BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_P18 (889 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g48700.1 68416.m05318 expressed protein similar to PrMC3 [Pin... 30 2.4 >At3g48700.1 68416.m05318 expressed protein similar to PrMC3 [Pinus radiata] GI:5487873 Length = 329 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 246 GCKQGLQCEGETCGLFRITWGYWADAGKPTING 344 GC + L E L R WGYW GK NG Sbjct: 257 GCGKVLVMVAEKDALVRQGWGYWEKLGKSRWNG 289 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,766,624 Number of Sequences: 28952 Number of extensions: 345071 Number of successful extensions: 834 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 812 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 834 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2081245872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -