BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_P15 (908 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g76730.1 68414.m08930 5-formyltetrahydrofolate cyclo-ligase f... 31 1.4 At1g04120.1 68414.m00401 ABC transporter family protein Strong s... 31 1.4 At5g56690.1 68418.m07076 F-box family protein contains F-box dom... 30 2.4 >At1g76730.1 68414.m08930 5-formyltetrahydrofolate cyclo-ligase family protein contains Pfam profile PF01812 5-formyltetrahydrofolate cyclo-ligase Length = 354 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 Query: 345 PRTSSGIVSQLSSDLSSPKTRLSLCTSATVS 437 PR +G S L SDL P+T + CTS V+ Sbjct: 171 PRLRTGFFSVLESDLLKPETIMEACTSVGVA 201 >At1g04120.1 68414.m00401 ABC transporter family protein Strong similarity to MRP-like ABC transporter gb|U92650 from A. thaliana and canalicular multi-drug resistance protein gb|L49379 from Rattus norvegicus Length = 1514 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/53 (22%), Positives = 26/53 (49%) Frame = +2 Query: 56 LGHTQASXLQSCSPLXXFXVFSWHLCMLQLPTSLTXFWRXSFTIASSSPITXV 214 LG ++ +Q C + +W + +L +P ++ FW + +ASS + + Sbjct: 1065 LGGFASTTIQLCGIVAVMTNVTWQVFLLVVPVAVACFWMQKYYMASSRELVRI 1117 >At5g56690.1 68418.m07076 F-box family protein contains F-box domain Pfam:PF00646 Length = 402 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/60 (28%), Positives = 30/60 (50%) Frame = +3 Query: 549 NNKVYFKILNTERNQYLVLGVGTNWNGDHMAFGVNSVDSFRAQWYLQPAKYDNDVLFYIY 728 N+K ++K + +YL + N F +NS+++FR +WY + D D L I+ Sbjct: 333 NSKSFYK---EKIGEYLPVSWSKNQGSVPKCF-LNSLETFRVKWYYSEEQEDRDFLSLIF 388 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,922,673 Number of Sequences: 28952 Number of extensions: 279681 Number of successful extensions: 745 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 722 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 745 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2149324008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -