BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_P15 (908 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBPB2B2.09c |||2-dehydropantoate 2-reductase |Schizosaccharomyc... 29 0.91 SPAC22F3.04 |mug62||AMP binding enzyme |Schizosaccharomyces pomb... 29 1.2 SPCC1235.03 |||SMR and CUE domain protein|Schizosaccharomyces po... 27 3.7 SPAC12G12.01c ||SPAC630.02|ubiquitin-protein ligase E3|Schizosac... 27 3.7 SPBC119.13c |prp31||U4/U6 x U5 tri-snRNP complex subunit Prp31|S... 27 4.9 SPCC1620.10 |cwf26||complexed with Cdc5 protein Cwf26 |Schizosac... 27 4.9 SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual 27 4.9 >SPBPB2B2.09c |||2-dehydropantoate 2-reductase |Schizosaccharomyces pombe|chr 2|||Manual Length = 350 Score = 29.1 bits (62), Expect = 0.91 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +3 Query: 519 VSWKLIALWENNKVYFKILNTERNQYLVLGVGTNWNG 629 + +K I L++NN+ KILN R V+ VGT NG Sbjct: 254 IFFKCIPLFKNNEEAEKILNVNRLLDRVMFVGTKVNG 290 >SPAC22F3.04 |mug62||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1428 Score = 28.7 bits (61), Expect = 1.2 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 Query: 421 VHKLNRVFGEDKSELNWETIPDDVL 347 +H + EDKS+L +ETIPD VL Sbjct: 9 IHPVRHSKYEDKSKLPFETIPDPVL 33 >SPCC1235.03 |||SMR and CUE domain protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 399 Score = 27.1 bits (57), Expect = 3.7 Identities = 12/38 (31%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +3 Query: 726 YNREYSKALTLS-RTVEPSGSPHGLGIHGQSXRKSRTL 836 Y+ + K +L+ R++ SG+ H L +HG + R+++T+ Sbjct: 285 YHEKALKYRSLAMRSLAHSGTSHSLDLHGATVREAKTI 322 >SPAC12G12.01c ||SPAC630.02|ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 1|||Manual Length = 905 Score = 27.1 bits (57), Expect = 3.7 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +3 Query: 504 KTSPRVSWKLIALWENNKVYFKILNTERNQYLVLGVGTN 620 K SP+V+WK +W + K K +++ +LG G++ Sbjct: 28 KASPKVNWKTHIIWRSLK-NVKCIDSFHGNNEILGAGSS 65 >SPBC119.13c |prp31||U4/U6 x U5 tri-snRNP complex subunit Prp31|Schizosaccharomyces pombe|chr 2|||Manual Length = 518 Score = 26.6 bits (56), Expect = 4.9 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +3 Query: 366 VSQLSSDLSSPKTRLSLCTSATV 434 VS L +DL + KT+LS SATV Sbjct: 166 VSSLLNDLDNSKTKLSFLPSATV 188 >SPCC1620.10 |cwf26||complexed with Cdc5 protein Cwf26 |Schizosaccharomyces pombe|chr 3|||Manual Length = 305 Score = 26.6 bits (56), Expect = 4.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 443 TLSNDVQGRRWQTCLRRRXGQDK-PESQLEVNRSVGEQQGLLQ 568 T+ D GRR L R+ + K E + E R +QQG++Q Sbjct: 155 TVYRDATGRRIDLVLARKEAKRKLKEKEEEARRQKEQQQGVVQ 197 >SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1236 Score = 26.6 bits (56), Expect = 4.9 Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +3 Query: 345 PRTSSGIVSQLSSDLSSP-KTRLSLCTSATVS 437 P T S + S LSS SSP T LS+ +S+T S Sbjct: 570 PSTFSSVSSILSSSTSSPSSTSLSISSSSTSS 601 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,976,522 Number of Sequences: 5004 Number of extensions: 51664 Number of successful extensions: 156 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 147 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 156 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 460503700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -