPLPPPLSPPQTTPPPPPAITPP 167 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PPP PP PPP P Sbjct: 104 PPPPPAITPPPPPAITPPLSPPPPAITPPP 133 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 1/24 (4%) Frame = +2 Query: 905 PPPXXPP-XXXPPPXXXPPPXXPP 973 PPP PP PPP PP PP Sbjct: 148 PPPLSPPQTTPPPPPAITPPLSPP 171 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PP PP PPP P Sbjct: 112 PPP--PPAITPPLSPPPPAITPPPPLATTP 139 Score = 28.7 bits (61), Expect = 6.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP P PPP PP PPP Sbjct: 262 PPPLPPQTLKPPPPQTTPP--PPP 283 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPP 990 P P PP PP PP P PP Sbjct: 69 PPPPPQSTSPPPVATTPPALPPKPLPPP 96 Score = 28.3 bits (60), Expect = 8.4 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP PP PPP Sbjct: 90 PKPLPPPLS-PPQTTPPP--PPAITPPPP 115 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 32.3 bits (70), Expect = 0.52 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 989 GGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GG G GG GGG GG GGG G Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGGGPPRG 86 Score = 31.5 bits (68), Expect = 0.90 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GG GG GGG Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGGG 82 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GG GG Sbjct: 64 GGGGGGGGSGGGGGGRGGGPPRGG 87 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GGG G GG GGG GG GG Sbjct: 63 GGGGGGGGGSGGGGGGRGGGPPRGG 87 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 32.3 bits (70), Expect = 0.52 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PPP P P PP Sbjct: 69 PPPPPPPQSLPPPSPSPEPEHYPP 92 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PPP PPP P P Sbjct: 63 PPPPQTPPPPPPPQSLPPPSPSPEPEHYPP 92 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PP PP P P P Sbjct: 64 PPPQTPPPPPPPQSLPPPSPSPEPEHYPPP 93 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 32.3 bits (70), Expect = 0.52 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP PP PP PPP Sbjct: 230 PPPPPPPPHQAQPPPPPPSGLFPPP 254 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PP P PPP Sbjct: 231 PPPPPPPHQAQPPPPPPSGLFPPP 254 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP P PPP P PPP Sbjct: 231 PPPPPPPHQAQPPPPPPSGLFPPPP 255 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 32.3 bits (70), Expect = 0.52 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +2 Query: 905 PPPXXPPXXXPPP-XXXPPPXXPP 973 PPP PP PPP PPP PP Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPP 115 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 5/34 (14%) Frame = +1 Query: 907 PXXXPPPXXXPPXXX-PPPXXPPXP----XXPPP 993 P PPP PP PPP PP P PPP Sbjct: 93 PPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPP 126 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPP 990 PPP PP PP P P PP Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPP 115 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 32.3 bits (70), Expect = 0.52 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP P PPP PPP Sbjct: 492 PPPPTPPAFKPLKGSAPPPPPPPP 515 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP PP P PPP PPP P Sbjct: 508 PPPPPPPPLPTTIAAPPPPPPPPRAAVAP 536 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 PPP PP P PPP PP Sbjct: 476 PPPPLPPAVMPLKHFAPPPPTPP 498 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +1 Query: 907 PXXXPPPXXX--PPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP P PPP Sbjct: 524 PPPPPPPRAAVAPPPPPPPPGTAAAPPPPPP 554 Score = 29.1 bits (62), Expect = 4.8 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 5/35 (14%) Frame = +2 Query: 905 PPPXX---PPXXXPPPXXX--PPPXXPPPXXXXXP 994 PPP PP PPP PPP PPP P Sbjct: 541 PPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAP 575 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP P PPP P P Sbjct: 458 PPPPPPPAVMPLKHFAPPPPPPLP 481 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 3/32 (9%) Frame = +1 Query: 907 PXXXPPP---XXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP P PPP Sbjct: 536 PPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPP 567 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 32.3 bits (70), Expect = 0.52 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 4/29 (13%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXX----PPXPXXPPP 993 PPP PP PPP PP P PPP Sbjct: 147 PPPESPPPESLPPPSPESPSPPSPEPPPP 175 Score = 28.7 bits (61), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP PP P P P P Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSP 170 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 32.3 bits (70), Expect = 0.52 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP PP PPP P Sbjct: 68 PPPNQPPNTTPPP---TPPSSPPPSITPPP 94 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPP 990 P P PP PP PP P PP Sbjct: 80 PTPPSSPPPSITPPPSPPQPQPPP 103 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PPP PPP P P Sbjct: 78 PPPTPPSS-PPPSITPPPSPPQP 99 Score = 28.7 bits (61), Expect = 6.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PPP PP PPP Sbjct: 82 PPSSPPPSITPPPS--PPQPQPPP 103 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 28.3 bits (60), Expect = 8.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 912 PXXPPXXXPPPXXPPPXXXP 971 P PP PPP PPP P Sbjct: 245 PQQPPATPPPPPPPPPVEVP 264 Score = 27.5 bits (58), Expect(2) = 0.68 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 Query: 935 PPPXXXPPPXXPPP 976 PPP PPP PPP Sbjct: 296 PPPSPPPPPPPPPP 309 Score = 23.0 bits (47), Expect(2) = 0.68 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXP 955 PP PP PPP P Sbjct: 248 PPATPPPPPPPPPVEVP 264 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 31.9 bits (69), Expect = 0.68 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 P P PP PP PP P PPP Sbjct: 378 PRPPYGPPPGPPPMMRPPLPPGPPP 402 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP P P PPP Sbjct: 380 PPYGPPPGPPPMMRPPLPPGPPP 402 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 31.9 bits (69), Expect = 0.68 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 920 PPXXXPPPXXXPPPXXPPP 976 PP PPP PPP PPP Sbjct: 262 PPNRPPPPSSPPPPPPPPP 280 Score = 31.9 bits (69), Expect = 0.68 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 937 PPXXXPPPXXPPXPXXPPP 993 PP PPP PP P PPP Sbjct: 262 PPNRPPPPSSPPPPPPPPP 280 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPP 972 P PPP PP PPP PP Sbjct: 262 PPNRPPPPSSPPPPPPPPPTPP 283 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 922 PPXXXPPXXXPPPXXPPXPXXP 987 PP PP PPP PP P P Sbjct: 262 PPNRPPPPSSPPPPPPPPPTPP 283 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXP 970 PP PP PPP PPP P Sbjct: 262 PPNRPPPPSSPPPPPPPPPTPP 283 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 31.9 bits (69), Expect = 0.68 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP P PPP PPP Sbjct: 98 PPPQPPPPPQPLNLFSPPPPPPPP 121 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 31.9 bits (69), Expect = 0.68 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GG GG GGG Sbjct: 59 GGIGVGGGGGGGGGIGGSGGVGAGGGVGGG 88 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG G G GG GGG Sbjct: 482 GGVGVGGGGGIGGGAGGGVGGGVGGGVGGG 511 Score = 28.7 bits (61), Expect = 6.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GGG G GG GG GG G G Sbjct: 199 GGGTVGAGGRGSGGASGGGGTVGAG 223 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G G GGG GG GG G Sbjct: 54 GGGASGGIGVGGGGGGGGGIGGSGGVGAG 82 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 31.9 bits (69), Expect = 0.68 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GG GGG GG GGG Sbjct: 104 GKSGGGGGGGKNGGGCGGGGGGKGGKSGGG 133 Score = 31.5 bits (68), Expect = 0.90 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GG GGG GGG GG GGG Sbjct: 5 GGSGSGGGGKGGGGGGSGGGRGGG 28 Score = 31.5 bits (68), Expect = 0.90 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 G G GGG GGG GG GGG Sbjct: 6 GSGSGGGGKGGGGGGSGGGRGGGG 29 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GG G GG GGG GG GGG Sbjct: 5 GGSGSGGGGKGGGGGGSGGGRGGGG 29 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG G GGG Sbjct: 11 GGGKGGGGGGSGGGRGGGGGGGAKGGCGGG 40 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GG GGG GG GGG Sbjct: 12 GGKGGGGGGSGGGRGGGGGGGAKGGCGGGG 41 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GGG G G GGG GG GGG Sbjct: 27 GGGGGGAKGGCGGGGKSGGGGGGGG 51 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 102 GGGKSGGGG--GGGKNGGGCGGGGGGKGG 128 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 96 GGKSGCGGGKSGGGG--GGGKNGGGCGGGG 123 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG GG GGG GG GG G Sbjct: 110 GGGGKNGGGCGGGGGGKGGKSGGGSGGGG 138 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXG--GXXXGGGXXXG 906 GGG G GG GGG G G GGG G Sbjct: 15 GGGGGGSGGGRGGGGGGGAKGGCGGGGKSGG 45 Score = 29.1 bits (62), Expect = 4.8 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = -1 Query: 993 GXXXXXGGGXXGG--GXXXGGGXXXGGXXGGG 904 G GGG GG G GGG GG GGG Sbjct: 20 GSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGG 51 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG G GG GGG G Sbjct: 22 GGGRGGGGGGGAKGGCGGGGKSGGGGGGG 50 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GG GGG GG GG GGG Sbjct: 109 GGGGGKNGGGCGGGGGGKGGKSGGGSGGGG 138 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G G GGG GG GG G Sbjct: 18 GGGSGGGRGGGGGGGAKGGCGGGGKSGGG 46 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 31.9 bits (69), Expect = 0.68 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGG 907 G GGG GGG GGG GG GG Sbjct: 61 GDGGGDGGGDGGGGGCGGGGGCGGGGGGG 89 Score = 31.5 bits (68), Expect = 0.90 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG GGG GGG GG GGG Sbjct: 63 GGGDGGGDGGGGGCGGGGGCGGG 85 Score = 31.5 bits (68), Expect = 0.90 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG GGG GGG GG GGG Sbjct: 67 GGGDGGGGGCGGGGGCGGGGGGG 89 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 31.9 bits (69), Expect = 0.68 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGG 907 G GGG GGG GGG GG GG Sbjct: 156 GPGYGSGGGGIGGGGGIGGGVIIGGGGGG 184 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXG-GGXXXG 906 GGG G GG GGG GG G GG G Sbjct: 162 GGGGIGGGGGIGGGVIIGGGGGGCGGSCSG 191 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GG GG G G G Sbjct: 115 GGGGYGPGGGGGGVVIGGGFGGGAGYGSG 143 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 G G G G GGG GG GGG G Sbjct: 151 GNGGGGPGYGSGGGGIGGGGGIGGGVIIG 179 Score = 28.3 bits (60), Expect = 8.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG GGG GGG G GGG Sbjct: 105 GGYGGGGPGYGGGGYGPGGGGGG 127 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GG GGG GG GG Sbjct: 163 GGGIGGGGGIGGGVIIGGGGGGCGGSCSGG 192 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 26.2 bits (55), Expect(2) = 0.74 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPP 958 PP PP PPP PP Sbjct: 120 PPPPPPPPPPPPTITPP 136 Score = 24.2 bits (50), Expect(2) = 0.74 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 935 PPPXXXPPPXXPPP 976 PPP PPP PP Sbjct: 154 PPPPPPPPPTITPP 167 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 31.5 bits (68), Expect = 0.90 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP PP PP P PP Sbjct: 39 PPPGAYPPAGYPPGAYPPAPGGYPP 63 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP P PP P PP Sbjct: 18 PAGYPPPGAYPPAGYPQQGYPPPPGAYPP 46 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 31.5 bits (68), Expect = 0.90 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXP 978 PPP PP PPP PP P Sbjct: 39 PPPVYSPPISPPPPPPPPPP 58 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PP PPP PPP Sbjct: 37 PPP--PPVYSPPISPPPPPPPPPP 58 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP PP PP P PPP Sbjct: 37 PPP---PPVYSPPISPPPPPPPPPP 58 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 31.5 bits (68), Expect = 0.90 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 G G G GG GGG GG GGG G Sbjct: 116 GRGSGGGGGHGGGGGGGGGRGGGGGSGNG 144 Score = 31.5 bits (68), Expect = 0.90 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GG G G Sbjct: 121 GGGGHGGGGGGGGGRGGGGGSGNG 144 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 G G GGG GGG GG GGG Sbjct: 116 GRGSGGGGGHGGGGGGGGGRGGGG 139 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG GG GGG GG G G G Sbjct: 120 GGGGGHGGGGGGGGGRGGGGGSGNGEGYG 148 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG G G G G Sbjct: 126 GGGGGGGGGRGGGGGSGNGEGYGEGGGYG 154 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG G G G G GG GGG Sbjct: 131 GGGGRGGGGGSGNGEGYGEGGGYGGGYGGG 160 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 31.5 bits (68), Expect = 0.90 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP PP P PPP Sbjct: 109 PYVKPPP---PPTVKPPP--PPTPYTPPP 132 Score = 31.5 bits (68), Expect = 0.90 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP P PPP PP P PPP Sbjct: 154 PPPTPTPEAPCPPP--PPTPYPPPP 176 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P P P P P PPP P Sbjct: 153 PPPPTPTPEAPCPPPPPTPYPPPPKPETCP 182 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP P P P P Sbjct: 135 PYTPPPPTVKPP---PPPVVTPPPPTPTP 160 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PPP PPP P P P Sbjct: 139 PPPTVKPP--PPPVVTPPPPTPTPEAPCPP 166 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PP PP PPP P Sbjct: 68 PPPPYIPCPPPPYTPKPPTVKPPPPPYVKP 97 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP PP PPP PP PPP Sbjct: 74 PCPPPPYTPKPPTVKPPP--PPYVKPPPP 100 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 2/32 (6%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPP--PXXPPPXXXXXP 994 PPP P P P PP P PPP P Sbjct: 115 PPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPP 146 Score = 28.7 bits (61), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PP PP P PP P PPP Sbjct: 116 PPTVKPPPPPTPYTPPPPTPYTPPP 140 Score = 28.7 bits (61), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP P P P P P P Sbjct: 147 PPPVVTPPPPTPTPEAPCPPPPPTP 171 Score = 28.3 bits (60), Expect = 8.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP P P PPP P Sbjct: 113 PPP--PPTVKPPP--PPTPYTPPPPTPYTP 138 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 31.5 bits (68), Expect = 0.90 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPP--XXPPPXXXXXP 994 PPP P PPP PPP PPP P Sbjct: 647 PPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPP 678 Score = 28.7 bits (61), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP P PP PPP Sbjct: 671 PPPVYSPPPPVHSPPPPPVHSPPPP 695 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPP--XXPPPXXXXXP 994 PP P PPP PPP PPP P Sbjct: 684 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 714 Score = 28.7 bits (61), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP P PP PPP Sbjct: 753 PPPVHSPPPPVHSPPPPPVHSPPPP 777 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPP--XXPPPXXXXXP 994 PP P PPP PPP PPP P Sbjct: 766 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 796 Score = 28.7 bits (61), Expect = 6.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP P PPP PPP P Sbjct: 802 PPPPSPIYSPPPPVFSPPPKPVTP 825 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP P PP PPP Sbjct: 721 PPPVHSPPPPVQSPPPPPVFSPPPP 745 >At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1 predicted transmembrane domain; Length = 175 Score = 31.5 bits (68), Expect = 0.90 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGG 907 GGG GGG GGG GG GG Sbjct: 153 GGGGGGGGGGLGGGGCGGGGCGG 175 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG G G GGG GG GGG Sbjct: 144 GGGSHGHGCGGGGGGGGGGLGGGG 167 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 G G GGG GGG GG GGG Sbjct: 149 GHGCGGGGGGGGGGLGGGGCGGGG 172 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 985 GXXGXGXXXGGGXXGGGXXXGGXXGXG 905 G G G GGG GGG GG G G Sbjct: 146 GSHGHGCGGGGGGGGGGLGGGGCGGGG 172 Score = 28.7 bits (61), Expect = 6.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXG 924 GGG G GG GGG GG G Sbjct: 153 GGGGGGGGGGLGGGGCGGGGCGG 175 >At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ boundaries domain protein 18 (LBD18) identical to LOB DOMAIN 18 [Arabidopsis thaliana] GI:17227164; supported by full-length cDNA gi:17227163 Length = 262 Score = 31.5 bits (68), Expect = 0.90 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGG 907 GGG GGG GGG GG GG Sbjct: 14 GGGGCGGGGSSGGGGSSGGGGGG 36 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 14 GGGGCGGGGSSGGGGSSGG---GGGGPCG 39 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 31.5 bits (68), Expect = 0.90 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGG 907 GGG GGG GGG GG GG Sbjct: 127 GGGSYGGGRREGGGGYGGGEGGG 149 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 31.5 bits (68), Expect = 0.90 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGG 907 GGG GGG GGG GG GG Sbjct: 144 GGGSYGGGRREGGGGYGGGEGGG 166 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 31.5 bits (68), Expect = 0.90 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPP--XXPPPXXXXXP 994 PPP P PPP PPP PPP P Sbjct: 536 PPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 567 Score = 31.5 bits (68), Expect = 0.90 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPP--XXPPPXXXXXP 994 PPP P PPP PPP PPP P Sbjct: 616 PPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPP 647 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP P PP PP P PP Sbjct: 605 PVHSPPPPVYSPPPPPPVHSPPPPVFSPP 633 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PP PPP PP P Sbjct: 530 PPPVYSPPPPPPVHSPPPPVHSPPPPVHSP 559 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PP PPP PP P Sbjct: 610 PPPVYSPPPPPPVHSPPPPVFSPPPPVHSP 639 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 PPP P PPP PP PP Sbjct: 501 PPPPSPIHSPPPPPVYSPPPPPP 523 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PPP P PPP P Sbjct: 518 PPPPPPVYSPPPPPPVYSPPPPPPVHSPPP 547 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP P PP PP P PP Sbjct: 529 PPPPVYSPPPPPPVHSPPPPVHSPP 553 Score = 28.7 bits (61), Expect = 6.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PPP PPP PPP P Sbjct: 512 PPPVYSPPP-PPPVYSPPP--PPPVYSPPP 538 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPP--XXPPPXXXXXP 994 PP P PPP PPP PPP P Sbjct: 587 PPPPPVHSPPPPVHSPPPPVHSPPPPVYSPP 617 Score = 28.7 bits (61), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PP PP PP PP PPP Sbjct: 604 PPVHSPPPPVYSPPPPPPVHSPPPP 628 Score = 28.7 bits (61), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP P PP PPP Sbjct: 640 PPPVYSPPPPVYSPPPPPVKSPPPP 664 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP P PP P PP Sbjct: 495 PPPVHSPPPPSPIHSPPPPPVYSPP 519 Score = 28.3 bits (60), Expect = 8.4 Identities = 18/62 (29%), Positives = 18/62 (29%), Gaps = 2/62 (3%) Frame = +1 Query: 814 PXPPXXXXXXXXXPXXXXXXXXXXXXXXXXXPXXXPPPXXXPPXXXPPPXX--PPXPXXP 987 P PP P P PPP PP PPP PP P Sbjct: 501 PPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPP--PPVHSPPPPVHSPPPPVHS 558 Query: 988 PP 993 PP Sbjct: 559 PP 560 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP P PP PPP Sbjct: 574 PPPVHSPPPPVYSPPPPPVHSPPPP 598 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP P PP PPP Sbjct: 603 PPPVHSPPPPVYSPPPPPPVHSPPP 627 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 31.5 bits (68), Expect = 0.90 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG GGG GGG GG GGG Sbjct: 48 GGHGGGGHYGGGGHGHGGHNGGG 70 Score = 31.5 bits (68), Expect = 0.90 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GG G Sbjct: 88 GGGHYGGGGGHGGGGHYGGGGHHGGGGHG 116 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 31.5 bits (68), Expect = 0.90 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 5/30 (16%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXX-----PPXPXXPPP 993 PPP PP PPP PP P PPP Sbjct: 530 PPPLSPPPPSPPPPYIYSSPPPPSPSPPPP 559 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +2 Query: 905 PPPXXPPXXXPPP---XXXPPPXXPPP 976 PPP PP PPP PPP P P Sbjct: 530 PPPLSPPPPSPPPPYIYSSPPPPSPSP 556 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 912 PXXPPXXXPPPXXPPPXXXPXPXXP 986 P PP PPP PPP P P Sbjct: 528 PPPPPLSPPPPSPPPPYIYSSPPPP 552 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 31.5 bits (68), Expect = 0.90 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPP--XXPPPXXXXXP 994 PPP P PPP PPP PPP P Sbjct: 609 PPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPP 640 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP PPP PPP PPP P Sbjct: 567 PPPPHVYSPPPPVASPPPPSPPPPVHSPP 595 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP PPP PP PPP Sbjct: 583 PPPSPPPPVHSPPP--PPVFSPPPP 605 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PP PP PPP Sbjct: 578 PVASPPPPSPPPPVHSPP--PPPVFSPPP 604 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PP PP P PP Sbjct: 584 PPSPPPPVHSPP--PPPVFSPPPPVFSPP 610 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP PPP P Sbjct: 567 PPPPHVYSPPPPVASPPPPSPPPPVHSPPP 596 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PP PPP PP P Sbjct: 583 PPPSPPPPVHSPP---PPPVFSPPPPVFSP 609 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PPP PP PPP P Sbjct: 576 PPPVASP---PPPSPPPPVHSPPPPPVFSP 602 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP P PP PPP Sbjct: 603 PPPVFSPPPPSPVYSPPPPSHSPPP 627 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 31.5 bits (68), Expect = 0.90 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GG GGG GGG GG GGG Sbjct: 91 GTTPPGGGDVGGGGGGYGGGTPGGGGGGGG 120 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GG GG G G G Sbjct: 101 GGGGGGYGGGTPGGGGGGGGDTGAGAGGG 129 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG GGG G G GG GGG Sbjct: 113 GGGGGGGGDTGAGAGGGGYGGGG 135 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GG GGG GG G G Sbjct: 96 GGGDVGGGGGGYGGGTPGGGGGGGGDTGAG 125 >At3g43583.1 68416.m04636 hypothetical protein Length = 100 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP PP PPP PPP P P Sbjct: 22 PPEKPPSPEPPPSPEPPPSPEKPTSPEQP 50 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P P P P PPP P P PPP Sbjct: 108 PHPHPKPPIVKPPTKPPPSTPKPPTKPPP 136 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP P PPP PP PPP P Sbjct: 114 PPIVKPPTKPPPSTPKPPTKPPPSTPKPP 142 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP PP P P PPP P P P Sbjct: 119 PPTKPPPSTPKPPTKPPPSTPKPPTTKPP 147 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP PP PPP P P PP Sbjct: 131 PTKPPPSTPKPPTTKPPPSTPKPPHHKPP 159 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP PP PP PP P P P Sbjct: 217 PPTPTPPVVTPPTPTPPVVTPPTPTPPTP 245 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Frame = +2 Query: 905 PPPXXP-PXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P P PPP PP PP P Sbjct: 123 PPPSTPKPPTKPPPSTPKPPTTKPPPSTPKP 153 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 2/32 (6%) Frame = +2 Query: 905 PPPXXP--PXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P P PPP PP PP P Sbjct: 134 PPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPP 165 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 2/32 (6%) Frame = +2 Query: 905 PPPXXP--PXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P P PPP PPP P P Sbjct: 146 PPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTP 177 Score = 28.3 bits (60), Expect = 8.4 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +2 Query: 905 PPPXXPPXXXP-PPXXXPPP-XXPPPXXXXXP 994 PP PP P PP PPP PPP P Sbjct: 141 PPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTP 172 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXP 987 P PP PP PP PP P P Sbjct: 177 PPTPTPPVITPPTPTPPVVTPPTPTPP 203 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXP 987 P PP PP PP PP P P Sbjct: 187 PPTPTPPVVTPPTPTPPVITPPTPTPP 213 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXP 987 P PP PP PP PP P P Sbjct: 197 PPTPTPPVITPPTPTPPVITPPTPTPP 223 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXP 987 P PP PP PP PP P P Sbjct: 207 PPTPTPPVITPPTPTPPVVTPPTPTPP 233 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PPP PP P PP Sbjct: 323 PVQKPPTPTYSPPIKPPPVKPPTPIYSPP 351 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PPP PP P PP Sbjct: 457 PVHKPPTPTYSPPIKPPPVKPPTPTYSPP 485 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PPP PP P PP Sbjct: 507 PIQKPPTPTYSPPIKPPPVKPPTPTYSPP 535 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P P P PP PP PP P PP Sbjct: 340 PVKPPTPIYSPPVKPPPVHKPPTPIYSPP 368 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P P P PP PP PP P PP Sbjct: 424 PVKPPTPIYSPPVKPPPVHKPPTPIYSPP 452 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P P P PP PP PP P PP Sbjct: 474 PVKPPTPTYSPPVQPPPVQKPPTPTYSPP 502 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P P P PP PP PP P PP Sbjct: 524 PVKPPTPTYSPPIKPPPVHKPPTPTYSPP 552 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 PPP P PPP PP PP Sbjct: 59 PPPIYSPPIYPPPIQKPPTYSPP 81 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PP PP P P Sbjct: 65 PPIYPPPIQKPPTYSPPIYPPPIQKPPTP 93 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP PP PP PP P PP Sbjct: 70 PPIQKPPTYSPPIYPPPIQKPPTPTYSPP 98 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 182 PPIKPPVHKPPTPIYSPPIKPPP 204 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 334 PPIKPPPVKPPTPIYSPPVKPPP 356 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP PP PP PP PPP P Sbjct: 451 PPVKPPPVHKPPTPTYSPPIKPPPVKPPTP 480 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 468 PPIKPPPVKPPTPTYSPPVQPPP 490 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP PP PP PP PPP P Sbjct: 501 PPVKPPPIQKPPTPTYSPPIKPPPVKPPTP 530 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 518 PPIKPPPVKPPTPTYSPPIKPPP 540 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP PP PP PP PPP P Sbjct: 317 PPIKPPPVQKPPTPTYSPPIKPPPVKPPTP 346 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP P PPP PP P Sbjct: 338 PPPVKPPTPIYSPPVKPPPVHKPPTPIYSP 367 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP P PPP PP P Sbjct: 472 PPPVKPPTPTYSPPVQPPPVQKPPTPTYSP 501 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP P PPP PP P Sbjct: 522 PPPVKPPTPTYSPPIKPPPVHKPPTPTYSP 551 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 137 PIQKPPTPSYSPPVKPPPVQMPPTPTYSPP 166 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 148 PPVKPPPVQMPPTPTYSPPIKPPP 171 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 154 PVQMPPTPTYSPPIKPPPVHKPPTPTYSPP 183 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 187 PVHKPPTPIYSPPIKPPPVHKPPTPIYSPP 216 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 204 PVHKPPTPIYSPPIKPPPVHKPPTPTYSPP 233 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 221 PVHKPPTPTYSPPVKPPPVHKPPTPIYSPP 250 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 232 PPVKPPPVHKPPTPIYSPPIKPPP 255 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 238 PVHKPPTPIYSPPIKPPPVHKPPTPIYSPP 267 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 255 PVHKPPTPIYSPPVKPPPVQTPPTPIYSPP 284 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 266 PPVKPPPVQTPPTPIYSPPVKPPP 289 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 272 PVQTPPTPIYSPPVKPPPVHKPPTPTYSPP 301 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 289 PVHKPPTPTYSPPVKSPPVQKPPTPTYSPP 318 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 300 PPVKSPPVQKPPTPTYSPPIKPPP 323 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 306 PVQKPPTPTYSPPIKPPPVQKPPTPTYSPP 335 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 350 PPVKPPPVHKPPTPIYSPPVKPPP 373 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 356 PVHKPPTPIYSPPVKPPPVHKPPTPIYSPP 385 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 367 PPVKPPPVHKPPTPIYSPPVKPPP 390 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 384 PPVKPPPIQKPPTPTYSPPIKPPP 407 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 434 PPVKPPPVHKPPTPIYSPPVKPPP 457 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 440 PVHKPPTPIYSPPVKPPPVHKPPTPTYSPP 469 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 484 PPVQPPPVQKPPTPTYSPPVKPPP 507 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 557 PIHKPPTPTYSPPIKPPPVHKPPTPTYSPP 586 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 574 PVHKPPTPTYSPPIKPPPVHKPPTPTYSPP 603 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 591 PVHKPPTPTYSPPIKPPPVHKPPTPTYSPP 620 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 608 PVHKPPTPTYSPPIKPPPVHKPPTPTYSPP 637 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 625 PVHKPPTPTYSPPIKPPPVHKPPTPTYSPP 654 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 642 PVHKPPTPTYSPPIKPPPVQKPPTPTYSPP 671 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 659 PVQKPPTPTYSPPVKPPPVQLPPTPTYSPP 688 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 670 PPVKPPPVQLPPTPTYSPPVKPPP 693 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 676 PVQLPPTPTYSPPVKPPPVQVPPTPTYSPP 705 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 687 PPVKPPPVQVPPTPTYSPPVKPPP 710 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 693 PVQVPPTPTYSPPVKPPPVQVPPTPTYSPP 722 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 704 PPVKPPPVQVPPTPTYSPPIKPPP 727 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P P P Sbjct: 710 PVQVPPTPTYSPPIKPPPVQVPPTPTTPSP 739 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 80 PPIYPPPIQKPPTPTYSPPIYPPP 103 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 86 PIQKPPTPTYSPPIYPPPIQKPPTPTYSPP 115 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 97 PPIYPPPIQKPPTPTYSPPIYPPP 120 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 103 PIQKPPTPTYSPPIYPPPIQKPPTPTYSPP 132 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 114 PPIYPPPIQKPPTPTYSPPIYPPP 137 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 120 PIQKPPTPTYSPPIYPPPIQKPPTPSYSPP 149 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 131 PPIYPPPIQKPPTPSYSPPVKPPP 154 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 198 PPIKPPPVHKPPTPIYSPPIKPPP 221 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 215 PPIKPPPVHKPPTPTYSPPVKPPP 238 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 249 PPIKPPPVHKPPTPIYSPPVKPPP 272 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 373 PVHKPPTPIYSPPVKPPPIQKPPTPTYSPP 402 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 390 PIQKPPTPTYSPPIKPPPLQKPPTPTYSPP 419 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 490 PVQKPPTPTYSPPVKPPPIQKPPTPTYSPP 519 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 534 PPIKPPPVHKPPTPTYSPPIKPPP 557 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 540 PVHKPPTPTYSPPIKPPPIHKPPTPTYSPP 569 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 551 PPIKPPPIHKPPTPTYSPPIKPPP 574 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 568 PPIKPPPVHKPPTPTYSPPIKPPP 591 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 585 PPIKPPPVHKPPTPTYSPPIKPPP 608 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 602 PPIKPPPVHKPPTPTYSPPIKPPP 625 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 619 PPIKPPPVHKPPTPTYSPPIKPPP 642 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 636 PPIKPPPVHKPPTPTYSPPIKPPP 659 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 653 PPIKPPPVQKPPTPTYSPPVKPPP 676 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP PP PP P P PPP Sbjct: 385 PPPPPPSAAAPPPPPPPKKGPAAPPPPPP 413 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP P PPP P PPP Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPP 412 Score = 28.7 bits (61), Expect = 6.4 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 906 PXPXXPPXXXPPPXXPPPXXXPXPXXP 986 P P PP PP PPP P P Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPP 410 >At1g07135.1 68414.m00759 glycine-rich protein Length = 155 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 989 GGXXGXGGXXGGGXXXGGXXXGGG 918 GG G GG GGG GG GGG Sbjct: 65 GGGGGGGGRGGGGARSGGRSRGGG 88 Score = 28.3 bits (60), Expect = 8.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GG G GGG Sbjct: 65 GGGGGGGGRGGGGARSGGRSRGGG 88 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +2 Query: 905 PPPXXPPXXXP--PPXXXPPPXXPPP 976 PPP PP PP PPP PPP Sbjct: 65 PPPSPPPPKKSSCPPSPLPPPPPPPP 90 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +1 Query: 919 PPPXXXPP--XXXPPPXXPPXPXXPPP 993 PPP PP PP PP P PPP Sbjct: 65 PPPSPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP P PPP PPP P Sbjct: 51 PPPSPPPPSCTPSP--PPPSPPPPKKSSCP 78 Score = 28.7 bits (61), Expect = 6.4 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 6/35 (17%) Frame = +1 Query: 907 PXXXPPPXXXP---PXXXPPPXX---PPXPXXPPP 993 P PPP P P PPP PP P PPP Sbjct: 52 PPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPP 86 Score = 28.3 bits (60), Expect = 8.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP P PP P PPP Sbjct: 50 PPPPSPPPPSCTP--SPPPPSPPPP 72 >At5g25550.1 68418.m03040 leucine-rich repeat family protein / extensin family protein similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana]; contains Pfam PF00560: Leucine Rich Repeat domains Length = 433 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +3 Query: 906 PXPXXPPXXXPPPXXP-PPXXXPXPXXP 986 P P PP PPP P PP P P P Sbjct: 398 PSPTSPPLSTPPPARPCPPVYSPPPPPP 425 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 6/31 (19%) Frame = +1 Query: 919 PPPXXXPPXXX------PPPXXPPXPXXPPP 993 PPP PP PPP PP P PPP Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPPPPPPP 38 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 906 PXPXXPPXXXPPPXXPPPXXXP 971 P P PP PPP PPP P Sbjct: 25 PPPQPPPPPPPPPPPPPPRLGP 46 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPP 973 PP PP PPP PPP P Sbjct: 25 PPPQPPPPPPPPPPPPPPRLGP 46 Score = 29.1 bits (62), Expect = 4.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 923 PXXXPPPXXXPPPXXPPP 976 P PPP PPP PPP Sbjct: 25 PPPQPPPPPPPPPPPPPP 42 Score = 29.1 bits (62), Expect = 4.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 937 PPXXXPPPXXPPXPXXPP 990 PP PPP PP P PP Sbjct: 25 PPPQPPPPPPPPPPPPPP 42 Score = 29.1 bits (62), Expect = 4.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 940 PXXXPPPXXPPXPXXPPP 993 P PPP PP P PPP Sbjct: 25 PPPQPPPPPPPPPPPPPP 42 Score = 28.3 bits (60), Expect = 8.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPP 990 PPP PP PPP PP P P Sbjct: 25 PPPQPPPPP--PPPPPPPPPRLGP 46 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXP 970 PPP P PPP PPP P Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPP 432 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PPP P PPP Sbjct: 423 PVYSPPPS--PPVFSPPPSPPVYSPPPPP 449 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +1 Query: 919 PPPXXXPPXXXP---PPXXPPXPXXPPP 993 PPP PP P PP PP PPP Sbjct: 421 PPPVYSPPPSPPVFSPPPSPPVYSPPPP 448 Score = 28.7 bits (61), Expect = 6.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PPP PP PPP Sbjct: 418 PPLPPPVYSPPPS--PPVFSPPP 438 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PP PP P P PP PPP Sbjct: 405 PPIVALPPPPPPSPPLPPPVYSPPP 429 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 906 PXPXXPPXXXPPPXXPPPXXXPXPXXP 986 P PP P P PPP P P P Sbjct: 406 PIVALPPPPPPSPPLPPPVYSPPPSPP 432 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GG GGG GG GGG Sbjct: 56 GGGGAWGGEGEGGGEWGGGGEGGG 79 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 47 GGGAWGGGG--GGGGAWGGEGEGGGEWGG 73 Score = 28.3 bits (60), Expect = 8.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG GGG GG GG GGG Sbjct: 52 GGGGGGGGAWGGEGEGGGEWGGG 74 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GGG GG GGG G Sbjct: 56 GGGGAWGGEGEGGGEWGGGGEGGGGGRRG 84 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GG GGG GG GGG Sbjct: 92 GGGSSGGRGGFGGGGGRGGGRGGG 115 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G G GGG GG GG G Sbjct: 92 GGGSSGGRGGFGGGGGRGGGRGGGSYGGG 120 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPP----XXPPXPXXPPP 993 P PPP PP PP PP P PPP Sbjct: 109 PTVSPPPVSPPPAPTSPPPTPASPPPAPASPPP 141 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPP-PXXPPPXXXXXP 994 PP P PPP PP P PPP P Sbjct: 104 PPASAPTVSPPPVSPPPAPTSPPPTPASPP 133 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 922 PPXXXPPXXXPPPXXPPXPXXPPP 993 PP P PP PP P PPP Sbjct: 104 PPASAPTVSPPPVSPPPAPTSPPP 127 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +2 Query: 908 PPXXPPXXXPP--PXXXPPPXXPPPXXXXXP 994 PP PP P P PPP PPP P Sbjct: 96 PPPQPPQSPPASAPTVSPPPVSPPPAPTSPP 126 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = +2 Query: 905 PPPXX---PPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP PP PPP PPP PP P Sbjct: 94 PPPVVVRPPPIIRPPPVVYPPPIVRPPPITRPP 126 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PP P P PPP Sbjct: 109 PVVYPPPIVRPPPITRPPIIIP-PIQPPP 136 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP PP PP PP PPP Sbjct: 160 PPGLLPPVTTPPGLLPPIINPPPVTVPPP 188 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP PP PP PP PPP P Sbjct: 165 PPVTTPPGLLPPIINPPPVTVPPPSSGYPP 194 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +1 Query: 919 PPPXXXPPXXXPPP--XXPPXPXXPPP 993 PPP PP PPP PP PPP Sbjct: 38 PPPGGYPPQGYPPPPHGYPPAAYPPPP 64 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PPP PP PPP P Sbjct: 30 PPP--PQGAYPPPGGYPPQGYPPPPHGYPP 57 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Frame = +2 Query: 905 PPPXXPPXX-XPPPXXXPPPXXPPPXXXXXP 994 PP PP PPP PP PPP P Sbjct: 39 PPGGYPPQGYPPPPHGYPPAAYPPPPGAYPP 69 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P PPP P P P P P Sbjct: 54 PPPKPQPKPVPPPACPPTPPKPQPKPAPPP 83 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +1 Query: 907 PXXXPPPXXXP-PXXXPPPXXPPXPXXPP 990 P PPP P P PPP P P PP Sbjct: 38 PQPKPPPAPSPSPCPSPPPKPQPKPVPPP 66 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +1 Query: 907 PXXXPPPXXXP--PXXXPPPXXPPXPXXPPP 993 P PPP P P P P PP P PP Sbjct: 60 PKPVPPPACPPTPPKPQPKPAPPPEPKPAPP 90 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPP 976 PP PP P P PPP P P Sbjct: 172 PPPSPPYFPPEPPSIPPPPPPSP 194 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP P P P PP P P P Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGPKGPRP 413 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP P PPP P P PPP Sbjct: 389 PPPAPPPGSGGPKPPPPP-GPKGPRPPPP 416 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP P P P PP P P P Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGPKGPRP 413 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP P PPP P P PPP Sbjct: 389 PPPAPPPGSGGPKPPPPP-GPKGPRPPPP 416 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 PPP PP P PPP PP Sbjct: 50 PPPPSPPPPSTPTTACPPPPSPP 72 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP P PP PP PPP Sbjct: 51 PSMSPPPSPSLPLSSSPPPPPPHKHSPPP 79 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 124 GGGYSGGGGGYGGGG--GGYGGGGGGYGG 150 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG G GGG Sbjct: 124 GGGYSGGGGGYGGGGGGYGGGGGG 147 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 G G GGG GGG GG GGG Sbjct: 133 GYGGGGGGYGGGGGGYGGGGDGGG 156 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 125 GGYSGGGGGYGGGGGGYGGGG--GGYGGGG 152 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GG G GG GGG GG GGG Sbjct: 132 GGYGGGGGGYGGGGGGYGGGGDGGG 156 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 131 GGGYGGGGGGYGGG---GGGYGGGGDGGGG 157 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 989 GGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GG G GG GG GG GGG G Sbjct: 129 GGGGGYGGGGGGYGGGGGGYGGGGDGGG 156 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PP P PPP PPP P P P Sbjct: 167 PPVPTDPMPSPPPPVSPPPPTPTPSVPSPP 196 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP P P P PPP P P Sbjct: 83 PPPPTPSVPSPTPPVSPPPPTPTP 106 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXP--PXPXXPPP 993 P PPP P P P P P P PPP Sbjct: 150 PVSPPPPTPTPSVPSPTPPVPTDPMPSPPPP 180 Score = 28.3 bits (60), Expect = 8.4 Identities = 15/60 (25%), Positives = 15/60 (25%) Frame = +1 Query: 814 PXPPXXXXXXXXXPXXXXXXXXXXXXXXXXXPXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PP P P PPP P P P P P P P Sbjct: 83 PPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTP 142 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPP 990 P PPP PP P P P P P Sbjct: 173 PMPSPPPPVSPPPPTPTPSVPSPPDVTP 200 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GGG G GG GGG G GGG Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGG 68 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 107 GGHYGGGGGGHGGGGHYGGGG--GGYGGGG 134 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 108 GHYGGGGGGHGGGGHYGGGGGGYGG--GGG 135 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -1 Query: 975 GGGXXG-GGXXXGGGXXXGGXXGGG 904 GGG G GG GGG GG GGG Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGG 68 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 100 GGHYGGGGGHYGGG---GGGHGGGGHYGGG 126 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGG 907 G GG GGG GGG GG GG Sbjct: 101 GHYGGGGGHYGGGGGGHGGGGHYGGGGGG 129 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 989 GGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GG G G GGG GG GGG G Sbjct: 104 GGGGGHYGGGGGGHGGGGHYGGGGGGYG 131 Score = 28.3 bits (60), Expect = 8.4 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Frame = -2 Query: 992 GGGXXGXG--GXXGGGXXXGGXXXGGG 918 GGG G G G GGG GG GGG Sbjct: 114 GGGHGGGGHYGGGGGGYGGGGGHHGGG 140 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GGG G GG GGG G GGG Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGG 68 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -1 Query: 975 GGGXXG-GGXXXGGGXXXGGXXGGG 904 GGG G GG GGG GG GGG Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGG 68 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 77 GGGGGGLGG--GGGGLLGGGGFGGGAGGG 103 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GG GG GGG Sbjct: 80 GGGLGGGGGGLLGGGGFGGGAGGG 103 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 73 GLGLGGGGGGLGGG---GGGLLGGGGFGGG 99 >At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) Length = 130 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPPPXXXP-PXXXPPPXXPPXPXXPPP 993 P PPP P P PPP P P PP Sbjct: 36 PVATPPPAATPAPTTTPPPAVSPAPTSSPP 65 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP P PP Sbjct: 105 PTYKPPTPTVKPPSVQPPTYKPPTPTVKPP 134 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 P P PP PP P P PPP Sbjct: 595 PSPPLPPVIPSPPIVGPTPSSPPP 618 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 124 GGGYSYGGG--GGGYGGGGGGYGGGGDGGG 151 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 126 GYSYGGGGGGYGGG---GGGYGGGGDGGGG 152 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG GG GG GG GGG G Sbjct: 123 GGGGYSYGGGGGGYGGGGGGYGGGGDGGG 151 >At3g49840.1 68416.m05449 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 606 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPPPXXXPP-XXXPPPXXPPXPXXPPP 993 P PPP PP PP PP PPP Sbjct: 491 PVSAPPPQGYPPKEGYPPAGYPPPAGYPPP 520 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PPP PP Sbjct: 496 PPQGYPPKEGYPPAGYPPPAGYPP 519 >At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 202 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG GGG G Sbjct: 8 GGGFRGRGGRDGGG---GGRFGGGGGRFG 33 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG G G G G Sbjct: 193 GGGGGGGGGGGGGGVDGSGSGSGSGSGGG 221 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG G G G G Sbjct: 191 GGGGGGGGGGGGGGGGVDGSGSGSGSGSG 219 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG G G G GGG Sbjct: 192 GGGGGGGGGGGGGGGVDGSGSGSGSGSGGG 221 >At1g35617.1 68414.m04424 hypothetical protein Length = 121 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PP PP P P Sbjct: 21 PPPAPPPESSSPPTPPEPPDPPDP 44 >At5g67600.1 68418.m08524 expressed protein Length = 82 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P PPP PP PP P PPP Sbjct: 8 PVGAPPPQGYPPKDGYPPAGYPPAGYPPP 36 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PP PP PP PP PPP Sbjct: 13 PPQGYPPKDGYPPAGYPPAGYPPP 36 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXG-GXXGGG 904 GGG GGG GGG G G GGG Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGG 146 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGG 907 GGG GGG GG GG GG Sbjct: 127 GGGYGGGGGGYGGSGGYGGGAGG 149 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GG GG G G G Sbjct: 127 GGGYGGGGGGYGGSGGYGGGAGGYGGSGG 155 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG G G GG GG G Sbjct: 131 GGGGGGYGGSGGYGGGAGGYGGSGGYGGG 159 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GG GG GG G Sbjct: 134 GGGYGGSGGYGGGAGGYGGSGGYGGGAGG 162 >At5g07190.1 68418.m00819 embryo-specific protein 3, putative similar to embryo-specific protein 3 GI:3335171 from [Arabidopsis thaliana] Length = 213 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP P PPP P P Sbjct: 160 PPPHFPPEFPPETPTTPPPPPPRP 183 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PP PP P PPP Sbjct: 312 PPPPPPPPLLQQPPPPPSVSKAPPP 336 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 5/29 (17%) Frame = +2 Query: 905 PPPXXPPXXXPPP-----XXXPPPXXPPP 976 PPP PP PP PPP PPP Sbjct: 313 PPPPPPPLLQQPPPPPSVSKAPPPPPPPP 341 >At3g26400.1 68416.m03292 eukaryotic translation initiation factor 4B, putative/ eIF-4B, putative similar to eukaryotic initiation factor 4B [Arabidopsis thaliana] GI:6739518 Length = 532 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG GGG GG GGG Sbjct: 190 GRYSGDGGGFGGGGSGFGGG---GGGGGGG 216 >At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to SP|P52597 Heterogeneous nuclear ribonucleoprotein F (hnRNP F) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 350 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GG GGG Sbjct: 212 GGGGLGGGNGSGGG--GGGGGGGG 233 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 5/34 (14%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXP---PPXX--PPXPXXPPP 993 P PPP PP P PP PP P PPP Sbjct: 60 PVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPP 93 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 3/32 (9%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXP---PPXXXXXP 994 PP P PPP PPP P PP P Sbjct: 55 PPPPTPVYSPPPADLPPPPTPYYSPPADLPPP 86 >At1g71830.1 68414.m08301 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 625 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPP 973 P P PP PPP PPP P Sbjct: 209 PCPGSPPFSPPPPFIQPPPVSTP 231 >At1g53640.1 68414.m06100 hypothetical protein ; expression supported by MPSS Length = 290 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GG GGG Sbjct: 269 GGGGCGGGGGCGGG--CGGGCGGG 290 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GGG G G GG G G Sbjct: 182 GSRYGGGGGSFGGGGGGGAGSYGGGGAGAG 211 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GG GGG G GGG Sbjct: 187 GGGGSFGGGGGGGAGSYGGGGAGAGSGGGG 216 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG G G GGG G GGG Sbjct: 188 GGGSFGGGGGGGAGSYGGGGAGAGSGGGGG 217 >At5g61660.1 68418.m07736 glycine-rich protein Length = 134 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG G G G GGG Sbjct: 93 GGGARGGGYGYGSGNGRSGGGGGG 116 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G G GGG G GGG G Sbjct: 43 GGGSYGGRGGYGGGGGRGNRGGGGGGYQG 71 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GG GGG G GGG Sbjct: 37 GGRGASGGGSYGGRGGYGGGGGRGNRGGGG 66 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G G GGG G GGG G Sbjct: 43 GGGSYGGRGGYGGGGGRGNRGGGGGGYQG 71 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GG GGG G GGG Sbjct: 37 GGRGASGGGSYGGRGGYGGGGGRGNRGGGG 66 >At5g57290.1 68418.m07157 60S acidic ribosomal protein P3 (RPP3B) Length = 120 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGG 907 GG GGG GGG GG GG Sbjct: 70 GGGGGGGFAAGGGAAAGGGGGG 91 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXG 910 GGG GGG GGG GG G Sbjct: 128 GGGQGGGGQGGGGGGAEGGTTG 149 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPPP 993 P P P PP PPP P P P P Sbjct: 337 PVLPPVPIVNPPSLPPPPPSFPVPLPPVP 365 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +1 Query: 907 PXXXPPPXXX--PPXXXPPPXXPPXPXXPPP 993 P PPP P PPP P P PPP Sbjct: 313 PYQPPPPTQSLHQPPYQPPPQQPQYPQQPPP 343 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXP-PPXXPPXPXXPP 990 P PP P PP P PP PP P PP Sbjct: 1122 PAGSPPLPHESPPSPPPQPPSSPPPPSSPP 1151 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 907 PXXXPP-PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PPP PP PP Sbjct: 1129 PHESPPSPPPQPPSSPPPPSSPPQLAPAPP 1158 >At4g29030.1 68417.m04151 glycine-rich protein glycine-rich protein - Onobrychis viciifolia,PID:g2565429 Length = 115 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG GGG G G GG GGG Sbjct: 75 GGGLGGGLGGGAGSGLGGGLGGG 97 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GG GGG G G GG GGG Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGGG 35 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGG 907 GGG GG GGG GG GG Sbjct: 575 GGGGGGGSDYYGGGGYGGGGYGG 597 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGG 907 GGG GG GGG GG GG Sbjct: 575 GGGGGGGSDYYGGGGYGGGGYGG 597 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 29.1 bits (62), Expect = 4.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 937 PPXXXPPPXXPPXPXXPP 990 PP PPP PP P PP Sbjct: 68 PPSPSPPPPPPPRPPPPP 85 >At3g46270.1 68416.m05008 receptor protein kinase-related contains weak similarity to light repressible receptor protein kinase (GI:1321686) [Arabidopsis thaliana] Length = 470 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG GGG GGG GG GG Sbjct: 363 GGKSGGGDNGGGGGQSGGGNNGG 385 >At2g28670.1 68415.m03485 disease resistance-responsive family protein / fibroin-related contains similarity to silk fibroin heavy chain [Bombyx mori] gi|765323|gb|AAB31861; contains disease resistance response protien domain Pfam:FP03018 Length = 447 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G G GGG G GGG G Sbjct: 185 GGGGAGAGPALGGGVAGSGSALGGGASAG 213 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP P P P PP PPP Sbjct: 54 PPPPPLPDFAPQPLLPPPSPPPPP 77 Score = 28.7 bits (61), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP P P PP P PPP Sbjct: 54 PPPPPLPDFAPQPLLPPPSPPPPPP 78 >At1g63570.1 68414.m07186 receptor-like protein kinase-related contains Pfam profile: PF01657 Domain of unknown function DUF26; similar to receptor-like protein kinase 4 (GI:13506745) [Arabidopsis thaliana] Length = 284 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +1 Query: 907 PXXXPP--PXXXPPXXXPPPXXPPXPXXPPP 993 P PP P PP PP PP PPP Sbjct: 251 PSSLPPISPTSSPPLSLPPQLPPPLSQPPPP 281 >At1g34210.1 68414.m04245 somatic embryogenesis receptor-like kinase 2 (SERK2) nearly identical to somatic embryogenesis receptor-like kinase 2 [Arabidopsis thaliana] GI:14573457; contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain; identical to cDNA somatic embryogenesis receptor-like kinase 2 (SERK2) GI:14573456 Length = 628 Score = 29.1 bits (62), Expect = 4.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 906 PXPXXPPXXXPPPXXPPP 959 P P PP PPP PPP Sbjct: 212 PCPGSPPFSPPPPFIPPP 229 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPPXXXXXP 994 PPP P P P PPP PPP P Sbjct: 223 PPPPPPSQPLPRPLLLPPP--PPPSFHAQP 250 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGG 907 GGG GGG GG GG GG Sbjct: 59 GGGISGGGGFGAGGGWIGGSVGG 81 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GG GG G G G Sbjct: 59 GGGISGGGGFGAGGGWIGGSVGGFGGGIG 87 Score = 28.7 bits (61), Expect = 6.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GG G GG GGG GG G G Sbjct: 76 GGSVGGFGGGIGGGFGGGGFGGGAG 100 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GGG GG GG GG GGG Sbjct: 65 GGGFGAGGGWIGGSVGGFGGGIGGGFGGGG 94 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GG G G Sbjct: 44 GGGGEGGGGEGGGGEGGGGQKISKGGGGG 72 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GGG GGG G Sbjct: 49 GGGGEGGGGEGGGGQKISKGGGGGGSGGG 77 Score = 28.3 bits (60), Expect = 8.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 GGG GGG GGG GGG Sbjct: 49 GGGGEGGGGEGGGGQKISKGGGGG 72 >At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family protein similar to SP|P42925 22 kDa peroxisomal membrane protein {Mus musculus}; contains Pfam profile PF04117: Mpv17 / PMP22 family Length = 288 Score = 28.7 bits (61), Expect = 6.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGG 918 GG G GG G G GG GGG Sbjct: 78 GGNSGGSGGLGGSGGGGGGSGGGGG 102 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GG G GGG G Sbjct: 388 GGGGGGGGGPMSGGLPPGFRPMGGGGGGG 416 >At5g07150.1 68418.m00815 leucine-rich repeat family protein contains weak similarity to LRR receptor-like protein kinase [Nicotiana tabacum] gi|7672732|gb|AAF66615; contains Pfam PF00560 domain Leucine Rich Repeat Length = 553 Score = 28.7 bits (61), Expect = 6.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPP 961 P P PP PPP PPP Sbjct: 193 PSPVPPPPAQPPPAQTPPP 211 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GG GG GG G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGG 116 Score = 28.3 bits (60), Expect = 8.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 G G GGG GGG G GGG Sbjct: 93 GRGGSGGGYRSGGGGGYSGGGGGG 116 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GG GG GG G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGG 116 Score = 28.3 bits (60), Expect = 8.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 975 GGGXXGGGXXXGGGXXXGGXXGGG 904 G G GGG GGG G GGG Sbjct: 93 GRGGSGGGYRSGGGGGYSGGGGGG 116 Score = 28.3 bits (60), Expect = 8.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG GG GGG GG GGG Sbjct: 135 GGGGGGRGYGGGGRREGGGYGGG 157 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 28.7 bits (61), Expect = 6.4 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 4/29 (13%) Frame = +1 Query: 919 PPPXXXP-PXXXPPP---XXPPXPXXPPP 993 PPP P P PPP PP P PPP Sbjct: 50 PPPVMSPMPMMTPPPMPMTPPPMPMTPPP 78 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 28.7 bits (61), Expect = 6.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 920 PPXXXPPPXXXPPPXXPPP 976 PP P P PPP PPP Sbjct: 217 PPPKPPSPPRKPPPPPPPP 235 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PPP PPP P P PPP Sbjct: 43 PPPSPSTNSTSPPPSSPLPPSLPPP 67 >At1g63550.1 68414.m07184 hypothetical protein low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 299 Score = 28.7 bits (61), Expect = 6.4 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 906 PXPXXPPXXXPPPXXPPPXXXPXPXXP 986 P P PP PPP PP P P Sbjct: 228 PSPSAPPPRSPPPKSSPPSSLPQTPSP 254 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 28.7 bits (61), Expect = 6.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 908 PPXXPPXXXPPPXXXPPPXXPPP 976 PP P PPP PPP PPP Sbjct: 109 PPPANPVSSPPPESSPPP--PPP 129 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 907 PXXXPPPXXXPPXXXPPPXXPPXPXXPP 990 P PPP P P P P P PP Sbjct: 143 PPTNPPPPPESPPSLPAPDPPSNPLPPP 170 >At5g59950.3 68418.m07518 RNA and export factor-binding protein, putative Length = 242 Score = 28.3 bits (60), Expect = 8.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG GG GGG GG GGG Sbjct: 187 GGQGRGGQQRGGGRGGGGRGGGG 209 >At5g59950.2 68418.m07519 RNA and export factor-binding protein, putative Length = 178 Score = 28.3 bits (60), Expect = 8.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG GG GGG GG GGG Sbjct: 123 GGQGRGGQQRGGGRGGGGRGGGG 145 >At5g59950.1 68418.m07517 RNA and export factor-binding protein, putative Length = 244 Score = 28.3 bits (60), Expect = 8.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG GG GGG GG GGG Sbjct: 189 GGQGRGGQQRGGGRGGGGRGGGG 211 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 28.3 bits (60), Expect = 8.4 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 6/36 (16%) Frame = +2 Query: 905 PPPXX----PPXXXPPPXXXPPP--XXPPPXXXXXP 994 PPP PP PPP PPP PPP P Sbjct: 88 PPPIKTYPHPPVKYPPPEQYPPPIKKYPPPEQYPPP 123 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 2/32 (6%) Frame = +2 Query: 905 PPPXXPPXXXPP--PXXXPPPXXPPPXXXXXP 994 PPP PP P PPP PPP P Sbjct: 709 PPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPP 740 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Frame = +2 Query: 905 PPPXXPPXXXPP-PXXXPPPXXPPPXXXXXP 994 PP PP PP P PP PPP P Sbjct: 150 PPDVVPPIWEPPRPPDIFPPESPPPGIDPPP 180 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 919 PPPXXXPPXXXPPPXXPPXPXXPPP 993 PP PP PP PP PPP Sbjct: 58 PPVVSSPPPSSSPPPSPPVITSPPP 82 >At5g10550.1 68418.m01221 DNA-binding bromodomain-containing protein low similarity to kinase [Gallus gallus] GI:1370092; contains Pfam profile PF00439: Bromodomain Length = 678 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 3/32 (9%) Frame = +1 Query: 907 PXXXPPPXXX---PPXXXPPPXXPPXPXXPPP 993 P PPP P P P PP P PPP Sbjct: 407 PTLPPPPVIEITRDPSPPPSPVQPPPPPSPPP 438 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 28.3 bits (60), Expect = 8.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 972 GGXXGGGXXXGGGXXXGGXXGGG 904 GG GG GGG GG GGG Sbjct: 71 GGGGGGRGYGGGGRREGGGYGGG 93 >At4g29240.1 68417.m04182 leucine-rich repeat family protein / extensin family protein contains Pfam PF00560: Leucine Rich Repeat domains; similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana] Length = 415 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 989 GGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GG G G GGG GG GGG G Sbjct: 33 GGGVGVGIGGGGGGGGGGVWVGGGYNNG 60 >At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi|20465684|gb|AY096677.1| Length = 158 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 992 GGGXXGXGGXXGGGXXXGGXXXGGGXXXG 906 GGG G GG GG GG G G G Sbjct: 82 GGGIGGLGGGVGGLGGLGGLGGGSGLGHG 110 >At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / heat shock transcription factor 7 (HSTF7) identical to heat shock factor protein 7 (HSF7) SP:Q9T0D3 from [Arabidopsis thaliana] Length = 377 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 993 GXXXXXGGGXXGGGXXXGGGXXXGGXXGGG 904 G GG G G GGG GG GGG Sbjct: 21 GCSAGNSGGSSGCGAGGGGGGSGGGGGGGG 50 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 PPPXXPPXXXPPPXXXPPPXXPPP 976 PPP PP PPP PPP Sbjct: 241 PPPQRPPMGGPPPPPHIGGSAPPP 264 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,997,209 Number of Sequences: 28952 Number of extensions: 147501 Number of successful extensions: 12872 Number of sequences better than 10.0: 146 Number of HSP's better than 10.0 without gapping: 646 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6265 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2431362000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -