BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_P11 (870 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF039047-11|AAB94230.1| 354|Caenorhabditis elegans Prion-like-(... 29 4.3 U97196-1|AAK68667.2| 3279|Caenorhabditis elegans Hypothetical pr... 28 7.5 AL032634-3|CAE45092.1| 412|Caenorhabditis elegans Hypothetical ... 28 7.5 Z77132-3|CAB00860.1| 310|Caenorhabditis elegans Hypothetical pr... 28 10.0 Z77132-2|CAB00858.1| 294|Caenorhabditis elegans Hypothetical pr... 28 10.0 >AF039047-11|AAB94230.1| 354|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 51 protein. Length = 354 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +2 Query: 470 ATGSGVWDLDKNTRLSAGGMVSKEFGHRRPDVGVQAEFRHDW*SRRSHQDIIDLNNNLLP 649 A G+G+ +L K+ + + F DV V ++ R +W + + +DL +N P Sbjct: 2 AHGNGIAELYKSVMADVIANMKEAFLDENIDVDVLSQLRKEWEDKVNSSGCVDLESNAPP 61 >U97196-1|AAK68667.2| 3279|Caenorhabditis elegans Hypothetical protein B0207.5 protein. Length = 3279 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +2 Query: 191 DTRVTSPGTNKWGEGRSSARWAKMMMGFLVKP 286 +TR + GTNK +GR+ R M +G ++KP Sbjct: 3195 ETRTRNKGTNKRRDGRNDGR--NMNLGSIIKP 3224 >AL032634-3|CAE45092.1| 412|Caenorhabditis elegans Hypothetical protein Y39G8C.4 protein. Length = 412 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 323 N*PGRPTAPGXLGPAGDSTNYG 388 N PG P PG +GP GDS G Sbjct: 213 NFPGPPGPPGPVGPPGDSGERG 234 >Z77132-3|CAB00860.1| 310|Caenorhabditis elegans Hypothetical protein F54D1.3 protein. Length = 310 Score = 27.9 bits (59), Expect = 10.0 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 329 PGRPTAPGXLGPAGDSTNYG 388 PG P APG GPAG S G Sbjct: 233 PGAPGAPGNAGPAGPSGQDG 252 >Z77132-2|CAB00858.1| 294|Caenorhabditis elegans Hypothetical protein F54D1.2 protein. Length = 294 Score = 27.9 bits (59), Expect = 10.0 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 329 PGRPTAPGXLGPAGDSTNYG 388 PG P APG GPAG S G Sbjct: 217 PGAPGAPGNAGPAGPSGQDG 236 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,515,734 Number of Sequences: 27780 Number of extensions: 389505 Number of successful extensions: 1951 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1915 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2181923744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -