BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_P03 (898 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 24 1.4 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 23 4.3 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 24.2 bits (50), Expect = 1.4 Identities = 8/23 (34%), Positives = 17/23 (73%) Frame = +2 Query: 434 DYIFMYMKP*LMFCYFLFIFILY 502 DY+ + ++ +FCYF+++F +Y Sbjct: 136 DYVSL-LQLVFVFCYFIYLFTVY 157 Score = 21.4 bits (43), Expect = 9.9 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 649 FKYLFTVYY 623 F YLFTVYY Sbjct: 150 FIYLFTVYY 158 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 22.6 bits (46), Expect = 4.3 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 430 NRLHIYVYETITNVLLLFIYFYIICWNSYKFY 525 +R+H++V LLF YF + YK+Y Sbjct: 132 SRIHLFVRYVFVTSYLLFDYF-VQRNQEYKYY 162 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,192 Number of Sequences: 336 Number of extensions: 3118 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24927353 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -