BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_P01 (897 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z84574-5|CAB06541.1| 846|Caenorhabditis elegans Hypothetical pr... 33 0.37 Z81062-8|CAD59145.1| 808|Caenorhabditis elegans Hypothetical pr... 32 0.64 Z54342-6|CAA91148.1| 459|Caenorhabditis elegans Hypothetical pr... 29 3.4 >Z84574-5|CAB06541.1| 846|Caenorhabditis elegans Hypothetical protein F33E2.6 protein. Length = 846 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = +2 Query: 503 PKTKPARKSPGSLPPCWKTTE--FTSRSCPPRTNST 604 PKT+P P ++P CW+ F PPR N+T Sbjct: 418 PKTEPPTTEPPNIPYCWQQQSRLFAPSPPPPRVNNT 453 >Z81062-8|CAD59145.1| 808|Caenorhabditis elegans Hypothetical protein F15A4.8b protein. Length = 808 Score = 31.9 bits (69), Expect = 0.64 Identities = 18/59 (30%), Positives = 27/59 (45%) Frame = +2 Query: 494 SVTPKTKPARKSPGSLPPCWKTTEFTSRSCPPRTNST*SSITRKVLXMTVSSTVIAPXT 670 +VT T ++P TT S + PP ++T + +T+ V ST IAP T Sbjct: 407 NVTSTTTAPTTESSAIPDVTSTTTTKSSTTPPVESTTTAPVTKSSSTPPVKSTTIAPVT 465 >Z54342-6|CAA91148.1| 459|Caenorhabditis elegans Hypothetical protein C08H9.11 protein. Length = 459 Score = 29.5 bits (63), Expect = 3.4 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Frame = +1 Query: 289 VKRLIENGKXNTMDFAYQLWTKDGKEIVKSY--FPIQFRVIFTEQTVKLINKRDHHALKL 462 VK ++ K N +D WT+ E +KSY F + R FTE K N+++ + + L Sbjct: 202 VKSIVSFFKKNDIDGIEIFWTRPKYEDIKSYSSFIQELRSAFTE-LQKRWNRKNEYIISL 260 Query: 463 I 465 I Sbjct: 261 I 261 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,242,396 Number of Sequences: 27780 Number of extensions: 259484 Number of successful extensions: 799 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 753 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 799 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2276333906 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -