BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_P08 (908 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase p... 28 0.45 AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. 28 0.45 >AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase protein. Length = 557 Score = 27.9 bits (59), Expect = 0.45 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -3 Query: 753 IGLLTHEFLLDVLSDLSIVEEVAVFSDFPVDEENPLGKLLLRVQGFGQG 607 IG +H FL S ++ + D+PV N G+ +L VQ + G Sbjct: 250 IGGHSHSFLFPNASSKPHNQQDTILGDYPVVVSNANGRKILIVQAYAYG 298 >AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. Length = 557 Score = 27.9 bits (59), Expect = 0.45 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -3 Query: 753 IGLLTHEFLLDVLSDLSIVEEVAVFSDFPVDEENPLGKLLLRVQGFGQG 607 IG +H FL S ++ + D+PV N G+ +L VQ + G Sbjct: 250 IGGHSHSFLFPNASSKPHNQQDTILGDYPVVVSNANGRKILIVQAYAYG 298 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 637,647 Number of Sequences: 2352 Number of extensions: 10248 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 98401338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -