BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_P14 (912 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 24 2.2 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 23 3.9 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 8.9 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 8.9 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 22 8.9 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 22 8.9 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.8 bits (49), Expect = 2.2 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -2 Query: 827 THHPRLQFSLGRPRCYSESI 768 +HH L +LGR C+S + Sbjct: 285 SHHSHLSSALGRSACHSPGV 304 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 23.0 bits (47), Expect = 3.9 Identities = 16/51 (31%), Positives = 21/51 (41%) Frame = -1 Query: 489 RIWSIC*Y*MLLLIPLFWYPCRXDIDRRFRLCTRSAWLGPQSARSHYSRPR 337 R ++C L P+ R DI+ R +R PQ SHY R R Sbjct: 89 RYGALCKEEALWNFPMISVFSRQDIETIIRRNSRYPLRPPQEVISHYRRTR 139 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.8 bits (44), Expect = 8.9 Identities = 7/25 (28%), Positives = 16/25 (64%) Frame = +3 Query: 462 SSINIWTIFYKDVLYFSTYPSHILY 536 S++ +W+ +D ++FS Y + + Y Sbjct: 403 SALQMWSTSLRDPVFFSIYKTILDY 427 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.8 bits (44), Expect = 8.9 Identities = 7/25 (28%), Positives = 16/25 (64%) Frame = +3 Query: 462 SSINIWTIFYKDVLYFSTYPSHILY 536 S++ +W+ +D ++FS Y + + Y Sbjct: 403 SALQMWSTSLRDPVFFSIYKTILDY 427 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.8 bits (44), Expect = 8.9 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = +3 Query: 306 YNLDTKKFTTIEGVNNGFAQTVDPTTQTVYIGGSDG 413 +N+ T + G + Q +DP TVYI G Sbjct: 176 HNIAVNASTGMGGPVSLVVQAMDPMNTTVYIADDRG 211 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 21.8 bits (44), Expect = 8.9 Identities = 7/25 (28%), Positives = 16/25 (64%) Frame = +3 Query: 462 SSINIWTIFYKDVLYFSTYPSHILY 536 S++ +W+ +D ++FS Y + + Y Sbjct: 29 SALQMWSTSLRDPVFFSIYKTILDY 53 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 218,153 Number of Sequences: 438 Number of extensions: 4334 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29630055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -