BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_P18 (889 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 25 0.79 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 25 0.79 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 25 1.0 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 25.0 bits (52), Expect = 0.79 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +3 Query: 432 FGQDCNGDGVVNCYDYMAIHKKGGYGCXGELPFNYVNVFNQCIXVFAQ 575 FGQD N DGV+N + + + F +NVF+ + VF Q Sbjct: 434 FGQDLNQDGVMNINGVLFVFLT---NMTFQNVFAVINVFSGELPVFLQ 478 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 25.0 bits (52), Expect = 0.79 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +3 Query: 432 FGQDCNGDGVVNCYDYMAIHKKGGYGCXGELPFNYVNVFNQCIXVFAQ 575 FGQD N DGV+N + + + F +NVF+ + VF Q Sbjct: 434 FGQDLNQDGVMNINGVLFVFLT---NMTFQNVFAVINVFSGELPVFLQ 478 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 24.6 bits (51), Expect = 1.0 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = -1 Query: 322 ASAQ*PHVMRKRPHV--SPSHCRPCLHPEIAWQMQPRHTSVTGGSSETSAKQTPAT 161 +SA P V PH+ SP++ +P LH P S T +S S+ +PA+ Sbjct: 169 SSASSPSVTAA-PHLRDSPNYIKPQLHVSTGSTSSPTIASATYTNSANSSIWSPAS 223 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,861 Number of Sequences: 336 Number of extensions: 3959 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24617054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -