BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_P09 (911 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Triboliu... 26 0.47 U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II p... 26 0.47 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 2.5 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 2.5 U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I pr... 23 3.3 AJ850287-1|CAH64507.1| 509|Tribolium castaneum putative esteras... 22 5.8 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 22 7.6 >X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Tribolium castaneum mRNAfor alhpa amylase 3'region. ). Length = 489 Score = 25.8 bits (54), Expect = 0.47 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = +1 Query: 322 ARPYGEGAVQF---YERAEVTPPEDDPKQLFVAMTSDRGLCG 438 A PYG + ++ + PP+DD L +D G CG Sbjct: 332 AHPYGTTRLMSSFAFDNNDQGPPQDDAGNLISPSINDDGTCG 373 >U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II protein. Length = 490 Score = 25.8 bits (54), Expect = 0.47 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = +1 Query: 322 ARPYGEGAVQF---YERAEVTPPEDDPKQLFVAMTSDRGLCG 438 A PYG + ++ + PP+DD L +D G CG Sbjct: 333 AHPYGTTRLMSSFAFDNNDQGPPQDDAGNLISPSINDDGTCG 374 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.4 bits (48), Expect = 2.5 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 373 TPPEDDPKQLFVAMTSDRGLCG 438 TPPEDD + L +++S L G Sbjct: 668 TPPEDDAESLNQSISSPGALSG 689 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.4 bits (48), Expect = 2.5 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 373 TPPEDDPKQLFVAMTSDRGLCG 438 TPPEDD + L +++S L G Sbjct: 560 TPPEDDAESLNQSISSPGALSG 581 >U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I protein. Length = 490 Score = 23.0 bits (47), Expect = 3.3 Identities = 12/42 (28%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = +1 Query: 322 ARPYGEGAVQF---YERAEVTPPEDDPKQLFVAMTSDRGLCG 438 A PYG + ++ + PP+D L +D G CG Sbjct: 333 AHPYGTTRLMSSFAFDNNDQGPPQDGAGNLISPSINDDGTCG 374 >AJ850287-1|CAH64507.1| 509|Tribolium castaneum putative esterase protein. Length = 509 Score = 22.2 bits (45), Expect = 5.8 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 423 QRFVRSCTHWCIQSDPQPSRRT 488 +RFV+ T++ DP P +T Sbjct: 461 KRFVKLWTNFAKNGDPNPKEKT 482 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 21.8 bits (44), Expect = 7.6 Identities = 12/46 (26%), Positives = 21/46 (45%) Frame = -3 Query: 573 TNDVLSVQSLQDTARFISHTDHLXVLSTRFAETVADHFGYTSXYSS 436 TN+VL +S ++ + L + + + HFG T Y+S Sbjct: 106 TNNVLVHRSQNSNDVCLAIPESLVIKLVDYHHQLLGHFGATKVYNS 151 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,154 Number of Sequences: 336 Number of extensions: 4064 Number of successful extensions: 16 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25444518 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -