BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_P15 (908 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51104| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_8394| Best HMM Match : zf-C3HC4 (HMM E-Value=8.6e-08) 28 9.1 >SB_51104| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 326 Score = 28.3 bits (60), Expect = 9.1 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 2/57 (3%) Frame = -2 Query: 841 KRNVRDFRXLCPCIPRPCGEPEGSTVLD--SVKALLYSRL*M*NKTSLSYLAGCRYH 677 K V +FR I +PC P +TV+ S + L +T S L GC YH Sbjct: 185 KLPVINFRLKLGTIKQPCHRPVAATVITYYSQNRAKFDMLAKAVRTIYSLLVGCTYH 241 >SB_8394| Best HMM Match : zf-C3HC4 (HMM E-Value=8.6e-08) Length = 1631 Score = 28.3 bits (60), Expect = 9.1 Identities = 27/88 (30%), Positives = 40/88 (45%), Gaps = 6/88 (6%) Frame = +3 Query: 369 SQLSSDLSSPKTRLSLCTSATVSL*R*AMMFKGDDGRPAYGDGXDKTSPRVSWKLIALWE 548 S +S+L P T L++C ++SL K ++ R Y K +WK +LWE Sbjct: 485 SASASELMLP-TGLAVCAEKSLSL-----RIKSENSREFYQSLKGKLQ---TWKCKSLWE 535 Query: 549 ------NNKVYFKILNTERNQYLVLGVG 614 N+K Y + E Q LV+G G Sbjct: 536 LLDNRANHKDYDRGTTCEHLQVLVIGAG 563 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,918,167 Number of Sequences: 59808 Number of extensions: 407208 Number of successful extensions: 1051 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 956 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1051 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2621784220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -