BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_P02 (907 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 30 1.8 At1g76010.1 68414.m08825 expressed protein 28 7.4 At1g72110.1 68414.m08335 expressed protein 28 7.4 At1g07310.1 68414.m00778 C2 domain-containing protein contains s... 28 9.8 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -2 Query: 906 PGIPDLGXXXPX-WXGXRXPXRRPGQXXGAGXGRXPNXXPPXPGG 775 P P G P W G R P RPG G G G P PGG Sbjct: 59 PRGPGFGPRGPGPWSGPRGP--RPGGGGGPGPGPWSGPRGPRPGG 101 >At1g76010.1 68414.m08825 expressed protein Length = 350 Score = 28.3 bits (60), Expect = 7.4 Identities = 26/63 (41%), Positives = 30/63 (47%), Gaps = 4/63 (6%) Frame = +3 Query: 177 DSGNGYE-PIDNRPYIVNPPKDYNPNGNG-YE-PIDNGAYYVDRPQG-RPYFKPTPFPGA 344 D G GY+ P ++R Y D P G G Y+ P G Y D PQG R Y P P Sbjct: 220 DGGYGYDAPHEHRGYDDRGGYDAPPQGRGGYDGPQGRGGY--DGPQGRRGYDGP---PQG 274 Query: 345 RGG 353 RGG Sbjct: 275 RGG 277 >At1g72110.1 68414.m08335 expressed protein Length = 479 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -2 Query: 426 NSYEILKYIVNTLFRY*-FSKIFFTSHREHQGK 331 N+ I++ I NTL + FS I T H EH+GK Sbjct: 41 NASTIVEGIKNTLINHPRFSSILVTGHGEHKGK 73 >At1g07310.1 68414.m00778 C2 domain-containing protein contains similarity to shock protein SRC2 [Glycine max] gi|2055230|dbj|BAA19769 ; contains Pfam profile PF00168:C2 domain Length = 352 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +3 Query: 228 PPKDYNPNGNGYEPIDNGAYYVDRPQGRPYFKPTPFP 338 PP + P +P+D Y PQG Y+ P+P P Sbjct: 141 PPPQHPPPRPQSQPLD----YYSAPQGNHYYSPSPPP 173 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,247,987 Number of Sequences: 28952 Number of extensions: 260319 Number of successful extensions: 517 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 516 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2139598560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -