BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_P18 (889 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC069570-1|AAH69570.1| 456|Homo sapiens chromosome 6 open readi... 31 7.4 BC069567-1|AAH69567.1| 307|Homo sapiens C6orf192 protein protein. 31 7.4 AL137783-1|CAI19370.1| 456|Homo sapiens protein ( Human DNA seq... 31 7.4 AL032821-1|CAI95705.1| 456|Homo sapiens protein ( Human DNA seq... 31 7.4 AK123191-1|BAC85553.1| 221|Homo sapiens protein ( Homo sapiens ... 30 9.8 >BC069570-1|AAH69570.1| 456|Homo sapiens chromosome 6 open reading frame 192 protein. Length = 456 Score = 30.7 bits (66), Expect = 7.4 Identities = 22/64 (34%), Positives = 31/64 (48%) Frame = +3 Query: 153 LLLVAGVCFADVSELPPVTEVCLGCICQAISGCKQGLQCEGETCGLFRITWGYWADAGKP 332 L+LV A +S +P E+ L C + +G ++GL G GLF W A G P Sbjct: 337 LILVVSGLSAGMSIIPTFPEI-LSCAHE--NGFEEGLSTLGLVSGLFSAMWSIGAFMG-P 392 Query: 333 TING 344 T+ G Sbjct: 393 TLGG 396 >BC069567-1|AAH69567.1| 307|Homo sapiens C6orf192 protein protein. Length = 307 Score = 30.7 bits (66), Expect = 7.4 Identities = 22/64 (34%), Positives = 31/64 (48%) Frame = +3 Query: 153 LLLVAGVCFADVSELPPVTEVCLGCICQAISGCKQGLQCEGETCGLFRITWGYWADAGKP 332 L+LV A +S +P E+ L C + +G ++GL G GLF W A G P Sbjct: 188 LILVVSGLSAGMSIIPTFPEI-LSCAHE--NGFEEGLSTLGLVSGLFSAMWSIGAFMG-P 243 Query: 333 TING 344 T+ G Sbjct: 244 TLGG 247 >AL137783-1|CAI19370.1| 456|Homo sapiens protein ( Human DNA sequence from clone RP5-1181K21 on chromosome 6 Contains the 5' end of the gene for a novel protein, the RPS12 gene for ). Length = 456 Score = 30.7 bits (66), Expect = 7.4 Identities = 22/64 (34%), Positives = 31/64 (48%) Frame = +3 Query: 153 LLLVAGVCFADVSELPPVTEVCLGCICQAISGCKQGLQCEGETCGLFRITWGYWADAGKP 332 L+LV A +S +P E+ L C + +G ++GL G GLF W A G P Sbjct: 337 LILVVSGLSAGMSIIPTFPEI-LSCAHE--NGFEEGLSTLGLVSGLFSAMWSIGAFMG-P 392 Query: 333 TING 344 T+ G Sbjct: 393 TLGG 396 >AL032821-1|CAI95705.1| 456|Homo sapiens protein ( Human DNA sequence from clone RP1-55C23 on chromosome 6q22.3-23.3 Contains a pseudogene similar to part of hepatic leukemia factor ). Length = 456 Score = 30.7 bits (66), Expect = 7.4 Identities = 22/64 (34%), Positives = 31/64 (48%) Frame = +3 Query: 153 LLLVAGVCFADVSELPPVTEVCLGCICQAISGCKQGLQCEGETCGLFRITWGYWADAGKP 332 L+LV A +S +P E+ L C + +G ++GL G GLF W A G P Sbjct: 337 LILVVSGLSAGMSIIPTFPEI-LSCAHE--NGFEEGLSTLGLVSGLFSAMWSIGAFMG-P 392 Query: 333 TING 344 T+ G Sbjct: 393 TLGG 396 >AK123191-1|BAC85553.1| 221|Homo sapiens protein ( Homo sapiens cDNA FLJ41197 fis, clone BRACE2045947. ). Length = 221 Score = 30.3 bits (65), Expect = 9.8 Identities = 18/58 (31%), Positives = 25/58 (43%) Frame = -1 Query: 295 RKRPHVSPSHCRPCLHPEIAWQMQPRHTSVTGGSSETSAKQTPATNSNAQNLITAEAI 122 R+RP S HC+ C W +PR +S S T + + Q LI EA+ Sbjct: 115 RQRPAASRPHCQQC-----PWPSEPRRSSTPSRPSSTPPRPAGQGQALPQILIGREAL 167 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,930,198 Number of Sequences: 237096 Number of extensions: 2413740 Number of successful extensions: 5113 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4870 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5113 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11381686510 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -