BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_P16 (871 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g38700.1 68415.m04753 mevalonate diphosphate decarboxylase (M... 28 9.3 >At2g38700.1 68415.m04753 mevalonate diphosphate decarboxylase (MVD1) identical to mevalonate diphosphate decarboxylase [Arabidopsis thaliana] gi|2288887|emb|CAA74700 Length = 412 Score = 27.9 bits (59), Expect = 9.3 Identities = 23/88 (26%), Positives = 38/88 (43%) Frame = -2 Query: 363 KDREFQILGKEXDXVHHHEIFVGFHVCVAVLAGLDVEVLGDFVVLSFIADLVNVVEKRQX 184 K++ +I K+ + +H H + H AGL G ++ +A L+NV E Sbjct: 96 KEKGIKIAKKDWEKLHLH---IASHNNFPTAAGLASSAAGFACLVFALAKLMNVNEDPSQ 152 Query: 183 LLXLFDERSVNRCRFEFRYGATESEGNK 100 L + + S + CR F + GNK Sbjct: 153 LSAIARQGSGSACRSLFGGFVKWNMGNK 180 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,734,495 Number of Sequences: 28952 Number of extensions: 192674 Number of successful extensions: 331 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 322 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 331 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2038669600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -