BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_P11 (870 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 27 0.74 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 26 1.7 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 25 3.0 AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 23 9.2 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 23 9.2 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 27.1 bits (57), Expect = 0.74 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = +2 Query: 350 GXLGPAGDSTNYGGRLDWANKNAEAAIDINRQIGGRSGMTATGSGV 487 G G +G S++ GG + + A AA+ GG +GM +TG+GV Sbjct: 677 GGGGGSGRSSSGGGMIGMHSVAAGAAVAAG---GGVAGMMSTGAGV 719 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 25.8 bits (54), Expect = 1.7 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 6/53 (11%) Frame = +2 Query: 203 TSPGTNK---WGEGRSSARWAKMMMGFLVKPVTTERSS---MMTAAN*PGRPT 343 TSP K W +G +WA+ + LVK + + + + A + PG+P+ Sbjct: 24 TSPAVKKLLGWKQGDEEEKWAEKAVDSLVKKLKKRKGAIEELERALSCPGQPS 76 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 25.0 bits (52), Expect = 3.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 329 PGRPTAPGXLGPAGDSTNYGGR 394 PGRP PG G G GGR Sbjct: 558 PGRPGLPGAKGERGLKGELGGR 579 Score = 23.4 bits (48), Expect = 9.2 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 332 GRPTAPGXLGPAG 370 GRP APG GP G Sbjct: 408 GRPGAPGPKGPRG 420 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 23.4 bits (48), Expect = 9.2 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +2 Query: 374 STNYGGRLDWANKNAEAAIDINR 442 +T GGRL + + E ++D++R Sbjct: 80 TTAVGGRLSYLTRTDEPSVDVSR 102 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 23.4 bits (48), Expect = 9.2 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 329 PGRPTAPGXLGPAGD 373 PGR APG GP G+ Sbjct: 775 PGRDGAPGLPGPKGE 789 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 798,690 Number of Sequences: 2352 Number of extensions: 16957 Number of successful extensions: 42 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 93026475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -