BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_O20 (962 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 56 3e-08 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 52 6e-07 At2g30560.1 68415.m03722 glycine-rich protein 51 1e-06 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 50 3e-06 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 48 1e-05 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 46 4e-05 At4g01985.1 68417.m00265 expressed protein 46 4e-05 At1g61080.1 68414.m06877 proline-rich family protein 46 4e-05 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 37 6e-05 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 45 9e-05 At1g27710.1 68414.m03387 glycine-rich protein 45 9e-05 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 45 9e-05 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 44 2e-04 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 43 3e-04 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 43 3e-04 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 43 3e-04 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 43 3e-04 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 43 3e-04 At5g46730.1 68418.m05757 glycine-rich protein 42 5e-04 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 42 5e-04 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 42 6e-04 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 42 6e-04 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 34 0.001 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 41 0.001 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 41 0.001 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 40 0.002 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 40 0.002 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 40 0.002 At1g75550.1 68414.m08780 glycine-rich protein 40 0.002 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 40 0.002 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 40 0.002 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 40 0.003 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 31 0.003 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 31 0.003 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 39 0.004 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 39 0.004 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 39 0.006 At5g38560.1 68418.m04662 protein kinase family protein contains ... 39 0.006 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 39 0.006 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 38 0.008 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 38 0.008 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 38 0.010 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 38 0.010 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 38 0.013 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 37 0.017 At2g05440.2 68415.m00575 glycine-rich protein 37 0.017 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 31 0.021 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 30 0.028 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 36 0.030 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 36 0.030 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 36 0.040 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 36 0.040 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 36 0.040 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 36 0.053 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 35 0.070 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 35 0.070 At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-conta... 35 0.070 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 35 0.070 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 35 0.070 At1g26150.1 68414.m03192 protein kinase family protein similar t... 35 0.070 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 35 0.070 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 35 0.093 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 35 0.093 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 35 0.093 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 35 0.093 At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1... 35 0.093 At2g28670.1 68415.m03485 disease resistance-responsive family pr... 35 0.093 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 35 0.093 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 35 0.093 At4g30460.1 68417.m04325 glycine-rich protein 34 0.12 At4g18570.1 68417.m02749 proline-rich family protein common fami... 34 0.12 At2g18470.1 68415.m02151 protein kinase family protein contains ... 34 0.12 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 34 0.12 At1g29380.1 68414.m03592 hypothetical protein 34 0.12 At1g15830.1 68414.m01900 expressed protein 34 0.12 At1g10620.1 68414.m01204 protein kinase family protein contains ... 34 0.12 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 28 0.14 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 34 0.16 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 34 0.16 At1g53625.1 68414.m06096 expressed protein 34 0.16 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 33 0.21 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 33 0.21 At5g04290.1 68418.m00422 KOW domain-containing transcription fac... 33 0.21 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 33 0.21 At2g05440.1 68415.m00574 glycine-rich protein 33 0.21 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 33 0.28 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 33 0.28 At1g62240.1 68414.m07021 expressed protein 33 0.28 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 33 0.28 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 33 0.37 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 33 0.37 At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; g... 33 0.37 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 33 0.37 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 33 0.37 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 33 0.37 At1g55540.1 68414.m06356 proline-rich family protein contains pr... 28 0.37 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 32 0.49 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 32 0.49 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 32 0.49 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 32 0.49 At2g05510.1 68415.m00583 glycine-rich protein 32 0.49 At1g70990.1 68414.m08190 proline-rich family protein 32 0.49 At1g04800.1 68414.m00476 glycine-rich protein 32 0.49 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 32 0.65 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 32 0.65 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 32 0.65 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 32 0.65 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 32 0.65 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 32 0.65 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 32 0.65 At1g49270.1 68414.m05524 protein kinase family protein contains ... 32 0.65 At4g29030.1 68417.m04151 glycine-rich protein glycine-rich prote... 29 0.77 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 31 0.86 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 31 0.86 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 31 0.86 At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / he... 31 0.86 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 31 0.86 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 31 0.86 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 31 1.1 At4g33660.1 68417.m04781 expressed protein 31 1.1 At4g16830.1 68417.m02540 nuclear RNA-binding protein (RGGA) iden... 31 1.1 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 31 1.1 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 31 1.1 At3g50180.1 68416.m05486 hypothetical protein 31 1.1 At3g49840.1 68416.m05449 proline-rich family protein contains pr... 31 1.1 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 31 1.1 At1g53620.1 68414.m06094 glycine-rich protein 31 1.1 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 31 1.1 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 31 1.1 At1g21310.1 68414.m02662 proline-rich extensin-like family prote... 31 1.1 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 31 1.1 At1g02710.1 68414.m00222 glycine-rich protein 31 1.1 At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly id... 31 1.5 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 31 1.5 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 31 1.5 At4g21720.1 68417.m03145 expressed protein 31 1.5 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 31 1.5 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 31 1.5 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 31 1.5 At3g04640.1 68416.m00497 glycine-rich protein predicted proteins... 31 1.5 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 31 1.5 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 31 1.5 At1g12810.1 68414.m01488 proline-rich family protein contains pr... 31 1.5 At1g04660.1 68414.m00463 glycine-rich protein 31 1.5 At3g54590.1 68416.m06040 proline-rich extensin-like family prote... 27 1.8 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 30 2.0 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 30 2.0 At5g35190.1 68418.m04170 proline-rich extensin-like family prote... 30 2.0 At3g24550.1 68416.m03083 protein kinase family protein contains ... 30 2.0 At1g11850.2 68414.m01364 expressed protein 30 2.0 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 30 2.0 At5g22560.1 68418.m02635 hypothetical protein contains Pfam prof... 30 2.6 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 30 2.6 At4g29240.1 68417.m04182 leucine-rich repeat family protein / ex... 30 2.6 At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containi... 30 2.6 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 30 2.6 At4g08410.1 68417.m01390 proline-rich extensin-like family prote... 30 2.6 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 30 2.6 At4g03120.1 68417.m00425 proline-rich family protein similar to ... 30 2.6 At3g54580.1 68416.m06039 proline-rich extensin-like family prote... 30 2.6 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 30 2.6 At3g13225.1 68416.m01660 WW domain-containing protein contains P... 30 2.6 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 30 2.6 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 30 2.6 At2g04190.1 68415.m00404 meprin and TRAF homology domain-contain... 30 2.6 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 30 2.6 At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin fa... 30 2.6 At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ... 29 3.5 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 29 3.5 At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; g... 29 3.5 At4g08400.1 68417.m01388 proline-rich extensin-like family prote... 29 3.5 At3g62680.1 68416.m07041 proline-rich family protein contains pr... 29 3.5 At3g46740.1 68416.m05074 chloroplast outer envelope protein, put... 29 3.5 At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein... 29 3.5 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 29 3.5 At2g05540.1 68415.m00586 glycine-rich protein 29 3.5 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 29 3.5 At1g15130.1 68414.m01807 hydroxyproline-rich glycoprotein family... 26 3.9 At3g21215.1 68416.m02681 RNA-binding protein, putative contains ... 26 4.2 At5g65630.1 68418.m08256 DNA-binding bromodomain-containing prot... 29 4.6 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 29 4.6 At5g04970.1 68418.m00526 pectinesterase, putative contains simil... 29 4.6 At3g18810.1 68416.m02389 protein kinase family protein contains ... 29 4.6 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 29 4.6 At1g76930.2 68414.m08956 proline-rich extensin-like family prote... 29 4.6 At1g76930.1 68414.m08955 proline-rich extensin-like family prote... 29 4.6 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 29 4.6 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 29 4.6 At1g30780.1 68414.m03763 F-box family protein 29 4.6 At1g15840.1 68414.m01901 expressed protein 29 4.6 At5g56140.1 68418.m07003 KH domain-containing protein 29 6.1 At4g23470.2 68417.m03383 hydroxyproline-rich glycoprotein family... 29 6.1 At4g23470.1 68417.m03382 hydroxyproline-rich glycoprotein family... 29 6.1 At4g23140.2 68417.m03338 receptor-like protein kinase 5 (RLK5) i... 29 6.1 At4g23140.1 68417.m03337 receptor-like protein kinase 5 (RLK5) i... 29 6.1 At4g19200.1 68417.m02833 proline-rich family protein contains pr... 29 6.1 At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar... 29 6.1 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 29 6.1 At2g21140.1 68415.m02508 hydroxyproline-rich glycoprotein family... 29 6.1 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 29 6.1 At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi do... 29 6.1 At1g32360.1 68414.m03989 zinc finger (CCCH-type) family protein ... 29 6.1 At1g23540.1 68414.m02960 protein kinase family protein contains ... 29 6.1 At5g61660.1 68418.m07736 glycine-rich protein 25 6.1 At5g66400.1 68418.m08374 dehydrin (RAB18) nearly identical to SP... 28 8.0 At5g49080.1 68418.m06074 proline-rich extensin-like family prote... 28 8.0 At5g13760.1 68418.m01604 expressed protein similar to unknown pr... 28 8.0 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 28 8.0 At5g06640.1 68418.m00750 proline-rich extensin-like family prote... 28 8.0 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 28 8.0 At4g16240.1 68417.m02464 hypothetical protein 28 8.0 At4g08230.1 68417.m01358 glycine-rich protein 28 8.0 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 28 8.0 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 28 8.0 At3g26400.1 68416.m03292 eukaryotic translation initiation facto... 28 8.0 At2g35920.1 68415.m04409 helicase domain-containing protein simi... 28 8.0 At2g24450.1 68415.m02922 fasciclin-like arabinogalactan family p... 28 8.0 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 28 8.0 At2g11005.1 68415.m01177 glycine-rich protein 28 8.0 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 28 8.0 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 28 8.0 At1g70250.1 68414.m08082 receptor serine/threonine kinase, putat... 28 8.0 At1g51580.1 68414.m05806 KH domain-containing protein 28 8.0 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 56.4 bits (130), Expect = 3e-08 Identities = 52/224 (23%), Positives = 59/224 (26%), Gaps = 17/224 (7%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPX 762 P PP PPPP + PPP P P +SP P PPPP P Sbjct: 429 PSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPP 488 Query: 761 GGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTP-----PPPXPXXXPXXP 597 P P PP TP PPP P P P Sbjct: 489 PPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPP 548 Query: 596 ---PPXPXPXX-----PPFXXXXXGAXXXXXXXXXXXXXFFXXXXXXXXXXXXXXXXXTX 441 PP P P PP + + Sbjct: 549 QFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYS 608 Query: 440 TPXXXPFFXPPXXPP---KKXPXPXPLTKXXFXPPP-LFXPXPP 321 P P PP PP P P P+ PPP ++ PP Sbjct: 609 PPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPP 652 Score = 52.0 bits (119), Expect = 6e-07 Identities = 33/113 (29%), Positives = 35/113 (30%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXXXXXX 726 PPPP P PP P P +SP P PPPP P Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPP----------PP 475 Query: 725 XXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P + P PPP PPPP P P PP P PP Sbjct: 476 PPPVYSPPPPSPPPPPPPVYSPPPPPP---PPPPPPVYSPPPPPVYSSPPPPP 525 Score = 47.2 bits (107), Expect = 2e-05 Identities = 35/133 (26%), Positives = 38/133 (28%), Gaps = 1/133 (0%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGX 783 P + P PP PPP P PPP P PP P P PPPP Sbjct: 545 PPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSP--PPPIYPYLSP---PPPPTPVS 599 Query: 782 XXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXF-XPXPPPX*KTPPPPXPXXXP 606 P P + P PPP + PPP P Sbjct: 600 SPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYS 659 Query: 605 XXPPPXPXPXXPP 567 PPP P P Sbjct: 660 SPPPPPPVHYSSP 672 Score = 41.5 bits (93), Expect = 8e-04 Identities = 34/128 (26%), Positives = 39/128 (30%), Gaps = 3/128 (2%) Frame = -1 Query: 941 PXPPXXKXXXKX-PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXP 765 P PP + PPPP + PPP PP SP P PPPP P Sbjct: 539 PPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSP--PPHSPP--PPHSPPPPIYPYLSPPPP 594 Query: 764 XGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*K--TPPPPXPXXXPXXPPP 591 + P + P PPP + PPP P PPP Sbjct: 595 PTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPP 654 Query: 590 XPXPXXPP 567 PP Sbjct: 655 PVYYSSPP 662 Score = 37.9 bits (84), Expect = 0.010 Identities = 33/140 (23%), Positives = 36/140 (25%), Gaps = 7/140 (5%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP---X 792 P + P PP PPPP PPP PP P PPPP Sbjct: 622 PPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPP--PPPVHYSSPPPPEVHY 679 Query: 791 XGXXXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXX 612 P P PP ++PPPP P Sbjct: 680 HSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPPMVHHSPPPPVIHQSPPPPSPEY 739 Query: 611 XPXXPP----PXPXPXXPPF 564 PP P PPF Sbjct: 740 EGPLPPVIGVSYASPPPPPF 759 Score = 37.5 bits (83), Expect = 0.013 Identities = 27/111 (24%), Positives = 34/111 (30%) Frame = -1 Query: 653 PPX*KTPPPPXPXXXPXXPPPXPXPXXPPFXXXXXGAXXXXXXXXXXXXXFFXXXXXXXX 474 PP +PPPP P PPP P P P + Sbjct: 420 PPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPP---PPPPPPPP 476 Query: 473 XXXXXXXXXTXTPXXXPFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 + P P + PP PP P P P+ PPP++ PP Sbjct: 477 PPVYSPPPPSPPPPPPPVYSPP--PPPPPPPPPPVYSP--PPPPVYSSPPP 523 Score = 33.9 bits (74), Expect = 0.16 Identities = 28/114 (24%), Positives = 32/114 (28%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPPFXXXXXGAXXXXXXXXXXXXXFFXXXXX 483 P PPP +PPPP P P P PP Sbjct: 401 PLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPP--PPPPP 458 Query: 482 XXXXXXXXXXXXTXTPXXXPFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 P P + PP PP P P P+ + PPP P PP Sbjct: 459 PPPPVYSPPPPPPPPPPPPPVYSPP--PPSPPPPPPPV----YSPPPPPPPPPP 506 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -2 Query: 412 PXXFPPKXPPXPPP*QKXXFXPPPFFXXXPP 320 P PP PP PPP PPP + PP Sbjct: 493 PVYSPPPPPPPPPPPPVYSPPPPPVYSSPPP 523 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 412 PXXFPPKXPPXPPP*QKXXFXPPPFFXXXPP 320 P PP PP PPP PPP PP Sbjct: 462 PVYSPPPPPPPPPPPPPVYSPPPPSPPPPPP 492 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -2 Query: 412 PXXFPPKXPPXPPP*QKXXFXPPPFFXXXPP 320 P + P PP PPP PPP PP Sbjct: 492 PPVYSPPPPPPPPPPPPVYSPPPPPVYSSPP 522 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 73 PXSSKXXVXSXPPPPPPP 126 P S V S PPPPPPP Sbjct: 428 PPSPPPPVYSPPPPPPPP 445 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 52.0 bits (119), Expect = 6e-07 Identities = 37/131 (28%), Positives = 40/131 (30%), Gaps = 6/131 (4%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXG---E 771 P PP K P PP P PP P PP++P PPPP + Sbjct: 49 PKPPTVKPPTHTPKPPTVKP----PPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVK 104 Query: 770 XPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPX---PPPX*KTPPPPXPXXXPXX 600 P P P PPP TPPPP P Sbjct: 105 PPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPC 164 Query: 599 PPPXPXPXXPP 567 PPP P P PP Sbjct: 165 PPPPPTPYPPP 175 Score = 41.9 bits (94), Expect = 6e-04 Identities = 36/135 (26%), Positives = 38/135 (28%), Gaps = 2/135 (1%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPX 762 P PP K P P P+ PP P P P P PPPP + P Sbjct: 61 PKPPTVKPPPPYIPCPPP-PYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYV----KPPP 115 Query: 761 GGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPX--PPPX*KTPPPPXPXXXPXXPPPX 588 P K P PPP TP P P P PP Sbjct: 116 PPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPP 175 Query: 587 PXPXXPPFXXXXXGA 543 P P P GA Sbjct: 176 PKPETCPIDALKLGA 190 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -1 Query: 437 PXXXPFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 P P+ PP PP P P P K PPP P PP Sbjct: 89 PPPPPYVKPPP-PPTVKPPPPPYVKP--PPPPTVKPPPP 124 Score = 30.3 bits (65), Expect = 2.0 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 9/65 (13%) Frame = -1 Query: 962 PGXXKXXPXP---PXXKXXXKXPPPPXXXP-----HXXPPPGXXPXXXPP-FSPXXXPXG 810 P K P P P K PPPP P PPP PP P P Sbjct: 92 PPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVV 151 Query: 809 XPPPP 795 PPPP Sbjct: 152 TPPPP 156 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -1 Query: 437 PXXXPFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 P P+ PP PP P P P T PP + P PP Sbjct: 105 PPPPPYVKPPP-PPTVKPPPPP-TPYTPPPPTPYTPPPP 141 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 50.8 bits (116), Expect = 1e-06 Identities = 37/127 (29%), Positives = 40/127 (31%), Gaps = 2/127 (1%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKX 747 GG G GGG G G GGGG GG G + G Sbjct: 10 GGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNRSSYISRDNF 69 Query: 748 GAXPPXGXSPXXXPXXGGGGXPXGXXXGE--XGGXXXGXXPGGGXXWGXXXGGGGXLXXX 921 + P G GGGG G G+ GG G GGG G GGGG Sbjct: 70 ESDPKGGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGK 129 Query: 922 LXXGGXG 942 G G Sbjct: 130 SGGGSGG 136 Score = 44.0 bits (99), Expect = 2e-04 Identities = 36/124 (29%), Positives = 38/124 (30%), Gaps = 9/124 (7%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKX 747 GG G GGG G G GGGG GGG G APG Sbjct: 19 GGSGGGRGGGGGGGAKGGCGGGG--KSGGGGGGGGYMVAPGSNRSSYISRDNFESDPKGG 76 Query: 748 GAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXX---------GG 900 G GG G G G+ GG G GGG G GG Sbjct: 77 SGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGG 136 Query: 901 GGXL 912 GG + Sbjct: 137 GGYM 140 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVF-XXGGGXGXNXXFXAPG 690 GG G G GGG G G GGGG GGG G APG Sbjct: 103 GGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGGGGYMVAPG 144 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG 906 GG G G G GG G GGG GGGG Sbjct: 5 GGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGG 41 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 49.6 bits (113), Expect = 3e-06 Identities = 35/126 (27%), Positives = 35/126 (27%), Gaps = 1/126 (0%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPX 762 P PP PPPP P PP P P P PPP P Sbjct: 32 PPPPCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPP-VATTPPALPP 90 Query: 761 GGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPP-PXP 585 P A P PP TPPPP P PP P P Sbjct: 91 KPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAI--TPPPPLATTPPALPPKPLP 148 Query: 584 XPXXPP 567 P PP Sbjct: 149 PPLSPP 154 Score = 35.1 bits (77), Expect = 0.070 Identities = 30/123 (24%), Positives = 31/123 (25%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGX 783 P + P P PP P PPP P PP P P PPPP Sbjct: 64 PANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITP---PPPPAITP 120 Query: 782 XXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPX 603 P P P P TPPPP P Sbjct: 121 PLSPPPPA------------ITPPPPLATTPPALPPKPLPPPLSPPQTTPPPPPAITPPL 168 Query: 602 XPP 594 PP Sbjct: 169 SPP 171 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -1 Query: 413 PPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 PP PPK P P + PPP P PP Sbjct: 85 PPALPPKPLPPPLSPPQTTPPPPPAITPPPP 115 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = -1 Query: 437 PXXXPFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 P P PP P P P +T PPP P PP Sbjct: 96 PLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPP 134 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPP 837 PG PP K PPP P PPP P PP Sbjct: 254 PGPSPTISPPPLPPQTLKPPPPQTTPP---PPPAITPPLSPP 292 Score = 29.1 bits (62), Expect = 4.6 Identities = 30/119 (25%), Positives = 32/119 (26%), Gaps = 3/119 (2%) Frame = -1 Query: 668 FXPXPPPX*KTPPPPXPXXXPXX---PPPXPXPXXPPFXXXXXGAXXXXXXXXXXXXXFF 498 F P PP + PPPP P PP P PP Sbjct: 59 FQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPP--------PLSPPQTTPPPPPAI 110 Query: 497 XXXXXXXXXXXXXXXXXTXTPXXXPFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 TP PP PPK P P PL+ PPP PP Sbjct: 111 TPPPPPAITPPLSPPPPAITPPPPLATTPPALPPK--PLPPPLSPPQTTPPPPPAITPP 167 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -1 Query: 689 PGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PG P PP +T PP P P PP P PP Sbjct: 254 PGPSPTISPPPLPP--QTLKPPPPQTTPPPPPAITPPLSPP 292 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 47.6 bits (108), Expect = 1e-05 Identities = 34/118 (28%), Positives = 36/118 (30%), Gaps = 3/118 (2%) Frame = -1 Query: 911 KXPPPPXXXPHXX---PPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXX 741 + PPPP H PPP P PP P P PP E P Sbjct: 431 RSPPPPQQPHHHVVHSPPPASSPPTSPPVHSTPSPVHKPQPPK------ESPQPNDPYDQ 484 Query: 740 XXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P P PPP +PPPP P P PPP P PP Sbjct: 485 SPVKFRRSPPPPPVHSPP-PPSPIHSPPPPPV-YSPPPPPPVYSPPPPPPVYSPPPPP 540 Score = 46.0 bits (104), Expect = 4e-05 Identities = 31/123 (25%), Positives = 33/123 (26%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PP PPPP P PP P P +SP P PPP P Sbjct: 501 PPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPV-----HSPPPP 555 Query: 755 XAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPX 576 + P PPP PPP P PP P Sbjct: 556 VHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYS 615 Query: 575 XPP 567 PP Sbjct: 616 PPP 618 Score = 39.5 bits (88), Expect = 0.003 Identities = 33/122 (27%), Positives = 36/122 (29%), Gaps = 7/122 (5%) Frame = -1 Query: 911 KXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXP--XGXPPPPXXGXXXGEXPXGGXAXXXX 738 + PPPP P P P P +SP P PPPP P Sbjct: 491 RSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVH 550 Query: 737 XXXXXXXXXXXXXXXXPGAXKXXFXP--XPPPX*KTPPPPXPXXXPXXP---PPXPXPXX 573 P P PPP +PPPP P P P PP P Sbjct: 551 SPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPP-PVHSPPPPVHSPPPPVHSP 609 Query: 572 PP 567 PP Sbjct: 610 PP 611 Score = 38.3 bits (85), Expect = 0.008 Identities = 38/141 (26%), Positives = 38/141 (26%), Gaps = 9/141 (6%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKX--PPPPXXXP----HXXPPPGXXPXXXPPFSPXXXPXGXPP 801 P P PP PPPP P H PPP P P SP PP Sbjct: 531 PPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP-PVHSPPPPVYSPPP 589 Query: 800 PPXXGXXXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPP-- 627 PP P F P PPP PPP Sbjct: 590 PP----VHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSP-PPPVHSPPPPVY 644 Query: 626 -PXPXXXPXXPPPXPXPXXPP 567 P P PPP P PP Sbjct: 645 SPPPPVYSPPPPPVKSPPPPP 665 Score = 37.5 bits (83), Expect = 0.013 Identities = 32/121 (26%), Positives = 34/121 (28%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPX 762 P PP PP H PPP P PP P PPPP P Sbjct: 573 PPPPVHSPPPPVYSPPPPPVHSPPPPVHSP--PPPVHSPPPPVYSPPPP--------PPV 622 Query: 761 GGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPX 582 P + P PPP K+PPPP P PP Sbjct: 623 HSPPPPVFSPPPPVHSPPPPVYSPP---PPVYSPPPPPV-KSPPPPPVYSPPLLPPKMSS 678 Query: 581 P 579 P Sbjct: 679 P 679 Score = 37.5 bits (83), Expect = 0.013 Identities = 30/118 (25%), Positives = 31/118 (26%), Gaps = 4/118 (3%) Frame = -1 Query: 905 PPPPXXXP----HXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXX 738 PPPP P H PPP P PP P PPPP Sbjct: 595 PPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPP 654 Query: 737 XXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPPF 564 K P P +PPP P PPP PPF Sbjct: 655 PPPVKSPPPPPVYSPPLLPPKMSSPPTQTPV-NSPPPRTPSQTVEAPPPSEEFIIPPF 711 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = -1 Query: 440 TPXXXPFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 +P P + PP PP P P P PPP+ P PP Sbjct: 509 SPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPP 548 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/49 (30%), Positives = 17/49 (34%) Frame = -3 Query: 942 APSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 +P P P PP PP PP + PP PPPP Sbjct: 608 SPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPP 656 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = -3 Query: 942 APSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 +P P P PP PP PP PP PPPP Sbjct: 535 SPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 583 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -3 Query: 936 SPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 SP PP P PP PP PP PPPP Sbjct: 509 SPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPP 555 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = -3 Query: 939 PSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 P P P PP PP PP PP PPPP Sbjct: 529 PPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 576 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/42 (35%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = -1 Query: 437 PXXXPFFXPPXXPPKKXPXPX---PLTKXXFXPPPLFXPXPP 321 P P + PP PP P P P PPP+ P PP Sbjct: 528 PPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 569 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -3 Query: 936 SPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 SP P PP PP PP PP PPPP Sbjct: 544 SPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPP 590 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -3 Query: 885 PPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 PP PP PP PP PPPP Sbjct: 590 PPVHSPPPPVHSPPPPVHSPPPPVYSPPPP 619 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/65 (26%), Positives = 19/65 (29%) Frame = -3 Query: 942 APSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPP 763 +P P P PP PP PP + PP PPP PP Sbjct: 615 SPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPP 674 Query: 762 GGGXP 748 P Sbjct: 675 KMSSP 679 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = -1 Query: 437 PXXXPFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 P P PP P P P P+ PP P PP Sbjct: 502 PPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPP 540 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/47 (29%), Positives = 15/47 (31%) Frame = -3 Query: 936 SPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 SP P PP PP PP + PP PPP Sbjct: 551 SPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPP 597 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 2/38 (5%) Frame = -3 Query: 903 PPXXXXPP--XXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 PP PP PP PP PP PPPP Sbjct: 575 PPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPP 612 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/55 (25%), Positives = 16/55 (29%) Frame = -2 Query: 961 PGXXXXGPXPPXXXXXPXXPPXPXXXPTXXPPXAXFPRXXPXFXXXPXRXGXPPP 797 P P PP P P P PP + P + P PPP Sbjct: 609 PPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPP 663 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = -1 Query: 440 TPXXXPFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 +P P PP P P P P+ PP P PP Sbjct: 492 SPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPP 531 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/49 (30%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Frame = -3 Query: 936 SPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXX--XPPXXGPPPP 796 SP PP P PP PP + PP PPPP Sbjct: 500 SPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPP 548 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = -3 Query: 939 PSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 P P PP PP P PP PP PPP Sbjct: 528 PPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 575 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/55 (27%), Positives = 15/55 (27%) Frame = -2 Query: 961 PGXXXXGPXPPXXXXXPXXPPXPXXXPTXXPPXAXFPRXXPXFXXXPXRXGXPPP 797 P P PP P P P PP F P P PPP Sbjct: 595 PPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPP 649 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 2/50 (4%) Frame = -1 Query: 941 PXPPXXKXXXKXP--PPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPP 798 P PP K P PP P PP P PP PPP Sbjct: 653 PPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTPVNSPPPRTPSQTVEAPPP 702 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP PPPP PH PPP P PP SP P PP P Sbjct: 23 PVPPPPSHI-SPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSP 70 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP PPP PH PP PP SP P PPPP Sbjct: 33 PPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPP 81 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP + PP P PH PPP P P P P PPPP Sbjct: 44 PPPPHFSPPHQPPPSPYPHPH-PPPPSPYPH---PHQPPPPPHVLPPPP 88 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P P P PPPP P P PPP P PP Sbjct: 59 PYPHPH---PPPPSPYPHPHQPPPPPHVLPPP 87 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPP--XPXPXXPP 567 P PPP PPP P P PPP P PP Sbjct: 23 PVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPP 56 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = -1 Query: 662 PXPP---PX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PP P + PP P P P P P P P PP Sbjct: 44 PPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPP 78 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPP 798 PP + P PP PPP P PP P P PPP Sbjct: 13 PPSHQHPLPSPVPPPPSHISPPPPPFSPPHHPP-PPHFSPPHQPPP 57 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/55 (29%), Positives = 18/55 (32%) Frame = -2 Query: 961 PGXXXXGPXPPXXXXXPXXPPXPXXXPTXXPPXAXFPRXXPXFXXXPXRXGXPPP 797 P P PP P PP P P PP + +P P PPP Sbjct: 26 PPPSHISP-PPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPP 79 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = -3 Query: 942 APSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 +P P PP PP PP PP P PPPP Sbjct: 32 SPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPP 80 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = -1 Query: 656 PPPX*KTP--PPPXPXXXPXXPPPXPXPXXPP 567 PPP P PPP P PPP P P P Sbjct: 34 PPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHP 65 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXP 816 P P PP P PH PPP P PP P P Sbjct: 55 PPPSPYPHPHPPPPSPYPHPHQPPPP---PHVLPPPPPTPAP 93 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 4/32 (12%) Frame = -1 Query: 662 PXPPPX*KTP----PPPXPXXXPXXPPPXPXP 579 P PPP P PPP P P PPP P P Sbjct: 63 PHPPPPSPYPHPHQPPPPPHVLP-PPPPTPAP 93 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 46.0 bits (104), Expect = 4e-05 Identities = 37/124 (29%), Positives = 39/124 (31%), Gaps = 2/124 (1%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKXG 750 G G G GGG G G G GG GGG G A G G Sbjct: 62 GVGGGGGGGGGIGGSGGVGAGG--GVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGG 119 Query: 751 AXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGG--GGXLXXXL 924 G G GG G G GG G GGG G GG GG + + Sbjct: 120 VGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGV 179 Query: 925 XXGG 936 GG Sbjct: 180 GAGG 183 Score = 44.4 bits (100), Expect = 1e-04 Identities = 34/113 (30%), Positives = 36/113 (31%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKX 747 GG G G GGG G G GG V GGG + G Sbjct: 347 GGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASG 406 Query: 748 GAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG 906 GA G + G GG G G GG G GG G GGGG Sbjct: 407 GASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAV--GGAVGGAVGGGGG 457 Score = 41.5 bits (93), Expect = 8e-04 Identities = 34/114 (29%), Positives = 34/114 (29%), Gaps = 1/114 (0%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKX 747 GG G G GG G G GGG GGG G G Sbjct: 462 GGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVG 521 Query: 748 GAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPG-GGXXWGXXXGGGG 906 G G GG G G G GG G G GG G GGGG Sbjct: 522 GGVGGAGRGSGGAS--GGAGAGGGAGGGVGGGANVGVGVGAGGSTGGGAAGGGG 573 Score = 40.7 bits (91), Expect = 0.001 Identities = 35/128 (27%), Positives = 36/128 (28%), Gaps = 3/128 (2%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXV-XK 744 GG G G GGG G G GGG GG G G Sbjct: 74 GGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGS 133 Query: 745 XGAXPPXGXSPXXXPXXGGGGXPXGXXXGEXG--GXXXGXXPGGGXXWGXXXGGGGXLXX 918 GA G G G G G G G G GGG G GG Sbjct: 134 VGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGG 193 Query: 919 XLXXGGXG 942 + GG G Sbjct: 194 GIGSGGGG 201 Score = 40.7 bits (91), Expect = 0.001 Identities = 33/115 (28%), Positives = 33/115 (28%), Gaps = 2/115 (1%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGG--XGXNXXFXAPGXXXXXXXXXXXXXXXVX 741 GG G G GGG G G GG V GGG G G Sbjct: 429 GGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGG 488 Query: 742 KXGAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG 906 G G G GG G G GG G G G G GGG Sbjct: 489 GGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGG 543 Score = 39.9 bits (89), Expect = 0.002 Identities = 35/125 (28%), Positives = 37/125 (29%) Frame = +1 Query: 580 GXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKXGAXP 759 G G GGG G GGGG GGG G + A G G Sbjct: 50 GAGAGGGASGGIGVGGGGG---GGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGK 106 Query: 760 PXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGGX 939 G GG G G G GG GGG G GG + GG Sbjct: 107 GRGRK-----GGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGK 161 Query: 940 GXXXK 954 G K Sbjct: 162 GRGGK 166 Score = 39.9 bits (89), Expect = 0.002 Identities = 34/125 (27%), Positives = 39/125 (31%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKX 747 GG G GG G G GGG GGG G + G Sbjct: 256 GGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGR 315 Query: 748 GAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLX 927 G+ G + GG G G G GG G GGG G GG + + Sbjct: 316 GSGGASGGASGG--ASGGAGGSVGAGGGVGGGVGGGV--GGGVGGGVGGAVGGAVGGAVG 371 Query: 928 XGGXG 942 GG G Sbjct: 372 GGGGG 376 Score = 39.9 bits (89), Expect = 0.002 Identities = 36/115 (31%), Positives = 37/115 (32%), Gaps = 2/115 (1%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKX 747 GG G G GGG G G GG V GG G + G Sbjct: 275 GGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGG----SVGGGGRGSGGASGGASGGASG 330 Query: 748 GAXPPXGXSPXXXPXXGG--GGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG 906 GA G GG GG G G GG G GGG G GGGG Sbjct: 331 GAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGG---GGSVGGGG 382 Score = 39.1 bits (87), Expect = 0.004 Identities = 34/121 (28%), Positives = 34/121 (28%) Frame = +1 Query: 580 GXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKXGAXP 759 G G GGG G G GGV G G G A G V G Sbjct: 137 GGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIG 196 Query: 760 PXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGGX 939 G G GG G G G G GG G GGG GG Sbjct: 197 SGGGGTV-----GAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGG 251 Query: 940 G 942 G Sbjct: 252 G 252 Score = 39.1 bits (87), Expect = 0.004 Identities = 36/118 (30%), Positives = 36/118 (30%), Gaps = 5/118 (4%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGG--GXGXNXXFXAPGXXXXXXXXXXXXXXXVX 741 G G G GGG G G GG GG G G A G V Sbjct: 190 GAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVG 249 Query: 742 KXG-AXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPG--GGXXWGXXXGGGG 906 G G S G GG G G GG G G GG G GGGG Sbjct: 250 GGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGG 307 Score = 37.5 bits (83), Expect = 0.013 Identities = 36/126 (28%), Positives = 38/126 (30%), Gaps = 1/126 (0%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGG-GGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXK 744 GG G G GGG G GG GG GGG G G V Sbjct: 164 GGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGG-GTVGAGGRGSGGASGGGGTVGA 222 Query: 745 XGAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXL 924 G G + GG G G G G G GG G G GG L + Sbjct: 223 GGRGS--GGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGA--GGNVGAGGGLGGGV 278 Query: 925 XXGGXG 942 G G Sbjct: 279 GGGVGG 284 Score = 37.1 bits (82), Expect = 0.017 Identities = 34/128 (26%), Positives = 35/128 (27%), Gaps = 5/128 (3%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGG--GGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVX 741 GG G G GG G G GG GG G G G A G V Sbjct: 145 GGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVG 204 Query: 742 KXG---AXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXL 912 G G G GG G G G G GGG G G Sbjct: 205 AGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGA 264 Query: 913 XXXLXXGG 936 + GG Sbjct: 265 GGNVGAGG 272 Score = 37.1 bits (82), Expect = 0.017 Identities = 33/123 (26%), Positives = 34/123 (27%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKX 747 GG G GG G G GG V GGG G G Sbjct: 313 GGRGSGGASGGASGGASGGAGGSV-GAGGGVGGGVGGGVGGGVGGGVGGAVGGAVG---- 367 Query: 748 GAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLX 927 GA G G GG G G GG G G G G GG + Sbjct: 368 GAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGG 427 Query: 928 XGG 936 GG Sbjct: 428 VGG 430 Score = 35.9 bits (79), Expect = 0.040 Identities = 36/126 (28%), Positives = 38/126 (30%), Gaps = 3/126 (2%) Frame = +1 Query: 568 GGXXGXGXG-GGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXK 744 GG G G G GG G G G GG GGG G + G Sbjct: 154 GGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSV---GAGGGIGSGGGGTVGAGGRGS 210 Query: 745 XGAXPPXGXSPXXXPXXGG--GGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXX 918 GA G GG GG G G GG G G G G GG + Sbjct: 211 GGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGA 270 Query: 919 XLXXGG 936 GG Sbjct: 271 GGGLGG 276 Score = 35.9 bits (79), Expect = 0.040 Identities = 32/125 (25%), Positives = 34/125 (27%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKX 747 GG G GG G G GG GGG G G Sbjct: 398 GGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVG-------- 449 Query: 748 GAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLX 927 GA G G GG G G G GGG G G GG + + Sbjct: 450 GAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVG 509 Query: 928 XGGXG 942 G G Sbjct: 510 GGVRG 514 Score = 35.5 bits (78), Expect = 0.053 Identities = 33/125 (26%), Positives = 35/125 (28%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKX 747 GG G GG G G GG GG G A G Sbjct: 386 GGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGG------- 438 Query: 748 GAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLX 927 G G + GGGG G G GG G G G GGGG + Sbjct: 439 GVGGAVGGAVGGAVGGGGGGSVGGGGRGS-GGAGGGTGGSVGAGGGVGVGGGGGIGGGAG 497 Query: 928 XGGXG 942 G G Sbjct: 498 GGVGG 502 Score = 35.5 bits (78), Expect = 0.053 Identities = 37/125 (29%), Positives = 39/125 (31%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKX 747 GG G G GG G G GGG GGG G A G Sbjct: 410 GGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVG-GAVGGAVGGGGGGSVGGGGRGSG 468 Query: 748 GAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLX 927 GA G S GGG G G GG G GGG G G G + + Sbjct: 469 GAGGGTGGS-----VGAGGGVGVGGGGGIGGGA--GGGVGGGVGGGVGGGVRGAVGGAVG 521 Query: 928 XGGXG 942 G G Sbjct: 522 GGVGG 526 Score = 35.5 bits (78), Expect = 0.053 Identities = 34/123 (27%), Positives = 34/123 (27%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKX 747 GG G GGG G G GG GGG G G Sbjct: 454 GGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVR 513 Query: 748 GAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLX 927 GA G GG G G GG G GGG G G GG Sbjct: 514 GAVGGAVGGGVGGAGRGSGGASGGAGAG--GGA--GGGVGGGANVGVGVGAGGSTGGGAA 569 Query: 928 XGG 936 GG Sbjct: 570 GGG 572 Score = 31.5 bits (68), Expect = 0.86 Identities = 31/125 (24%), Positives = 32/125 (25%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKX 747 GG G G GG G G GG GG G G Sbjct: 299 GGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGV--GG 356 Query: 748 GAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLX 927 G G + GGGG G G G G GG GG Sbjct: 357 GVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAS--GGASGGASGGASGGASGGASGGVGG 414 Query: 928 XGGXG 942 GG G Sbjct: 415 AGGAG 419 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 46.0 bits (104), Expect = 4e-05 Identities = 39/133 (29%), Positives = 39/133 (29%), Gaps = 12/133 (9%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXX------PPFSPXXXPXGX--PPPPXXG 786 P PP PPPP P PPP P PP P P PPPP Sbjct: 442 PTPPIADIAISMPPPPPPPP---PPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPP 498 Query: 785 XXXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KT----PPPPXP 618 P G A P P PPP T PPPP P Sbjct: 499 AFK---PLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPP 555 Query: 617 XXXPXXPPPXPXP 579 PPP P P Sbjct: 556 PGTQAAPPPPPPP 568 Score = 43.2 bits (97), Expect = 3e-04 Identities = 31/121 (25%), Positives = 31/121 (25%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPX 762 P PP K PPP P P PP P PPPP P Sbjct: 495 PTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPP 554 Query: 761 GGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPX 582 P PPP PPPP P PPP P Sbjct: 555 PPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPP----PPPPMPLANGATPPPPPP 610 Query: 581 P 579 P Sbjct: 611 P 611 Score = 41.9 bits (94), Expect = 6e-04 Identities = 32/125 (25%), Positives = 32/125 (25%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPX 762 P PP PPP P P G P PP P PPPP P Sbjct: 479 PLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPP-PPLPTTIAAPPPPPP------PPR 531 Query: 761 GGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPX 582 A PG P PPP P P P P Sbjct: 532 AAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPP 591 Query: 581 PXXPP 567 P PP Sbjct: 592 PPPPP 596 Score = 36.3 bits (80), Expect = 0.030 Identities = 30/115 (26%), Positives = 31/115 (26%), Gaps = 6/115 (5%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSP------XXXPXGXPPPPXXGXXXGEXPXGGXAXX 744 PPPP P P PP +P P PPPP Sbjct: 419 PPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPP 478 Query: 743 XXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXP 579 P A K PPP PPPP P PPP P P Sbjct: 479 PLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPP---PPPPPLPTTIAAPPPPPPPP 530 Score = 32.3 bits (70), Expect = 0.49 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PG P PP PPPP P P PP G PPPP Sbjct: 543 PGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPS-----PPPMPMGNSGSGGPPPP 593 Score = 31.5 bits (68), Expect = 0.86 Identities = 18/63 (28%), Positives = 19/63 (30%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGX 783 PG P PP + P PP P G P PP PPPP Sbjct: 556 PGTQAAPPPPPPPPMQNRAPSPPPM-PMGNSGSGGPPPPPPPMPLANGATPPPPPPPMAM 614 Query: 782 XXG 774 G Sbjct: 615 ANG 617 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 PPP PPPP PP P P P Sbjct: 454 PPPPPPPPPPPAVMPLKHFAPPPPPPLPP 482 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 36.7 bits (81), Expect = 0.023 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP PP P P PP P PP SP P PPPP Sbjct: 403 PSPPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSP---PVYSPPPP 448 Score = 36.7 bits (81), Expect(2) = 6e-05 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXP 765 PPPP P PP P P FSP P PPP P Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPP 457 Score = 32.3 bits (70), Expect = 0.49 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP PP P PPP P PP P PPPP Sbjct: 413 PPPPSPPLPPPVYSPPPSPPVFSPPPSP-PVYSPPPPPSIHYSSPPPPP 460 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PPP +PPP P P PP P PP Sbjct: 419 PLPPPV-YSPPPSPPVFSPPPSPPVYSPPPPP 449 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 437 PXXXPFFXPPXXPPKKXPXPXPLTKXXFXPPP 342 P P F PP PP P P P PPP Sbjct: 428 PPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPP 459 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = -1 Query: 668 FXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 F P P P +PPPP PPP PP Sbjct: 434 FSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPP 467 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXP 765 PP PPPP PPP PP SP P PP G P Sbjct: 436 PPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSPEFE---GPLPPVIGVSYASPP 489 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 1/57 (1%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSP-XXXPXGXPPPP 795 P P PP PPPP H PP P P P PPPP Sbjct: 438 PSPPVYSPPPPPSIHYSSPPPPPV---HHSSPPPPSPEFEGPLPPVIGVSYASPPPP 491 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/39 (33%), Positives = 15/39 (38%) Frame = -1 Query: 437 PXXXPFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 P P + PP PP P P P PP + PP Sbjct: 419 PLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPP 457 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = -3 Query: 903 PPXXXXPPXXXPPXXXSXGGPPXF--XXXPPXXGPPPPXXRXXXXGXPP 763 PP PP PP PP F PP PPPP PP Sbjct: 412 PPPPPSPP-LPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPP 459 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -1 Query: 413 PPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 PP PP P P P PP++ P PP Sbjct: 418 PPLPPPVYSPPPSPPVFSPPPSPPVYSPPPP 448 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = -1 Query: 668 FXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 + P P P +PPP P P PP PP Sbjct: 425 YSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPP 458 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = -1 Query: 686 GAXKXXFXPXPPPX*KTPPPPXPXXXP---XXPPPXPXPXXPP 567 G + P PP PPPP P PPP P PP Sbjct: 395 GCGRSVVKPSPPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPP 437 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PPP +PP P P P PP P P Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPPSP 440 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PPP P PP P PP P PP Sbjct: 412 PPPPPSPPLPPPVYSPPPSPPVFSPPPSPP 441 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXP 585 P PP + PPP P PPP P Sbjct: 446 PPPPSIHYSSPPPPPVHHSSPPPPSP 471 Score = 27.9 bits (59), Expect(2) = 6e-05 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPP----PXPXPXXPPF 564 P PP +PPPP P PP P PPF Sbjct: 457 PPPPVHHSSPPPPSPEFEGPLPPVIGVSYASPPPPPF 493 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 44.8 bits (101), Expect = 9e-05 Identities = 30/112 (26%), Positives = 30/112 (26%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXXXXXX 726 PPPP P PPP P SP P P P G P G Sbjct: 164 PPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGP 223 Query: 725 XXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 P P P PP P P P P P P P P Sbjct: 224 DSPLPLPGPPPSSSPTPGPDSPLPSPG--PPPSPSPTPGPDSPLPSPGPDSP 273 Score = 33.1 bits (72), Expect = 0.28 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 635 PPPPXPXXXPXXPPPXPXPXXPP 567 PPPP P P PPP P P P Sbjct: 164 PPPPPPYPSPLPPPPSPSPTPGP 186 Score = 33.1 bits (72), Expect = 0.28 Identities = 31/127 (24%), Positives = 31/127 (24%), Gaps = 8/127 (6%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXP--------PPGXXPXXXPPFSPXXXPXGXPPPPXXGXX 780 PP PPPP P P P P PP SP P P P G Sbjct: 165 PPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPD 224 Query: 779 XGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXX 600 G P P P P P P P P Sbjct: 225 SPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPG---PDSPLPSPGPDP 281 Query: 599 PPPXPXP 579 P P P P Sbjct: 282 PLPSPGP 288 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PPP +P PP P P P P P P Sbjct: 164 PPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGP 195 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXG 786 PG P P P P P PPP P P SP P P P G Sbjct: 221 PGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPD-SPLPSPGPDSPLPSPG 278 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PP TP P P P P P P PP Sbjct: 175 PPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPP 206 Score = 28.7 bits (61), Expect = 6.1 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PG P P P P PPP P P SP P G PP P Sbjct: 202 PGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPD-SPLPSP-GPPPSP 255 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 44.8 bits (101), Expect = 9e-05 Identities = 36/112 (32%), Positives = 38/112 (33%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKX 747 GG G G G G G G GGGGV GGG G + + G Sbjct: 105 GGYGGGGPGYGGGGYGPGGGGGGVVI-GGGFGGGAGYGSGGGLGWDGG----------NG 153 Query: 748 GAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGG 903 G P G GGGG G G GG G GGG G GG Sbjct: 154 GGGP--GYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHGG 203 Score = 33.5 bits (73), Expect = 0.21 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGGXG 942 GGGG G GG G GGG G G GG L GG G Sbjct: 108 GGGGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGG 156 Score = 32.3 bits (70), Expect = 0.49 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGGXG 942 GG G G G GG G PG G G GGGG + GG G Sbjct: 136 GGAGYGSGGGLGWDGG-NGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGG 183 Score = 31.1 bits (67), Expect = 1.1 Identities = 38/124 (30%), Positives = 38/124 (30%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKXG 750 G G GG G G GGGG GGG G G G Sbjct: 97 GFKGELTAGGYGGGGPGYGGGGYGPGGGGGGVVIGGGFGG-------------------G 137 Query: 751 AXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXX 930 A G GGGG G G GG G GGG G GGGG Sbjct: 138 AGYGSGGGLGWDGGNGGGGPGYGSGGGGIGG---GGGIGGGVIIG---GGGGGCGGSCSG 191 Query: 931 GGXG 942 GG G Sbjct: 192 GGGG 195 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 44.8 bits (101), Expect = 9e-05 Identities = 47/214 (21%), Positives = 56/214 (26%), Gaps = 9/214 (4%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PP PPPP + PPP PP P PPPP P Sbjct: 70 PPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPP--PPYVYKSPPPPPYVYSSPPPPPYVY 127 Query: 755 XAXXXXXXXXXXXXXXXXXXXXPGAXKXXF-XPXPPPX*KTPPPPXPXXXPXXPPP---X 588 + P + P PPP +PPPP P PPP Sbjct: 128 KSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVY 187 Query: 587 PXPXXPPFXXXXXGAXXXXXXXXXXXXXFF--XXXXXXXXXXXXXXXXXTXTPXXXPF-F 417 P PP+ + +P P+ + Sbjct: 188 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 247 Query: 416 XPPXXPP--KKXPXPXPLTKXXFXPPPLFXPXPP 321 P PP K P P P PPP PP Sbjct: 248 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 281 Score = 42.3 bits (95), Expect = 5e-04 Identities = 32/124 (25%), Positives = 35/124 (28%), Gaps = 1/124 (0%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PP PPPP + PPP PP P PPPP P Sbjct: 240 PPPPPYVYSSPPPPPY-VYKSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYSSPPPPPYVY 297 Query: 755 XAXXXXXXXXXXXXXXXXXXXXPGAXKXXF-XPXPPPX*KTPPPPXPXXXPXXPPPXPXP 579 + P + P PPP PPP P PPP P Sbjct: 298 SSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPAPYV 357 Query: 578 XXPP 567 PP Sbjct: 358 YKPP 361 Score = 40.3 bits (90), Expect = 0.002 Identities = 34/133 (25%), Positives = 37/133 (27%), Gaps = 1/133 (0%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGX 783 P K P PP PPPP + PPP PP P PPPP Sbjct: 154 PYVYKSPPPPPYVYS----PPPPPPYVYQSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYS 208 Query: 782 XXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXF-XPXPPPX*KTPPPPXPXXXP 606 P + P + P PPP PPP P Sbjct: 209 SPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYS 268 Query: 605 XXPPPXPXPXXPP 567 PPP PP Sbjct: 269 SPPPPPYVYKSPP 281 Score = 34.3 bits (75), Expect = 0.12 Identities = 33/136 (24%), Positives = 34/136 (25%), Gaps = 4/136 (2%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPP----FSPXXXPXGXPPPP 795 P K P PP PPPP PPP PP SP P PP Sbjct: 274 PYVYKSPPPPPYV--YSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPP 331 Query: 794 XXGXXXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPX 615 P P + P P P PPP Sbjct: 332 PPPYVYKSPPPPPYVDSYSPPPAPYVYKPPPYVYKPPPYVYNYSPPPAPYVYKPPP---Y 388 Query: 614 XXPXXPPPXPXPXXPP 567 PPP P PP Sbjct: 389 VYSYSPPPAPYVYKPP 404 Score = 31.9 bits (69), Expect = 0.65 Identities = 32/133 (24%), Positives = 34/133 (25%), Gaps = 10/133 (7%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPP----FSPXXXPXGXPPPPXXGXXXGEX 768 PP PPPP PPP PP SP P PP Sbjct: 291 PPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYS 350 Query: 767 PXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPP------PXPXXXP 606 P P A + P P +PPP P P Sbjct: 351 PPPAPYVYKPPPYVYKPPPYVYNYSPPPAP-YVYKPPPYVYSYSPPPAPYVYKPPPYVYS 409 Query: 605 XXPPPXPXPXXPP 567 PPP P PP Sbjct: 410 YSPPPAPYVYKPP 422 Score = 30.3 bits (65), Expect = 2.0 Identities = 29/125 (23%), Positives = 31/125 (24%), Gaps = 3/125 (2%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXX---PXGXPPPPXXGXXXGEXP 765 PP PPPP PPP PP +P P PPP P Sbjct: 320 PPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPAPYVYKPPPYVYKPPPYVYNY--SPP 377 Query: 764 XGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXP 585 P + P P P PPP P PP Sbjct: 378 PAPYVYKPPPYVYSYSPPPAPYVYKPPPYVYSYSPPPAPY-VYKPPPYVYSSPSPPPYYS 436 Query: 584 XPXXP 570 P P Sbjct: 437 SPSPP 441 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PPP + PPP P PPP PP Sbjct: 62 PPPYIYSSPPPPPYVYSSPPPPPYVYNSPP 91 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 43.6 bits (98), Expect = 2e-04 Identities = 47/214 (21%), Positives = 56/214 (26%), Gaps = 9/214 (4%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PP K PPPP + PPP PP P PPPP P Sbjct: 120 PPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPP--PPYVYSSPPPPPYVYKSPPPPPYVY 177 Query: 755 XAXXXXXXXXXXXXXXXXXXXXPGAXKXXF-XPXPPPX*KTPPPPXPXXXPXXPPP---X 588 + P + P PPP + PPP P PPP Sbjct: 178 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 237 Query: 587 PXPXXPPFXXXXXGAXXXXXXXXXXXXXFF--XXXXXXXXXXXXXXXXXTXTPXXXPF-F 417 P PP+ + +P P+ + Sbjct: 238 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 297 Query: 416 XPPXXPP--KKXPXPXPLTKXXFXPPPLFXPXPP 321 P PP K P P P PPP PP Sbjct: 298 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 331 Score = 42.7 bits (96), Expect = 3e-04 Identities = 47/214 (21%), Positives = 55/214 (25%), Gaps = 9/214 (4%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PP K PPPP PPP PP P PPPP P Sbjct: 60 PPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPP--PPYVYSSPPPPPYIYKSPPPPPYVY 117 Query: 755 XAXXXXXXXXXXXXXXXXXXXXPGAXKXXF-XPXPPPX*KTPPPPXPXXXPXXPPP---X 588 + P + P PPP + PPP P PPP Sbjct: 118 SSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 177 Query: 587 PXPXXPPFXXXXXGAXXXXXXXXXXXXXFF--XXXXXXXXXXXXXXXXXTXTPXXXPF-F 417 P PP+ + +P P+ + Sbjct: 178 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 237 Query: 416 XPPXXPP--KKXPXPXPLTKXXFXPPPLFXPXPP 321 P PP K P P P PPP PP Sbjct: 238 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 271 Score = 39.9 bits (89), Expect = 0.002 Identities = 31/124 (25%), Positives = 35/124 (28%), Gaps = 1/124 (0%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PP K PPPP + PPP PP P PP P P Sbjct: 320 PPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPP--PPYVYSSPPPSPYVYKSPPPPPYVY 377 Query: 755 XAXXXXXXXXXXXXXXXXXXXXPGAXKXXF-XPXPPPX*KTPPPPXPXXXPXXPPPXPXP 579 + P + P PPP + PPP P PPP Sbjct: 378 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 437 Query: 578 XXPP 567 PP Sbjct: 438 SSPP 441 Score = 39.5 bits (88), Expect = 0.003 Identities = 33/128 (25%), Positives = 37/128 (28%), Gaps = 4/128 (3%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PP PPPP + PPP PP SP PPPP P Sbjct: 330 PPPPPYVYNSPPPPPY-VYKSPPPPPYVYSSPPPSPYVY-KSPPPPPYVYSSPPPPPYVY 387 Query: 755 XAXXXXXXXXXXXXXXXXXXXXPGAXKXXF-XPXPPPX*KTPPPPXPXXXPXXPPP---X 588 + P + P PPP PPP P PPP Sbjct: 388 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY 447 Query: 587 PXPXXPPF 564 P PP+ Sbjct: 448 KSPSPPPY 455 Score = 39.1 bits (87), Expect = 0.004 Identities = 31/124 (25%), Positives = 33/124 (26%), Gaps = 1/124 (0%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PP PPPP PPP PP P PPPP P Sbjct: 50 PPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPP--PPYIYKSPPPPPYVYSSPPPPPYIY 107 Query: 755 XAXXXXXXXXXXXXXXXXXXXXPGAXKXXF-XPXPPPX*KTPPPPXPXXXPXXPPPXPXP 579 + P + P PPP PPP P PPP Sbjct: 108 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVY 167 Query: 578 XXPP 567 PP Sbjct: 168 KSPP 171 Score = 37.9 bits (84), Expect = 0.010 Identities = 31/124 (25%), Positives = 34/124 (27%), Gaps = 1/124 (0%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PP PPPP + PPP PP P PPPP P Sbjct: 290 PPPPPYVYSSPPPPPY-VYKSPPPPPYVYSSPP-PPPYVYKSPPPPPYVYNSPPPPPYVY 347 Query: 755 XAXXXXXXXXXXXXXXXXXXXXPGAXKXXF-XPXPPPX*KTPPPPXPXXXPXXPPPXPXP 579 + P + P PPP PPP P PPP Sbjct: 348 KSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY 407 Query: 578 XXPP 567 PP Sbjct: 408 KSPP 411 Score = 36.7 bits (81), Expect = 0.023 Identities = 43/203 (21%), Positives = 51/203 (25%), Gaps = 9/203 (4%) Frame = -1 Query: 902 PPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXXXXXXX 723 PPP + PPP PP P PPPP P + Sbjct: 50 PPPPPYVYSSPPPPPYIYKSPP-PPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYK 108 Query: 722 XXXXXXXXXXXPGAXKXXF-XPXPPPX*KTPPPPXPXXXPXXPPP---XPXPXXPPFXXX 555 P + P PPP PPP P PPP P PP+ Sbjct: 109 SPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYK 168 Query: 554 XXGAXXXXXXXXXXXXXFF--XXXXXXXXXXXXXXXXXTXTPXXXPF-FXPPXXPP--KK 390 + +P P+ + P PP K Sbjct: 169 SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYK 228 Query: 389 XPXPXPLTKXXFXPPPLFXPXPP 321 P P P PPP PP Sbjct: 229 SPPPPPYVYSSPPPPPYVYKSPP 251 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P K P PP PPPP PPP PP S PPPP Sbjct: 424 PYVYKSPPPPPYV--YSSPPPPPYVYKSPSPPPYVYKSPPPPPS-YSYSYSSPPPP 476 Score = 29.9 bits (64), Expect = 2.6 Identities = 26/112 (23%), Positives = 30/112 (26%), Gaps = 2/112 (1%) Frame = -1 Query: 896 PXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXXXXXXXXX 717 P + PPP PP P PPPP P + Sbjct: 42 PPTHIYSSPPPPPYVYSSPP-PPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSP 100 Query: 716 XXXXXXXXXPGAXKXXFXPXPPP--X*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P + PPP K+PPPP PPP PP Sbjct: 101 PPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPP 152 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP PPP P PPP P PP SP P PPPP Sbjct: 1082 PSPPLPPSSLPPPPPAALFPPLPPPPSQPPP--PPLSPPPSPPPPPPPP 1128 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PPP PP P P P PP P P PP Sbjct: 1092 PPPPPAALFPPLPPPPSQPPPPPLSPPPSPPP 1123 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/29 (51%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -1 Query: 668 FXPXPPPX*KTPPPP-XPXXXPXXPPPXP 585 F P PPP + PPPP P P PPP P Sbjct: 1100 FPPLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 662 PXPP-PX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PP P PPPP P PPP P PP Sbjct: 1082 PSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPP 1114 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXX-PPPXPXPXXPP 567 P PP +PPPP P P PPP P PP Sbjct: 1070 PPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPP 1102 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PP P P PP P PP SP P PPPP Sbjct: 1062 PPLPQESPPPLPP---LPPSPPPPSPPLPPSSLPPPP 1095 Score = 32.3 bits (70), Expect = 0.49 Identities = 18/60 (30%), Positives = 20/60 (33%) Frame = -3 Query: 942 APSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPP 763 +P P PP PP PP + PP PP PPPP PP Sbjct: 1068 SPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPP---LPPPPSQPPPPPLSPPPSPPPP 1124 Score = 32.3 bits (70), Expect = 0.49 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = -1 Query: 935 PPXXKXXXKXPPP-PXXXPHXXPPPG----XXPXXXPPFSPXXXPXGXPPPP 795 PP PPP P P PPP P PP P P PP P Sbjct: 1070 PPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSP 1121 Score = 31.9 bits (69), Expect = 0.65 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 4/61 (6%) Frame = -3 Query: 933 PXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPP----XFXXXPPXXGPPPPXXRXXXXGXP 766 P Q PP PP PP S PP F PP PPP P Sbjct: 1063 PLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPP 1122 Query: 765 P 763 P Sbjct: 1123 P 1123 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = -1 Query: 668 FXPXP---PPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 F P P PP + PPP P P PPP P P P Sbjct: 1054 FNPLPEDSPPLPQESPPPLPPLPPSPPPPSP-PLPP 1088 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -1 Query: 413 PPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 PP PP P P PL+ PPP P PP Sbjct: 1101 PPLPPPPSQPPPPPLSPPPSPPPP---PPPP 1128 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = -1 Query: 410 PXXPPKKXPXPXPLTKXXFXPPP---LFXPXPP 321 P PP P PL PPP LF P PP Sbjct: 1073 PPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPP 1105 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -1 Query: 410 PXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 P PP P P P PPP P PP Sbjct: 1084 PPLPPSSLPPPPPAALFPPLPPPPSQPPPP 1113 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 43.2 bits (97), Expect = 3e-04 Identities = 31/115 (26%), Positives = 32/115 (27%), Gaps = 2/115 (1%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPP--FSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXXXX 732 PPPP PPP PP SP P PPP P Sbjct: 44 PPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPP--VLLSPPPP 101 Query: 731 XXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P P PPP +PPPP P PP P PP Sbjct: 102 PVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPP 156 Score = 41.9 bits (94), Expect = 6e-04 Identities = 31/123 (25%), Positives = 33/123 (26%), Gaps = 1/123 (0%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPP-FSPXXXPXGXPPPPXXGXXXGEXPXG 759 PP PPPP PP P P SP P PPP P Sbjct: 44 PPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPV 103 Query: 758 GXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXP 579 + P P PPP +PPPP P PP P Sbjct: 104 NLSPPPPPVNLSPPPPPVLLSPPP--PPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSP 161 Query: 578 XXP 570 P Sbjct: 162 PPP 164 Score = 39.9 bits (89), Expect = 0.002 Identities = 31/115 (26%), Positives = 33/115 (28%), Gaps = 2/115 (1%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPP--FSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXXXX 732 PPPP PPP PP SP P PPP P + Sbjct: 62 PPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPV 121 Query: 731 XXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P P PPP +PPPP P PP P PP Sbjct: 122 LLSPPPPPVLLSPPPPPVN--LSPPPPPVLLSPPPP-PVLFSPPPPTVTRPPPPP 173 Score = 39.5 bits (88), Expect = 0.003 Identities = 32/124 (25%), Positives = 33/124 (26%), Gaps = 1/124 (0%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPF-SPXXXPXGXPPPPXXGXXXGEXPXG 759 PP PPPP PP P P SP P PPP P Sbjct: 62 PPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPP- 120 Query: 758 GXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXP 579 P P PPP +PPPP P PPP Sbjct: 121 -VLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPP--PPPTITR 177 Query: 578 XXPP 567 PP Sbjct: 178 SPPP 181 Score = 39.5 bits (88), Expect = 0.003 Identities = 34/128 (26%), Positives = 35/128 (27%), Gaps = 2/128 (1%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPP--FSPXXXPXGXPPPPXX 789 P P PP PPPP PPP PP SP P PPP Sbjct: 64 PPPVNLSPPPPPVNLS---PPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPP 120 Query: 788 GXXXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXX 609 P P F P PP + PPPP Sbjct: 121 VLLSPPPPP--VLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRS 178 Query: 608 PXXPPPXP 585 P PPP P Sbjct: 179 P--PPPRP 184 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/112 (24%), Positives = 29/112 (25%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPPFXXXXXGAXXXXXXXXXXXXXFFXXXXXXX 477 PPP +PPPP P PP P PP Sbjct: 55 PPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVN--LSPPPPPV 112 Query: 476 XXXXXXXXXXTXTPXXXPFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 P PP P P P P+ PP LF P PP Sbjct: 113 NLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPP 164 Score = 35.1 bits (77), Expect = 0.070 Identities = 32/124 (25%), Positives = 33/124 (26%), Gaps = 5/124 (4%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPF-SPXXXPXGX-PPPPXXGXXXGEXPX 762 PP PPPP PP P P SP P PPPP P Sbjct: 89 PPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPV 148 Query: 761 GGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*---KTPPPPXPXXXPXXPPP 591 P + P P KTPPPP PPP Sbjct: 149 LLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPP 208 Query: 590 XPXP 579 P P Sbjct: 209 PPPP 212 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P P P PPP P PPP PP Sbjct: 34 PEPAPLVDLSPPPPPVNISSPPPPVNLSPPPP 65 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPPF 564 P PPP PPPP P P PPP P P PP+ Sbjct: 377 PSPPPP-PPPPPPPPPPPPPPPPPPPPPPPPPY 408 Score = 41.9 bits (94), Expect = 6e-04 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP PPPP P PPP PP P P PPPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPP 429 Score = 41.9 bits (94), Expect = 6e-04 Identities = 19/51 (37%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPF--SPXXXPXGXPPPP 795 P PP PPPP P+ P P P PP+ P P PPPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPP 438 Score = 41.5 bits (93), Expect = 8e-04 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPPF 564 P PPP PPPP P P PPP P P PP+ Sbjct: 393 PPPPPPPPPPPPPPPYVYPSPPPPPPSP--PPY 423 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PPP PPPP P P PPP P PP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPP 415 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PPP PPPP P P PPP P P P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYP 411 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP PPPP P+ PPP P PP P P PPPP Sbjct: 403 PPPPPYVYPSPPPPPPSPPPYVYPPP-PPPYVYPP--PPSPPYVYPPPP 448 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP PPPP P+ PPP P PP P P P PP Sbjct: 414 PPPPPSPPPYVYPPPPP--PYVYPPPPSPPYVYPPPPPSPQPYMYPSPP 460 Score = 38.7 bits (86), Expect = 0.006 Identities = 30/106 (28%), Positives = 31/106 (29%) Frame = -1 Query: 884 PHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXXXXXXXXXXXXX 705 P PPP P PP P P PPPP P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP------------------- 416 Query: 704 XXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P + P PPP PPPP P PPP P P P Sbjct: 417 -----PPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYP 457 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP PPPP P PPP PP P P PPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPP 428 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PP PPPP P PPP P P P P PPP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 638 TPPPPXPXXXPXXPPPXPXPXXPP 567 +PP P P P PPP P P PP Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPP 398 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPP--XPXPXXPPF 564 P PPP PP P P P PPP P P PP+ Sbjct: 411 PSPPPP---PPSPPPYVYPPPPPPYVYPPPPSPPY 442 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -3 Query: 885 PPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPPGGGXPXFXY 736 PP PP PP PP PPPP PP P + Y Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVY 425 Score = 33.5 bits (73), Expect = 0.21 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = -2 Query: 940 PXPPXXXXXPXXPPXPXXXPTXXPPXAXFPRXXPXFXXXPXRXGXPPPHXQGXXXGXPPX 761 P PP P PP P P P P P P PPP Q PP Sbjct: 402 PPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPPC 461 Query: 760 GGXP 749 P Sbjct: 462 NDLP 465 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -1 Query: 440 TPXXXPFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 +P P PP PP P P P PPP P PP Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPP 414 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 954 FXXXAPSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 F PSP PP PP PP PP PP P PP Sbjct: 372 FGCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPP---PPYVYPSPPPPPPSPP 421 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = -1 Query: 437 PXXXPFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 P P PP PP P P P + PP P PP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Frame = -3 Query: 903 PPXXXXPPXXXPPXXXSXGGPPXFXXXPPXX--GPPPPXXRXXXXGXPP 763 PP PP PP PP PP PPPP PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPP 427 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 43.2 bits (97), Expect = 3e-04 Identities = 35/137 (25%), Positives = 36/137 (26%), Gaps = 4/137 (2%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXX--PXXXPPFSPXXXPXGXPPPPXXGXXXGEX 768 P P K K PP P PPP P PP +P P P PP Sbjct: 123 PPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTP 182 Query: 767 PXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXP--XXXPXXPP 594 P P P P TPP P P P P Sbjct: 183 PVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTP 242 Query: 593 PXPXPXXPPFXXXXXGA 543 P P P P GA Sbjct: 243 PTPIPETCPIDTLKLGA 259 Score = 40.3 bits (90), Expect = 0.002 Identities = 37/133 (27%), Positives = 37/133 (27%), Gaps = 5/133 (3%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXG---XPP--P 798 P K P PP K P PP PH PP P PP P P PP P Sbjct: 67 PPTVKPHPKPPTVKPH---PKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKP 123 Query: 797 PXXGXXXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXP 618 P P P P P P TPP P P Sbjct: 124 PPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPP-TPTPTPPVVTPPTPTP 182 Query: 617 XXXPXXPPPXPXP 579 P PP P P Sbjct: 183 ---PVITPPTPTP 192 Score = 39.1 bits (87), Expect = 0.004 Identities = 30/126 (23%), Positives = 30/126 (23%), Gaps = 1/126 (0%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPP-FSPXXXPXGXPPPPXXGXXXGEXP 765 P P K P PP P PP P PP P P P P P Sbjct: 43 PVKPPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHP 102 Query: 764 XGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXP 585 P P P PPP P PPP P Sbjct: 103 KPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTP 162 Query: 584 XPXXPP 567 P P Sbjct: 163 CPPPTP 168 Score = 39.1 bits (87), Expect = 0.004 Identities = 33/128 (25%), Positives = 34/128 (26%), Gaps = 4/128 (3%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPP---PGXXPXXXPPF-SPXXXPXGXPPPPXXGXXXG 774 P PP K P PP PH PP P P P P P PP Sbjct: 55 PKPPAVKPPT--PKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHP 112 Query: 773 EXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPP 594 + P P K PP K PP P P P P Sbjct: 113 KPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTP 172 Query: 593 PXPXPXXP 570 P P P Sbjct: 173 PVVTPPTP 180 Score = 31.9 bits (69), Expect = 0.65 Identities = 30/115 (26%), Positives = 30/115 (26%), Gaps = 6/115 (5%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXXXXXX 726 PP P PH P P P P P PP P Sbjct: 29 PPKPSPAPHKPPKHPVKPPKPPAVKPPKPPAVKPPTPKPPTVKPHPKP--PTVKPHPKPP 86 Query: 725 XXXXXXXXXXXXPGAXKXXFXPXP---PPX*KTP--PPPXPXXXPXXPPP-XPXP 579 P K P P PP K P PPP P PPP P P Sbjct: 87 TVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKP 141 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 437 PXXXPFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXP 324 P P PP P K P P P T PP P P Sbjct: 46 PPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHP 83 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/59 (25%), Positives = 17/59 (28%) Frame = -3 Query: 939 PSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPP 763 P P + PP P P PP PP PPP + PP Sbjct: 102 PKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPP 160 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 43.2 bits (97), Expect = 3e-04 Identities = 33/118 (27%), Positives = 35/118 (29%), Gaps = 5/118 (4%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPP---PXXGXXXGEXPXGGXAXXXXX 735 PPPP P PPP P P SP PPP P P Sbjct: 670 PPPPVYSP---PPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHS 726 Query: 734 XXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPP--XPXXXPXXPPPXPXPXXPP 567 P + P PPP +PPPP P P PP P PP Sbjct: 727 PPPPVQSPPPPPVFSPPPPAPIYSPPPPPV-HSPPPPVHSPPPPPVHSPPPPVHSPPP 783 Score = 43.2 bits (97), Expect = 3e-04 Identities = 36/124 (29%), Positives = 37/124 (29%), Gaps = 11/124 (8%) Frame = -1 Query: 905 PPPPXXXP----HXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXX 738 PPPP P H PPP P P SP P PPPP P Sbjct: 706 PPPPVHSPPPPVHSPPPPVHSPPP-PVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVH 764 Query: 737 XXXXXXXXXXXXXXXXPGAXKXXFXPX---PPPX*KTPPPPXPXXXP----XXPPPXPXP 579 P P PPP +PPPP P P PPP P Sbjct: 765 SPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVT 824 Query: 578 XXPP 567 PP Sbjct: 825 PLPP 828 Score = 42.3 bits (95), Expect = 5e-04 Identities = 35/119 (29%), Positives = 37/119 (31%), Gaps = 6/119 (5%) Frame = -1 Query: 905 PPPPXXXP----HXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXG--XXXGEXPXGGXAXX 744 PPPP P H PPP P P SP P PPPP P + Sbjct: 656 PPPPVFSPPPPMHSPPPPVYSP-PPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 714 Query: 743 XXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 F P PP +PPPP P P PPP P PP Sbjct: 715 PPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPP-PVHSP--PPPVHSPPPPP 770 Score = 41.5 bits (93), Expect = 8e-04 Identities = 30/112 (26%), Positives = 32/112 (28%) Frame = -1 Query: 902 PPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXXXXXXX 723 PPP H PPP P PP P PPPP Sbjct: 647 PPPPPPVHSPPPPVFSPP--PPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVH 704 Query: 722 XXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PPP ++PPPP P P P P P PP Sbjct: 705 SPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPP-PVFSPPPPAPIYSPPPPP 755 Score = 39.9 bits (89), Expect = 0.002 Identities = 32/131 (24%), Positives = 33/131 (25%), Gaps = 3/131 (2%) Frame = -1 Query: 950 KXXPXPPXXKXXXKXPPPPXXXP-HXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXG 774 K P PP P P H PPP PP P PPPP Sbjct: 621 KRRPQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPP 680 Query: 773 EXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPP--XPXXXPXX 600 P PPP +PPPP P P Sbjct: 681 VHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVF 740 Query: 599 PPPXPXPXXPP 567 PP P P P Sbjct: 741 SPPPPAPIYSP 751 Score = 35.5 bits (78), Expect = 0.053 Identities = 29/114 (25%), Positives = 34/114 (29%), Gaps = 2/114 (1%) Frame = -1 Query: 656 PPPX*KTPPPPX--PXXXPXXPPPXPXPXXPPFXXXXXGAXXXXXXXXXXXXXFFXXXXX 483 PPP +PPPP P PPP P PP + Sbjct: 663 PPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPP----PVHSPPPPVHSPPPPVHSPPPPVH 718 Query: 482 XXXXXXXXXXXXTXTPXXXPFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 +P P F PP P P P P+ PPP+ P PP Sbjct: 719 SPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHS---PPPPVHSPPPP 769 Score = 35.5 bits (78), Expect = 0.053 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PP PPPP H PPP P P SP P PPPP Sbjct: 742 PPPPAPIYSPPPPPV---HSPPPPVHSPPPPPVHSP-PPPVHSPPPP 784 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = -3 Query: 936 SPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 SP P PP PP PP + PP PPPP Sbjct: 641 SPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPP 687 Score = 33.5 bits (73), Expect = 0.21 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P + P PP PPPP PPP P P SP P PPPP Sbjct: 728 PPPVQSPPPPPVFS-----PPPPAPIYSPPPPPVHSPPP-PVHSPPPPPVHSPPPP 777 Score = 31.9 bits (69), Expect = 0.65 Identities = 30/126 (23%), Positives = 33/126 (26%), Gaps = 4/126 (3%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXX-GXXXGEXPXGG 756 P + + P P P PP P P SP P PP G P Sbjct: 550 PKPQPPKQETPKPEESPKPQPPKQETPK--PEESPKPQPPKQEQPPKTEAPKMGSPPLES 607 Query: 755 XAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXP---PPXP 585 P PP +PPPP P P P PP P Sbjct: 608 PVPNDPYDASPIKKRRPQPPSPSTEETKTTSPQSPPV-HSPPPPPPVHSPPPPVFSPPPP 666 Query: 584 XPXXPP 567 PP Sbjct: 667 MHSPPP 672 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/43 (34%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = -1 Query: 440 TPXXXPFFXPPXXPPKKXPXPX---PLTKXXFXPPPLFXPXPP 321 +P P PP PP P P P PPP++ P PP Sbjct: 638 SPQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPP 680 Score = 31.5 bits (68), Expect = 0.86 Identities = 17/56 (30%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPP-PGXXPXXXPPFSPXXXPXGXPPP 798 P K P P + + PP P P PP P P PP P P P Sbjct: 497 PEQPKPKPESPKQESSKQEPPKPEESPKPEPPKPEESPKPQPPKQETPKPEESPKP 552 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -3 Query: 936 SPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 SP P PP PP PP PP PPPP Sbjct: 691 SPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPP 737 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = -3 Query: 903 PPXXXXPPXXX--PPXXXSXGGPPXFXXXPPXXGPPPP 796 PP PP PP S PP PP PPPP Sbjct: 665 PPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPP 702 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -3 Query: 903 PPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 P PP PP PP PP PPPP Sbjct: 688 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 723 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = -1 Query: 941 PXPPXXKXXX--KXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP + PPPP P P P P SP P PPPP Sbjct: 720 PPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPP-PVHSPPPP 769 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -3 Query: 903 PPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 P PP PP PP PP PPPP Sbjct: 770 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 805 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -3 Query: 885 PPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 PP PP PP PP PPPP Sbjct: 687 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 716 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -3 Query: 885 PPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 PP PP PP PP PPPP Sbjct: 769 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 798 Score = 29.1 bits (62), Expect = 4.6 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKX--PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P P PP PPPP P PPP P SP P PPPP Sbjct: 745 PAPIYSPPPPPVHSPPPPVHSPPPP---PVHSPPPPVHSPPPPVHSP-PPPVHSPPPP 798 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = -3 Query: 936 SPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 SP PP PP P PP PP PPP Sbjct: 683 SPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 729 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/49 (28%), Positives = 15/49 (30%) Frame = -3 Query: 942 APSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 +P P P PP PP PP PP PPP Sbjct: 646 SPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPP 694 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = -3 Query: 936 SPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 SP PP PP P PP PP PPP Sbjct: 676 SPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 722 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/50 (30%), Positives = 16/50 (32%), Gaps = 1/50 (2%) Frame = -3 Query: 942 APSPXXQXXXQXXPPXXXXPPXXX-PPXXXSXGGPPXFXXXPPXXGPPPP 796 +P P PP PP PP PP PP PPP Sbjct: 741 SPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPP 790 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = -3 Query: 936 SPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 SP PP PP P PP PP PPP Sbjct: 758 SPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 804 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 42.3 bits (95), Expect = 5e-04 Identities = 34/125 (27%), Positives = 35/125 (28%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKX 747 GG G GGG G G GGGG GG + Sbjct: 153 GGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGG 212 Query: 748 GAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLX 927 G G GGG G GE GG G G G G GGGG Sbjct: 213 GGGGSGGGGAYGGGGAHGGG--YGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHG 270 Query: 928 XGGXG 942 G G Sbjct: 271 GGSGG 275 Score = 42.3 bits (95), Expect = 5e-04 Identities = 34/114 (29%), Positives = 35/114 (30%), Gaps = 2/114 (1%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXG-GGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXK 744 GG G G GG G G G GGG GG G + G Sbjct: 169 GGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGA 228 Query: 745 XGAXPPXGXSPXXXPXXGG-GGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGG 903 G G G GG G GE GG G GGG G GGG Sbjct: 229 HGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGG 282 Score = 41.5 bits (93), Expect = 8e-04 Identities = 39/121 (32%), Positives = 40/121 (33%) Frame = +1 Query: 580 GXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKXGAXP 759 G G GGG G G GGG GGG G A G GA Sbjct: 105 GEGGGGGYGGAAGGHAGGGGGGSGGGGGS-----AYGAGGEHASGYGNGAGEGGGAGASG 159 Query: 760 PXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGGX 939 G + GGGG G G GG G GGG G GGGG GG Sbjct: 160 YGGGA-----YGGGGGHGGGGGGGSAGGAHGGSGYGGGE--GGGAGGGGSHGGAGGYGGG 212 Query: 940 G 942 G Sbjct: 213 G 213 Score = 41.1 bits (92), Expect = 0.001 Identities = 36/115 (31%), Positives = 37/115 (32%), Gaps = 2/115 (1%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKX 747 G G G G G G G GGG GGG G + A G Sbjct: 146 GNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAG-GAHGGSGYGGGEGGGAGGGGSHG 204 Query: 748 GAXPPXGXSPXXXPXXG--GGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG 906 GA G G GGG G G GG G GGG G GGGG Sbjct: 205 GAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGY--GGGAAGGYGGGGGG 257 Score = 41.1 bits (92), Expect = 0.001 Identities = 35/113 (30%), Positives = 36/113 (31%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKX 747 GG G GGG G G GGGG GGG G + G Sbjct: 191 GGEGGGAGGGGSHGGAGGYGGGG----GGGSGGGGAYGGGGAHGGGYGS----------- 235 Query: 748 GAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG 906 G G GGGG G GG G GGG G GGGG Sbjct: 236 GGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGG-GSGGGHGGGGGHGGGG 287 Score = 39.1 bits (87), Expect = 0.004 Identities = 32/114 (28%), Positives = 33/114 (28%), Gaps = 1/114 (0%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG-XNXXFXAPGXXXXXXXXXXXXXXXVXK 744 GG G G GGG G GGG GGG G + A G Sbjct: 62 GGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAG 121 Query: 745 XGAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG 906 G G G G GE GG GG G GGGG Sbjct: 122 GGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGG 175 Score = 34.7 bits (76), Expect = 0.093 Identities = 28/106 (26%), Positives = 29/106 (27%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKX 747 G G G GG G GG GGG G A G Sbjct: 31 GQASGGGGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGG 90 Query: 748 GAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWG 885 G GGGG G G GG G GGG +G Sbjct: 91 GGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYG 136 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG 906 GGGG G G G GGG G G GG Sbjct: 35 GGGGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGG 71 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG 906 GGGG G G GG G GGG G G GG Sbjct: 40 GGGGGSGGVSSGGYGGESGGGY-GGGSGEGAGGGYGG 75 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 42.3 bits (95), Expect = 5e-04 Identities = 34/129 (26%), Positives = 34/129 (26%), Gaps = 6/129 (4%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPP-----PXXGXXXGE 771 PP K PP PPG P PP P P P P P Sbjct: 3 PPTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKP 62 Query: 770 XPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPP-PX*KTPPPPXPXXXPXXPP 594 P P A K P PP P TP P P P P Sbjct: 63 VPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPA 122 Query: 593 PXPXPXXPP 567 P P P P Sbjct: 123 PAPTPAPSP 131 Score = 36.7 bits (81), Expect = 0.023 Identities = 37/132 (28%), Positives = 37/132 (28%), Gaps = 1/132 (0%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGX 783 P P PP K K PP P P PPP P PP P P P P Sbjct: 25 PPGPSPCPSPPP-KPQPKPPPAPSPSPCPSPPPKPQPKPVPP--PACPPTPPKPQPKPAP 81 Query: 782 XXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXP- 606 P A P K P P P PPP P P Sbjct: 82 PPEPKPAPPPAPKPVPC--------------PSPPKPP-APTPKPVPPHGPPPKPAPAPT 126 Query: 605 XXPPPXPXPXXP 570 P P P P P Sbjct: 127 PAPSPKPAPSPP 138 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -1 Query: 440 TPXXXPFFXPPXXP-PKKXPXPXPLTKXXFXPPPLFXPXPP 321 +P P PP P P P P P + PPP P PP Sbjct: 33 SPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPP 73 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 41.9 bits (94), Expect = 6e-04 Identities = 32/113 (28%), Positives = 32/113 (28%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXXXXXX 726 PPPP P PPP P P SP P PPPP P Sbjct: 526 PPPPVYSPPPPPPPVHSPPP-PVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPP 584 Query: 725 XXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PPP PPPP P P P P P P Sbjct: 585 PVHSPPPPVHSPP--PPAPVHSPPPPVHS-PPPPPPVYSPPPPVFSPPPSQSP 634 Score = 37.1 bits (82), Expect = 0.017 Identities = 34/125 (27%), Positives = 35/125 (28%), Gaps = 2/125 (1%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PP PPPP H PPP P PP P P PPPP Sbjct: 533 PPPPPPPVHSPPPPV---HSPPPP---PVYSPP--PPPPPVHSPPPPVFSPPPPVYSPPP 584 Query: 755 XAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPP--XPX 582 P P PPP +PPPP P PP Sbjct: 585 PVHSPPPPVHSPPPPAPVHSPPPPVHS----PPPPPPVYSPPPPVFSPPPSQSPPVVYSP 640 Query: 581 PXXPP 567 P PP Sbjct: 641 PPRPP 645 Score = 36.7 bits (81), Expect = 0.023 Identities = 29/113 (25%), Positives = 30/113 (26%) Frame = -1 Query: 902 PPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXXXXXXX 723 PPP PP P PP P PPPP P Sbjct: 518 PPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPP 577 Query: 722 XXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPPF 564 P P PP +PPP P P PPP P P F Sbjct: 578 PVYSPPPPVHSP--PPPVHSPPPPAPVHSPPP--PVHSPPPPPPVYSPPPPVF 626 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -1 Query: 440 TPXXXPFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 +P P + PP PP P P+ PPP++ P PP Sbjct: 549 SPPPPPVYSPPPPPPPVHSPPPPVFSP---PPPVYSPPPP 585 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPP 798 P P PPP H PPP P PP P PPP Sbjct: 583 PPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPP 630 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = -3 Query: 900 PXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 P PP PP PP + PP PPPP Sbjct: 558 PPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPP 592 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -1 Query: 437 PXXXPFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 P P PP PP P P P+ PPP+ P PP Sbjct: 535 PPPPPVHSPP--PPVHSPPPPPVYSPPPPPPPVHSPPPP 571 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = -3 Query: 939 PSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 P P P PP PP PP PP PPPP Sbjct: 552 PPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPP 599 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -1 Query: 425 PFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 P + PP PP P P+ PPP++ P PP Sbjct: 529 PVYSPPPPPPPVHSPPPPVHSP--PPPPVYSPPPP 561 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -1 Query: 425 PFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 P PP P P P P PPP+F P PP Sbjct: 546 PVHSPPPPPVYSPPPPPPPVHSP--PPPVFSPPPP 578 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = -3 Query: 939 PSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 P P PP PP P PP PP PPP Sbjct: 551 PPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPP 598 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -3 Query: 903 PPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPP 799 PP PP PP S P PP PPP Sbjct: 623 PPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPP 657 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = -3 Query: 939 PSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 P+P P PP PP PP PP PPPP Sbjct: 520 PAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPP---PPPP 564 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = -3 Query: 942 APSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 +P P PP PP P PP PP PPPP Sbjct: 532 SPPPPPPPVHSPPPPVHSPPPP--PVYSPPPPPPPVHSPPPPVFSPPPP 578 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/60 (26%), Positives = 18/60 (30%) Frame = -3 Query: 942 APSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPP 763 +P P P PP PP PP + PP PPP PP Sbjct: 588 SPPPPVHSPPPPAPVHSPPPPVHSPPPP-----PPVYSPPPPVFSPPPSQSPPVVYSPPP 642 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 41.9 bits (94), Expect = 6e-04 Identities = 30/122 (24%), Positives = 30/122 (24%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PP PPP P PP P P P P PPPP Sbjct: 74 PPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTP-- 131 Query: 755 XAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPX 576 P P P P T P P P PPP P P Sbjct: 132 PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPS 191 Query: 575 XP 570 P Sbjct: 192 VP 193 Score = 36.3 bits (80), Expect = 0.030 Identities = 30/126 (23%), Positives = 30/126 (23%), Gaps = 2/126 (1%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPX--GXPPPPXXGXXXGEX 768 P PP P PP P P P P PP SP P P Sbjct: 99 PPPPTPTPSVPSPTPPVSPPPPTPTPSV-PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPT 157 Query: 767 PXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPX 588 P P P PP TPP P P P Sbjct: 158 PTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTP 217 Query: 587 PXPXXP 570 P P P Sbjct: 218 PTPSVP 223 Score = 35.9 bits (79), Expect = 0.040 Identities = 28/129 (21%), Positives = 29/129 (22%), Gaps = 4/129 (3%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXX----PXXXPPFSPXXXPXGXPPPPXXGXXXG 774 P PP P PP P P P P PP +P PP Sbjct: 117 PPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPS 176 Query: 773 EXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPP 594 P P PP P PP P PP Sbjct: 177 PPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPP 236 Query: 593 PXPXPXXPP 567 P P P Sbjct: 237 SVPTPSGSP 245 Score = 31.1 bits (67), Expect = 1.1 Identities = 29/124 (23%), Positives = 32/124 (25%), Gaps = 2/124 (1%) Frame = -1 Query: 686 GAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPPFXXXXXGAXXXXXXXXXXXX 507 G + P P +PPPP P PP P P P Sbjct: 66 GGDDGGYTPPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPS 125 Query: 506 XFFXXXXXXXXXXXXXXXXXTXTPXXXPFFXPPXXPPKKXPXPXP--LTKXXFXPPPLFX 333 + TP P PP P P P P T PPP Sbjct: 126 VPSPTPPVSPPPPTPTPSVPSPTPPVSP---PPPTPTPSVPSPTPPVPTDPMPSPPPPVS 182 Query: 332 PXPP 321 P PP Sbjct: 183 PPPP 186 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 33.9 bits (74), Expect(2) = 0.001 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXF 678 GG G G GGG G G GG G GGG G N F Sbjct: 105 GGGRGGGRGGGSYG--GGYGGRGSGGRGGGGGDNSCF 139 Score = 33.1 bits (72), Expect = 0.28 Identities = 29/98 (29%), Positives = 30/98 (30%) Frame = +1 Query: 580 GXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKXGAXP 759 G GGG G G GGGG GGG G G K G Sbjct: 88 GNSGGGGSSGGRGGFGGGG--GRGGGRGGGSYGGGYGGRGSGGRGGGGGDNSCFKCG--E 143 Query: 760 PXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGG 873 P + GGGG G G G G GGG Sbjct: 144 PGHMAREC--SQGGGGYSGGGGGGRYGSGGGGGGGGGG 179 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGG 636 GG G GGG G G GGGG Sbjct: 155 GGGYSGGGGGGRYGSGGGGGGGG 177 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 775 PXXXPXXG--GGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGG 903 P P G GGG G G GG G GGG G G G Sbjct: 81 PDGAPVQGNSGGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRG 125 Score = 26.2 bits (55), Expect(2) = 0.001 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGGXG 942 GGGG GE G GGG G GGGG GG G Sbjct: 131 GGGGDNSCFKCGEPGHMARECSQGGGGYSG--GGGGGRYGSGGGGGGGG 177 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 40.7 bits (91), Expect = 0.001 Identities = 39/140 (27%), Positives = 40/140 (28%), Gaps = 8/140 (5%) Frame = +1 Query: 547 PXXXXXXGGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXX 726 P GG G G GG G GG G GGG G A G Sbjct: 247 PGGPYKSGGGYGGGRSGGYGGYGGEFGGYGGGGYGGGVGPYRGEPALGYSGRYGGGGGGY 306 Query: 727 XXXVXKXGAXPPXGXSP------XXXPXXGGGGXPXGXXXGEXGGXXXGXXPG--GGXXW 882 G G P GG G P G G G G G GG Sbjct: 307 NRGGYSMGGGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGGMGGAGG 366 Query: 883 GXXXGGGGXLXXXLXXGGXG 942 G GGGG + GG G Sbjct: 367 GGYRGGGGYDMGGVGGGGAG 386 Score = 38.7 bits (86), Expect = 0.006 Identities = 32/119 (26%), Positives = 34/119 (28%) Frame = +1 Query: 586 GXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKXGAXPPX 765 G GGG GGGG + G G + PG G Sbjct: 301 GGGGGYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGG 360 Query: 766 GXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGGXG 942 GGGG G G GG G GGG G GGG GG G Sbjct: 361 MGGAGGGGYRGGGGYDMG---GVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGGSG 416 Score = 33.9 bits (74), Expect = 0.16 Identities = 31/114 (27%), Positives = 32/114 (28%), Gaps = 2/114 (1%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGX-NXXFXAPGXXXXXXXXXXXXXXXVXK 744 GG G GG G G GGG GG G + P Sbjct: 301 GGGGGYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGG 360 Query: 745 XGAXPPXGXSPXXXPXXGG-GGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGG 903 G G GG GG G GG G GGG G GGG Sbjct: 361 MGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGG 414 Score = 31.5 bits (68), Expect = 0.86 Identities = 39/135 (28%), Positives = 40/135 (29%), Gaps = 10/135 (7%) Frame = +1 Query: 568 GGXXGXGXGG-------GXXGXXXGXGGG---GVFXXGGGXGXNXXFXAPGXXXXXXXXX 717 GG G G G G G G GGG G + GGG G PG Sbjct: 277 GGGYGGGVGPYRGEPALGYSGRYGGGGGGYNRGGYSMGGGGGYGG---GPGDMYGGSYGE 333 Query: 718 XXXXXXVXKXGAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXG 897 G S G GG G G GG G GGG G G Sbjct: 334 PGGGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRG-GGGYDMGGVGGGGAG-GYGAG 391 Query: 898 GGGXLXXXLXXGGXG 942 GGG GG G Sbjct: 392 GGGNGGGSFYGGGGG 406 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 G G G GG G G GGG GGG G Sbjct: 386 GGYGAGGGGNGGGSFYGGGGGRGGYGGGGSG 416 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 40.7 bits (91), Expect = 0.001 Identities = 43/205 (20%), Positives = 49/205 (23%), Gaps = 1/205 (0%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGX 753 P K PP P P PPP P P +SP P PP P Sbjct: 182 PPIKPPVHKPPTPIYSPPIKPPPVHKPPT-PIYSPPIKPPPVHKPPTPTYSPPVKPPPVH 240 Query: 752 AXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXX 573 P P PP +TPP P P PPP P Sbjct: 241 KPPTPIYSPPIKPPPVHKPPTP----IYSPPVKPPPVQTPPTPI-YSPPVKPPPVHKPPT 295 Query: 572 PPFXXXXXGAXXXXXXXXXXXXXFFXXXXXXXXXXXXXXXXXTX-TPXXXPFFXPPXXPP 396 P + P + PP PP Sbjct: 296 PTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPP 355 Query: 395 KKXPXPXPLTKXXFXPPPLFXPXPP 321 P P+ PPP+ P P Sbjct: 356 PVHKPPTPIYSPPVKPPPVHKPPTP 380 Score = 36.7 bits (81), Expect = 0.023 Identities = 44/209 (21%), Positives = 47/209 (22%), Gaps = 2/209 (0%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPX 762 P P K PP P PP P PP +P P PPP P Sbjct: 411 PPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPP-TPIYSPPVKPPPVHKPPTPTYSPP 469 Query: 761 GGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPX--PXXXPXXPPPX 588 P PPP K P P P P PP Sbjct: 470 IKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPT 529 Query: 587 PXPXXPPFXXXXXGAXXXXXXXXXXXXXFFXXXXXXXXXXXXXXXXXTXTPXXXPFFXPP 408 P PP P P + PP Sbjct: 530 PT-YSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPT--PTYSPP 586 Query: 407 XXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 PP P P PPP+ P P Sbjct: 587 IKPPPVHKPPTPTYSPPIKPPPVHKPPTP 615 Score = 36.3 bits (80), Expect = 0.030 Identities = 44/207 (21%), Positives = 49/207 (23%), Gaps = 2/207 (0%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PP + PP P P PPP P P +SP P PP P Sbjct: 80 PPIYPPPIQKPPTPTYSPPIYPPPIQKP-PTPTYSPPIYPPPIQKPPTPTY---SPPIYP 135 Query: 755 XAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPP--PXPXXXPXXPPPXPX 582 P PPP K P P P P PP P Sbjct: 136 PPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPI 195 Query: 581 PXXPPFXXXXXGAXXXXXXXXXXXXXFFXXXXXXXXXXXXXXXXXTXTPXXXPFFXPPXX 402 PP P P + PP Sbjct: 196 -YSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPP--TPIYSPPIK 252 Query: 401 PPKKXPXPXPLTKXXFXPPPLFXPXPP 321 PP P P+ PPP+ P P Sbjct: 253 PPPVHKPPTPIYSPPVKPPPVQTPPTP 279 Score = 36.3 bits (80), Expect = 0.030 Identities = 44/208 (21%), Positives = 49/208 (23%), Gaps = 3/208 (1%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PP + PP P P PPP P P +SP P PP P Sbjct: 97 PPIYPPPIQKPPTPTYSPPIYPPPIQKPPT-PTYSPPIYPPPIQKPPTPSYSPPVKPPPV 155 Query: 755 XAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPP---PXPXXXPXXPPPXP 585 P P PP K P P P P PP P Sbjct: 156 QMPPTPTYSPPIKPPPVHKPPTP----TYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTP 211 Query: 584 XPXXPPFXXXXXGAXXXXXXXXXXXXXFFXXXXXXXXXXXXXXXXXTXTPXXXPFFXPPX 405 PP P P + PP Sbjct: 212 I-YSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPT--PIYSPPV 268 Query: 404 XPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 PP P P+ PPP+ P P Sbjct: 269 KPPPVQTPPTPIYSPPVKPPPVHKPPTP 296 Score = 35.9 bits (79), Expect = 0.040 Identities = 44/211 (20%), Positives = 50/211 (23%), Gaps = 4/211 (1%) Frame = -1 Query: 941 PXPPXXKXXXKXPP---PPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGE 771 P PP PP PP P PPP P P +SP P PP Sbjct: 58 PPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKP-PTPTYSPPIYPPPIQKPPTPTYSPPI 116 Query: 770 XPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPP 591 P P P PP + PP P P PPP Sbjct: 117 YPPPIQKPPTPTYSPPIYPPPIQKPPTPS----YSPPVKPPPVQMPPTP-TYSPPIKPPP 171 Query: 590 XPXPXXPPFXXXXXGAXXXXXXXXXXXXXFFXXXXXXXXXXXXXXXXXTXT-PXXXPFFX 414 P P + P + Sbjct: 172 VHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYS 231 Query: 413 PPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 PP PP P P+ PPP+ P P Sbjct: 232 PPVKPPPVHKPPTPIYSPPIKPPPVHKPPTP 262 Score = 35.1 bits (77), Expect = 0.070 Identities = 45/216 (20%), Positives = 50/216 (23%), Gaps = 11/216 (5%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGX--PP-----PPXXGXXX 777 PP PP P P PPP P P +SP P PP PP Sbjct: 350 PPVKPPPVHKPPTPIYSPPVKPPPVHKPPT-PIYSPPVKPPPIQKPPTPTYSPPIKPPPL 408 Query: 776 GEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXP 597 + P + P P P K PP P P Sbjct: 409 QKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSP 468 Query: 596 PPXPXPXXPPFXXXXXGAXXXXXXXXXXXXXFFXXXXXXXXXXXXXXXXXTXTP----XX 429 P P P PP P Sbjct: 469 PIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPP 528 Query: 428 XPFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 P + PP PP P P PPP+ P P Sbjct: 529 TPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTP 564 Score = 34.7 bits (76), Expect = 0.093 Identities = 45/210 (21%), Positives = 50/210 (23%), Gaps = 5/210 (2%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PP PP P P PPP P P +SP P PP + P Sbjct: 434 PPVKPPPVHKPPTPIYSPPVKPPPVHKPPT-PTYSPPIKPPPVKPPTPTYSPPVQPPP-- 490 Query: 755 XAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPP--PPXPXXXPXX-PPPXP 585 P K PP K PP PP P P PPP Sbjct: 491 -------VQKPPTPTYSPPVKPPPIQKPPTPTYSPPI-KPPPVKPPTPTYSPPIKPPPVH 542 Query: 584 XPXXPPFXXXXXGAXXXXXXXXXXXXXFFXXXXXXXXXXXXXXXXXTXT--PXXXPFFXP 411 P P + P + P Sbjct: 543 KPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSP 602 Query: 410 PXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 P PP P P PPP+ P P Sbjct: 603 PIKPPPVHKPPTPTYSPPIKPPPVHKPPTP 632 Score = 34.3 bits (75), Expect = 0.12 Identities = 42/209 (20%), Positives = 46/209 (22%), Gaps = 2/209 (0%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPX 762 P P K PP P PP P PP +P P PPP P Sbjct: 461 PPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPP-TPTYSPPVKPPPIQKPPTPTYSPP 519 Query: 761 GGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPX 582 P PPP K P P P PPP Sbjct: 520 IKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSP--PIKPPPVHK 577 Query: 581 PXXPPFXXXXXGAXXXXXXXXXXXXXFFXXXXXXXXXXXXXXXXXTXT--PXXXPFFXPP 408 P P + P + PP Sbjct: 578 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPP 637 Query: 407 XXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 PP P P PPP+ P P Sbjct: 638 IKPPPVHKPPTPTYSPPIKPPPVQKPPTP 666 Score = 34.3 bits (75), Expect = 0.12 Identities = 30/122 (24%), Positives = 32/122 (26%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PP PP P P PPP P P +SP P PP P Sbjct: 619 PPIKPPPVHKPPTPTYSPPIKPPPVHKP-PTPTYSPPIKPPPVQKPPTPTYSPPVKPPPV 677 Query: 755 XAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPX 576 P P PP + PP P P PPP P Sbjct: 678 QLPPTPTYSPPVKPPPVQVPPTP----TYSPPVKPPPVQVPPTP-TYSPPIKPPPVQVPP 732 Query: 575 XP 570 P Sbjct: 733 TP 734 Score = 33.9 bits (74), Expect = 0.16 Identities = 43/207 (20%), Positives = 46/207 (22%), Gaps = 3/207 (1%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PP + PP P P PPP P P P PP P P Sbjct: 148 PPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPP--- 204 Query: 755 XAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPP---PXPXXXPXXPPPXP 585 P PPP K P P P P PP P Sbjct: 205 --VHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTP 262 Query: 584 XPXXPPFXXXXXGAXXXXXXXXXXXXXFFXXXXXXXXXXXXXXXXXTXTPXXXPFFXPPX 405 PP P P + PP Sbjct: 263 I-YSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPP--TPTYSPPI 319 Query: 404 XPPKKXPXPXPLTKXXFXPPPLFXPXP 324 PP P P PPP+ P P Sbjct: 320 KPPPVQKPPTPTYSPPIKPPPVKPPTP 346 Score = 33.9 bits (74), Expect = 0.16 Identities = 30/124 (24%), Positives = 35/124 (28%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PP + PP P P PPP P P +SP P PP + P Sbjct: 300 PPVKSPPVQKPPTPTYSPPIKPPPVQKP-PTPTYSPPIKPPPVKPPTPIYSPPVKPP--- 355 Query: 755 XAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPX 576 P P PP + PP P P PPP P Sbjct: 356 PVHKPPTPIYSPPVKPPPVHKPP--TPIYSPPVKPPPIQKPPTP-TYSPPIKPPPLQKPP 412 Query: 575 XPPF 564 P + Sbjct: 413 TPTY 416 Score = 33.9 bits (74), Expect = 0.16 Identities = 45/210 (21%), Positives = 49/210 (23%), Gaps = 4/210 (1%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPX 762 P P K PP P PP P PP +P P PPP P Sbjct: 327 PPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPP-TPIYSPPVKPPP----VHKPPTPI 381 Query: 761 GGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPP--PPXP-XXXPXXPPP 591 P K PP K PP PP P P PPP Sbjct: 382 YSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPI-KLPPVKPPTPIYSPPVKPPP 440 Query: 590 XPXPXXPPFXXXXXGAXXXXXXXXXXXXXFFXXXXXXXXXXXXXXXXXTXT-PXXXPFFX 414 P P + P + Sbjct: 441 VHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYS 500 Query: 413 PPXXPPKKXPXPXPLTKXXFXPPPLFXPXP 324 PP PP P P PPP+ P P Sbjct: 501 PPVKPPPIQKPPTPTYSPPIKPPPVKPPTP 530 Score = 33.5 bits (73), Expect = 0.21 Identities = 42/207 (20%), Positives = 46/207 (22%), Gaps = 2/207 (0%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PP PP P P PPP P P +SP P PP P Sbjct: 451 PPVKPPPVHKPPTPTYSPPIKPPPVKPPT--PTYSPPVQPPPVQKPPTPTYSPPVKPP-- 506 Query: 755 XAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPX 576 P PPP K P P P PPP P Sbjct: 507 --PIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSP--PIKPPPIHKPP 562 Query: 575 XPPFXXXXXGAXXXXXXXXXXXXXFFXXXXXXXXXXXXXXXXXTXT--PXXXPFFXPPXX 402 P + P + PP Sbjct: 563 TPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIK 622 Query: 401 PPKKXPXPXPLTKXXFXPPPLFXPXPP 321 PP P P PPP+ P P Sbjct: 623 PPPVHKPPTPTYSPPIKPPPVHKPPTP 649 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPP 798 PP + PP P P PPP P SP G PPP Sbjct: 704 PPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSPPQGGYGTPPP 749 Score = 33.1 bits (72), Expect = 0.28 Identities = 42/207 (20%), Positives = 48/207 (23%), Gaps = 2/207 (0%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PP + PP P P PPP P P +SP P PP + P Sbjct: 484 PPVQPPPVQKPPTPTYSPPVKPPPIQKPPT-PTYSPPIKPPPVKPPTPTYSPPIKPPP-- 540 Query: 755 XAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPX 576 P PPP K P P P PPP P Sbjct: 541 --VHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSP--PIKPPPVHKPP 596 Query: 575 XPPFXXXXXGAXXXXXXXXXXXXXFFXXXXXXXXXXXXXXXXXTXT--PXXXPFFXPPXX 402 P + P + PP Sbjct: 597 TPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIK 656 Query: 401 PPKKXPXPXPLTKXXFXPPPLFXPXPP 321 PP P P PPP+ P P Sbjct: 657 PPPVQKPPTPTYSPPVKPPPVQLPPTP 683 Score = 31.9 bits (69), Expect = 0.65 Identities = 42/206 (20%), Positives = 46/206 (22%), Gaps = 2/206 (0%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGX 753 P K PP P P PPP P P +SP P PP P Sbjct: 518 PPIKPPPVKPPTPTYSPPIKPPPVHKPPT-PTYSPPIKPPPIHKPPTPTYSPPIKPPPVH 576 Query: 752 AXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXX 573 P P PP PP P P PPP P Sbjct: 577 KPPTPTYSPPIKPPPVHKPPTP----TYSPPIKPPPVHKPPTPT-YSPPIKPPPVHKPPT 631 Query: 572 PPFXXXXXGAXXXXXXXXXXXXXFFXXXXXXXXXXXXXXXXXTXTPXXXPF--FXPPXXP 399 P + P + PP P Sbjct: 632 PTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKP 691 Query: 398 PKKXPXPXPLTKXXFXPPPLFXPXPP 321 P P P PPP+ P P Sbjct: 692 PPVQVPPTPTYSPPVKPPPVQVPPTP 717 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PPP PPPP P P PPP P P PP Sbjct: 62 PPPPPPPPCPPPPSP--PPCPPPPSPPPSPPP 91 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PP P P P PPP P PP P P PPPP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPP 92 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/59 (32%), Positives = 20/59 (33%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXP 765 P PP P PP P PPP P PP P P PP P + P Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPP--PPQLPPPAPPKPQPSPPTPDLP 118 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P P PPPP P PP P PP SP P PPPP Sbjct: 52 PEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSP--PPPQLPPPP 98 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PPP PP P P P PPP P P P Sbjct: 64 PPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLP 95 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P P PPPP P PPP P PP P P PPP Sbjct: 50 PSPEPEPEPADCPPPPPPPP-CPPPPSPPPCPPPPSPPPSPPPPQLPPP 97 Score = 36.3 bits (80), Expect = 0.030 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -1 Query: 662 PXPPPX*KTPPPPX-PXXXPXXPPPXPXPXXPP 567 P P P PPPP P P PPP P P PP Sbjct: 54 PEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPP 86 Score = 34.3 bits (75), Expect = 0.12 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPP-PPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P P PP PP PP P PPP P P P P P PP Sbjct: 58 PADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLP-PPPQLPPPAPPKPQPSPP 113 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PP PPPP P P P P P PP Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPP 102 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 PPP P P P P PPP P P P Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPP 74 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = -3 Query: 942 APSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 +PSP + PP PP PP PP PP PPP Sbjct: 49 SPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPP 97 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = -1 Query: 662 PXPPPX*KTPP---PPXPXXXPXXPPPXPXPXXPP 567 P P P + P PP P P PPP P P PP Sbjct: 48 PSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPP 82 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 662 PXPPPX*KTP-PPPXPXXXPXXPPPXPXPXXPP 567 P PPP P PPP P PPP P PP Sbjct: 74 PSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPP 106 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPPF 564 P PPP PPP P P P P P PF Sbjct: 87 PSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLPF 119 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P P P + P P P PPP P P PP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPP 77 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 P PPP PP P P P PPP P P Sbjct: 69 PCPPPP-SPPPCPPPPSPPPSPPPPQLPPPP 98 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 P PP +PPPP P PPP P P Sbjct: 80 PPPPSPPPSPPPPQLPPPPQLPPPAPPKPQP 110 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 P PPP P PP P P P P P P Sbjct: 78 PCPPPPSPPPSPPPPQLPPPPQLPPPAPPKP 108 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 P PPP P P P P PP P P P Sbjct: 83 PSPPPSPPPPQLPPPPQLPPPAPPKPQPSPP 113 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 437 PXXXPFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 P P PP PP P P P PP L P PP Sbjct: 68 PPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPP 106 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/64 (26%), Positives = 19/64 (29%), Gaps = 1/64 (1%) Frame = -3 Query: 936 SPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXP-PXXGPPPPXXRXXXXGXPPG 760 +P + P PP PP PP P P PPPP PP Sbjct: 45 NPPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPA 104 Query: 759 GGXP 748 P Sbjct: 105 PPKP 108 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -2 Query: 400 PPKXPPXPPP*QKXXFXPPPFFXXXPP 320 PP PP PPP PPP PP Sbjct: 64 PPPPPPCPPPPSPPPCPPPPSPPPSPP 90 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 936 SPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 SP PP PP PP S PP F PP PPPP Sbjct: 566 SPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPP 612 Score = 38.7 bits (86), Expect = 0.006 Identities = 32/132 (24%), Positives = 36/132 (27%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGX 783 P + P PP + + PPP P PP P SP PPPP Sbjct: 516 PVKNRRSPPPPKVEDT-RVPPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPH--V 572 Query: 782 XXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPX 603 P P F P PP +PPPP P Sbjct: 573 YSPPPPVASPPPPSPPPPVHSPPPPPVFSPPP----PVFSPPPPSPVYSPPPPSHSPPPP 628 Query: 602 XPPPXPXPXXPP 567 P P PP Sbjct: 629 VYSPPPPTFSPP 640 Score = 35.1 bits (77), Expect = 0.070 Identities = 19/59 (32%), Positives = 20/59 (33%) Frame = -3 Query: 939 PSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPP 763 PSP PP PP PP S P + PP PPPP PP Sbjct: 541 PSPSPPSPIYSPPPPVHSPP---PPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPP 596 Score = 33.1 bits (72), Expect = 0.28 Identities = 27/117 (23%), Positives = 32/117 (27%), Gaps = 3/117 (2%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPPFXXXXXGAXXXXXXXXXXXXXFFXXXXX 483 P PP T PP P PP P PP + + Sbjct: 523 PPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPP----PVHSPPPPVYSSPPPPHVYSPPPP 578 Query: 482 XXXXXXXXXXXXTXTPXXXPFFXPPXX---PPKKXPXPXPLTKXXFXPPPLFXPXPP 321 +P P F PP PP P P PPP++ P PP Sbjct: 579 VASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPP 635 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = -3 Query: 942 APSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 +PSP P PP P PP PP PPPP Sbjct: 542 SPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPP 590 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = -2 Query: 961 PGXXXXGPXPPXXXXXPXXPPXPXXXPTXXPPXAXFPRXXPXFXXXPXRXGXPPP 797 P P PP P PP P P PP F P F P PP Sbjct: 568 PPPHVYSPPPPVASPPPPSPPPPVHSP---PPPPVFSPPPPVFSPPPPSPVYSPP 619 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPP 798 P PP PP P PPP P +SP P PPP Sbjct: 595 PPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSP-PPPTFSPPP 641 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/55 (25%), Positives = 16/55 (29%) Frame = -2 Query: 961 PGXXXXGPXPPXXXXXPXXPPXPXXXPTXXPPXAXFPRXXPXFXXXPXRXGXPPP 797 P P PP P P P+ PP + P F P PP Sbjct: 595 PPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPPTHNTNQPP 649 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 39.9 bits (89), Expect = 0.002 Identities = 35/114 (30%), Positives = 35/114 (30%), Gaps = 3/114 (2%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGGGVFXXGG-GXGXNXXFXAPGXXXXXXXXXXXXXXXVXKX 747 G G G G G G G GGG F GG G G PG Sbjct: 4 GGCGGGPGRGGRGFG-GRGGGPGFGPGGPGFGPGGPGFGPGGPGFGPGGPGFGGRGPRGP 62 Query: 748 GAXP--PXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGG 903 G P P S P GGGG P G G G G G GGG Sbjct: 63 GFGPRGPGPWSGPRGPRPGGGGGPGPGPWSGPRGPRPGGGGGPGSGCGSGTGGG 116 Score = 34.7 bits (76), Expect = 0.093 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 4/100 (4%) Frame = +1 Query: 568 GGXXGXGXGG---GXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXV 738 GG G G GG G G G GG G G G G PG Sbjct: 21 GGGPGFGPGGPGFGPGGPGFGPGGPGFGPGGPGFGGRGP-RGPGFGPRGPGPWSGPRGPR 79 Query: 739 XKXGAXP-PXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXG 855 G P P S P GGGG P GG G Sbjct: 80 PGGGGGPGPGPWSGPRGPRPGGGGGPGSGCGSGTGGGNQG 119 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGGXG 942 GGGG G G GG G GGG WG GGGG GG G Sbjct: 70 GGGGGGGGGGGGGGGGGGGG---GGGWGWGGGGGGGGWYKWGCGGGGKG 115 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G G GGG G G GGGG GGG G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGG 101 Score = 36.3 bits (80), Expect = 0.030 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G G GGG G G GGGG + G G G Sbjct: 81 GGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGG 112 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G G GGG G G GGG + GGG G Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 35.5 bits (78), Expect = 0.053 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 805 GXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGGXG 942 G G G GG G GGG WG GGGG GG G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGG 113 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 G G G GGG G G GGGG G G G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGG 98 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGGGVFXXGGG 657 G G GGG G G GGGG GGG Sbjct: 63 GSYRWGWGGGGGGGGGGGGGGGGGGGGGG 91 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PP ++PPPP P P PPP P P PP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PPPP P PPP P PP G PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPP 78 Score = 34.7 bits (76), Expect = 0.093 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 668 FXPXPPPX*KTPPPPXPXXXPXXPPPXPXP 579 F PPP PPPP P P PPP P P Sbjct: 38 FPQSPPP----PPPPPPPPPPPPPPPPPPP 63 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 7/56 (12%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPG-------XXPXXXPPFSPXXXPXGXPPPP 795 P P PPPP P PPP P PP + P PPPP Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPP 94 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXP 585 P PP PPPP P P PPP P Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 29.9 bits (64), Expect = 2.6 Identities = 22/92 (23%), Positives = 23/92 (25%) Frame = -1 Query: 842 PPFSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFX 663 PP P P PPPP P A Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPP-P 93 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PPP + PP P P PP P P Sbjct: 94 PQPPPRSQPPPKPPQKNLPRRHPPPPRSPEKP 125 Score = 28.3 bits (60), Expect = 8.0 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 3/52 (5%) Frame = -1 Query: 941 PXPPXXKXXXKX---PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP K PPPP P PPP PP P PPPP Sbjct: 76 PPPPPVTDMIKPLSSPPPPQPPPRSQPPP------KPP--QKNLPRRHPPPP 119 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 39.9 bits (89), Expect = 0.002 Identities = 33/132 (25%), Positives = 36/132 (27%), Gaps = 7/132 (5%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPP---XXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGE 771 P PP + PPP P PPP P SP P PPPP G + Sbjct: 575 PPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNK 634 Query: 770 ---XPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXP-XXXPX 603 P P + PP PPPP P Sbjct: 635 RQAQPPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISN 694 Query: 602 XPPPXPXPXXPP 567 P P P PP Sbjct: 695 APKPPAPPPLPP 706 Score = 38.7 bits (86), Expect = 0.006 Identities = 34/110 (30%), Positives = 34/110 (30%), Gaps = 3/110 (2%) Frame = -1 Query: 905 PPPPXXXP--HXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXXXX 732 PPPP P PPP P S P PPPP P A Sbjct: 645 PPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPP--------PPPPKANISNAP 696 Query: 731 XXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTP-PPPXPXXXPXXPPPXP 585 GA P PPP KTP PPP P PPP P Sbjct: 697 KPPAPPPLPPSSTRLGAPPP---PPPPPLSKTPAPPPPPLSKTPVPPPPP 743 Score = 35.1 bits (77), Expect = 0.070 Identities = 32/125 (25%), Positives = 33/125 (26%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPX 762 P PP P P PPP FSP P PPPP P Sbjct: 488 PPPPLFTSTTSFSPSQPPPP---PPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSP- 543 Query: 761 GGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPX 582 P P PPP + P P P PPP P Sbjct: 544 -SQPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQP--PPPRPP 600 Query: 581 PXXPP 567 P PP Sbjct: 601 PPPPP 605 Score = 34.7 bits (76), Expect = 0.093 Identities = 33/130 (25%), Positives = 36/130 (27%), Gaps = 2/130 (1%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGX 783 P P + K PPPP PPP PP + P PPPP Sbjct: 553 PSFSNRDPLTTLHQPINKTPPPPP----PPPPPLPSRSIPPPLAQPPPPRPPPPPP---- 604 Query: 782 XXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPP--XPXXX 609 P G + P PPP PPPP P Sbjct: 605 -----PPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPP----PPPPTRIPAAK 655 Query: 608 PXXPPPXPXP 579 PPP P P Sbjct: 656 CAPPPPPPPP 665 Score = 34.7 bits (76), Expect = 0.093 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 2/60 (3%) Frame = -1 Query: 959 GXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPP--GXXPXXXPPFSPXXXPXGXPPPPXXG 786 G P PP K PPP P PPP G PP PPPP G Sbjct: 712 GAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPPLGAKGSNAPPPPPPAG 771 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -3 Query: 885 PPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPPGGGXP 748 PP PP S PP PP PPPP P P Sbjct: 574 PPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPP 619 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -3 Query: 885 PPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPPGG 757 PP PP + PP P PPP R G PP G Sbjct: 715 PPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPPLG 757 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXP 765 P PP PPPP PP P PP P PPPP G P Sbjct: 703 PLPPSSTRLGAPPPPPP------PPLSKTPAPPPP--PLSKTPVPPPPPGLGRGTSSGP 753 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/59 (27%), Positives = 16/59 (27%) Frame = -3 Query: 939 PSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPP 763 P P P PP PP S G PP PPP PP Sbjct: 602 PPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPP 660 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP K P P P P PP P PPPP Sbjct: 683 PPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPP 731 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/59 (27%), Positives = 17/59 (28%) Frame = -3 Query: 939 PSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPP 763 P P + P PP PP G PP PPPP PP Sbjct: 601 PPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPP 659 Score = 28.3 bits (60), Expect = 8.0 Identities = 19/65 (29%), Positives = 21/65 (32%), Gaps = 3/65 (4%) Frame = -3 Query: 939 PSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXP---PXXGPPPPXXRXXXXGX 769 P P + P PP PP G PP P PPPP + Sbjct: 684 PPPPPKANISNAPKPPAPPPL--PPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPP 741 Query: 768 PPGGG 754 PPG G Sbjct: 742 PPGLG 746 Score = 25.0 bits (52), Expect(2) = 8.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 100 SXPPPPPPP 126 S PPPPPPP Sbjct: 523 SQPPPPPPP 531 Score = 21.4 bits (43), Expect(2) = 8.2 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +1 Query: 61 LFRXPXSSKXXVXSXPPPPPP 123 LF S PPPPPP Sbjct: 492 LFTSTTSFSPSQPPPPPPPPP 512 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 39.5 bits (88), Expect = 0.003 Identities = 29/105 (27%), Positives = 30/105 (28%), Gaps = 3/105 (2%) Frame = -1 Query: 884 PHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXXXXXXXXXXXXX 705 P PPG PFS P PP G+ G A Sbjct: 318 PSVPLPPGQYTAVNAPFSTSTQPVSLPP--------GQYMPGNAALSASTPLTPGQFTTA 369 Query: 704 XXXXXPGAXKXXFXPXPPPX*KT---PPPPXPXXXPXXPPPXPXP 579 P P PPP PPPP P P PPP P P Sbjct: 370 NAPPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPP 414 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 3/52 (5%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXX---PHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP PPPP P PPP P PP P PPPP Sbjct: 373 PAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPP 424 Score = 34.7 bits (76), Expect = 0.093 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 3/59 (5%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXP---XXXPPFSPXXXPXGXPPPP 795 P P PP PPPP PPP P PP P G P PP Sbjct: 378 PANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPP 436 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -1 Query: 662 PXPP-PX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PP P +T PPP P PPP P P P Sbjct: 373 PAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGP 405 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PPP PPPP P PPP P PP Sbjct: 384 PPP----PPPPSAAAPPPPPPPKKGPAAPP 409 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/63 (28%), Positives = 19/63 (30%), Gaps = 4/63 (6%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPH----XXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXG 774 P P PP P + PPP PP P P PPPP G Sbjct: 360 PLTPGQFTTANAPPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGA 419 Query: 773 EXP 765 P Sbjct: 420 GPP 422 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 6/66 (9%) Frame = -3 Query: 939 PSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXG------PPPPXXRXXX 778 P P Q PP P PP PP PP G PPPP Sbjct: 376 PGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPP----PPPPPGKKGAGPPPPPPMSKKG 431 Query: 777 XGXPPG 760 PPG Sbjct: 432 PPKPPG 437 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = -1 Query: 662 PXPPPX*K--TPPPPXPXXXPXXPPPXPXPXXP 570 P PPP K PPPP P P P P P Sbjct: 410 PPPPPGKKGAGPPPPPPMSKKGPPKPPGNPKGP 442 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXG 810 P PP PPPP PPP P P P G Sbjct: 398 PPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNPKG 441 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 31.1 bits (67), Expect(2) = 0.003 Identities = 18/60 (30%), Positives = 20/60 (33%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PP + + PPP PP G P P PPPP G P GG Sbjct: 156 PPIIRPPGQMLPPPPFGGQG-PPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGG 214 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = -3 Query: 903 PPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPPGGGXP 748 PP P PP GPP PP G PP + P G P Sbjct: 156 PPIIRPPGQMLPPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRP 207 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = -3 Query: 939 PSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 P+P PP PP PP P P GPPPP Sbjct: 138 PAPGMMQPQISRPPQLSAPPIIRPPGQMLPPPPFGGQGPPMGRGPPPP 185 Score = 27.5 bits (58), Expect(2) = 0.003 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PPP PP P PPP P P PP Sbjct: 210 PPPGGMMRGPPPPPHGMQGPPP-PRPGMPP 238 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 31.1 bits (67), Expect(2) = 0.003 Identities = 18/60 (30%), Positives = 20/60 (33%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PP + + PPP PP G P P PPPP G P GG Sbjct: 156 PPIIRPPGQMLPPPPFGGQG-PPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGG 214 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = -3 Query: 903 PPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPPGGGXP 748 PP P PP GPP PP G PP + P G P Sbjct: 156 PPIIRPPGQMLPPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRP 207 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = -3 Query: 939 PSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 P+P PP PP PP P P GPPPP Sbjct: 138 PAPGMMQPQISRPPQLSAPPIIRPPGQMLPPPPFGGQGPPMGRGPPPP 185 Score = 27.5 bits (58), Expect(2) = 0.003 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PPP PP P PPP P P PP Sbjct: 210 PPPGGMMRGPPPPPHGMQGPPP-PRPGMPP 238 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PPP +PPPP P P PPP P P PP Sbjct: 65 PPPPPTSPPPPSPPP-PSPPPPSPPPPSPP 93 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPPF 564 P PPP PP P P P PP P P P F Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSPPPPAF 97 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXG 810 P PP PPPP P PPP P P F+ P G Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSPPP---PAFAVGKTPEG 105 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXG 759 PPPP PP P PP SP P PP G+ P G Sbjct: 64 PPPP-------PPTSPPPPSPPPPSPPPPSPPPPSPPPPAFAVGKTPEG 105 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 39.1 bits (87), Expect = 0.004 Identities = 32/126 (25%), Positives = 35/126 (27%), Gaps = 3/126 (2%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXP-PPPXXGXXXGEXPXG 759 PP PPPP PPP PP+ P P PPP P Sbjct: 484 PPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVV 543 Query: 758 GXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXP--XXPPPXP 585 A P + P P +PPPP P P PP P Sbjct: 544 YYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYP---PVTNSPPPPSPVYYPPVTYSPPPP 600 Query: 584 XPXXPP 567 P P Sbjct: 601 SPVYYP 606 Score = 38.7 bits (86), Expect = 0.006 Identities = 29/122 (23%), Positives = 31/122 (25%), Gaps = 3/122 (2%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPP-PGXXPXXXPPFSPXXXPXGXPPPP--XXGXXXGEXP 765 PP PPPP PP P PP P P PPPP P Sbjct: 494 PPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPP 553 Query: 764 XGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXP 585 + PP +PPPP P P P P Sbjct: 554 PPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPP 613 Query: 584 XP 579 P Sbjct: 614 PP 615 Score = 38.3 bits (85), Expect = 0.008 Identities = 30/127 (23%), Positives = 33/127 (25%), Gaps = 3/127 (2%) Frame = -1 Query: 941 PXPPXXKXXXKX---PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGE 771 P PP K PPP P PP+S PPP Sbjct: 408 PPPPSSKMSPTVRAYSPPPPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPPSPSPP 467 Query: 770 XPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPP 591 P + P P PP +PPPP P PPP Sbjct: 468 PPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPP 527 Query: 590 XPXPXXP 570 P P P Sbjct: 528 SPPPPCP 534 Score = 36.3 bits (80), Expect = 0.030 Identities = 30/125 (24%), Positives = 34/125 (27%), Gaps = 2/125 (1%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PP PPPP PPP PP+ PPPP P Sbjct: 475 PPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYV-----YSSPPPPYVYSSPPPPPPSP 529 Query: 755 XAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXP--XXPPPXPX 582 P + P P ++PPPP P P PP P Sbjct: 530 PPPCPESSPPPPVVYYAPVTQSPPPPSPVYYP---PVTQSPPPPSPVYYPPVTNSPPPPS 586 Query: 581 PXXPP 567 P P Sbjct: 587 PVYYP 591 Score = 33.9 bits (74), Expect = 0.16 Identities = 34/133 (25%), Positives = 35/133 (26%), Gaps = 12/133 (9%) Frame = -1 Query: 941 PXPPXXKXXXKXPPP--PXXXPHXXPPP-----GXXPXXXPPFSPXXXPX--GXPPPPXX 789 P PP PPP P P PPP PP SP P PPPP Sbjct: 513 PPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSP 572 Query: 788 GXXXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXP---PPX*KTPPPPXP 618 P P P PP +PPPP P Sbjct: 573 VYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSP 632 Query: 617 XXXPXXPPPXPXP 579 P P P P Sbjct: 633 VYYPPVTPSPPPP 645 Score = 33.9 bits (74), Expect = 0.16 Identities = 33/133 (24%), Positives = 35/133 (26%), Gaps = 5/133 (3%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPX--GXPPPPXX 789 P + P PP PP P PP P PP SP P PPPP Sbjct: 531 PPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSP---PPPSPVYYPPVTNSPPPPSP 587 Query: 788 GXXXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXP---PPX*KTPPPPXP 618 P P P PP +PPPP P Sbjct: 588 VYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSP 647 Query: 617 XXXPXXPPPXPXP 579 P P P P Sbjct: 648 VYYPPVTPSPPPP 660 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPPF 564 P PPP +PPPP P P P PP+ Sbjct: 457 PPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPY 489 Score = 31.5 bits (68), Expect = 0.86 Identities = 30/125 (24%), Positives = 33/125 (26%), Gaps = 4/125 (3%) Frame = -1 Query: 941 PXPPXXKXXXKX----PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXG 774 P PP K PPPP P+ P PP P PPP Sbjct: 425 PPPPSSKMSPSVRAYSPPPP---PYSKMSPSVRAYPPPP------PPSPSPPPPYVYSSP 475 Query: 773 EXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPP 594 P + P P PP +PPPP P P P Sbjct: 476 PPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPE 535 Query: 593 PXPXP 579 P P Sbjct: 536 SSPPP 540 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 936 SPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 SP PP PP PP S PP P PPPP Sbjct: 512 SPPPPYVYSSPPPPPPSPP---PPCPESSPPPPVVYYAPVTQSPPPP 555 Score = 28.7 bits (61), Expect = 6.1 Identities = 25/125 (20%), Positives = 29/125 (23%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPX 762 P P PPP + P P P + P P PP P + P Sbjct: 614 PPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPP 673 Query: 761 GGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPX 582 P A P +PPPP P P Sbjct: 674 PPTEYYYSPSQSPPPTKACKEGHPPQATPSYEPPPEYSYSSSPPPPSPTSYFPPMPSVSY 733 Query: 581 PXXPP 567 PP Sbjct: 734 DASPP 738 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = -2 Query: 400 PPKXPPXPPP*QKXXFXPPPFFXXXPP 320 PP P PPP PPP+ PP Sbjct: 459 PPPPSPSPPPPYVYSSPPPPYVYSSPP 485 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPP-PXPXPXXPPF 564 P PP +PPPP P PP P PP+ Sbjct: 466 PPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPY 499 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 38.7 bits (86), Expect = 0.006 Identities = 22/67 (32%), Positives = 25/67 (37%), Gaps = 5/67 (7%) Frame = -3 Query: 939 PSPXXQXXXQXXPPXXXXPPXXXPPXXX---SXGGPPXFXXXPPXXGPPPP--XXRXXXX 775 P+P PP PP PP G PP + PP GPPPP + Sbjct: 139 PAPGMMQPQISRPPQIIRPPGQMPPQPPFAGQGGPPPPYGMRPPYPGPPPPQYGGQQRPM 198 Query: 774 GXPPGGG 754 PP GG Sbjct: 199 MIPPPGG 205 Score = 35.1 bits (77), Expect = 0.070 Identities = 23/73 (31%), Positives = 23/73 (31%), Gaps = 7/73 (9%) Frame = -3 Query: 939 PSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPP---XXGPPPPXXR----XX 781 P P PP PP PP G PP GPPPP Sbjct: 163 PQPPFAGQGGPPPPYGMRPPYPGPPPPQYGGQQRPMMIPPPGGMMRGPPPPHGMQGPPPS 222 Query: 780 XXGXPPGGGXPXF 742 G PP GG P F Sbjct: 223 RPGMPPPGGAPMF 235 Score = 29.1 bits (62), Expect = 4.6 Identities = 26/106 (24%), Positives = 27/106 (25%), Gaps = 4/106 (3%) Frame = -1 Query: 872 PPPGXX-PXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXXXXXXXXXXXXXXXX 696 P PG P P P PP P G P G Sbjct: 139 PAPGMMQPQISRPPQIIRPPGQMPPQPPFAGQGGPPPPYGMRPPYPGPPPPQYGGQQRPM 198 Query: 695 XXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPP---XPXPXXPP 567 P P PP + PPP P P P P P PP Sbjct: 199 MIPPPGGMMRGPPPPHGMQGPPPSRPGMPPPGGAPMFAPPHPGMPP 244 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 38.7 bits (86), Expect = 0.006 Identities = 32/114 (28%), Positives = 33/114 (28%), Gaps = 2/114 (1%) Frame = -1 Query: 905 PPP--PXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXXXX 732 PPP P P PPP PP P PPP P A Sbjct: 35 PPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITS---PPPTVASSPPPP 91 Query: 731 XXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 P A P PPP +P PP P PPP P P P Sbjct: 92 VVIASPPPSTPATTPPAPPQTVSPPPPPD-ASPSPPAP--TTTNPPPKPSPSPP 142 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PP +PPP P P PP P PP Sbjct: 88 PPPPVVIASPPPSTPATTPPAPPQTVSPPPPP 119 Score = 30.3 bits (65), Expect = 2.0 Identities = 25/112 (22%), Positives = 27/112 (24%) Frame = -1 Query: 902 PPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXXXXXXX 723 PPP P PP P SP PPP P + Sbjct: 64 PPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASP 123 Query: 722 XXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P P P +TP PP P P P PP Sbjct: 124 SPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPP 175 Score = 29.9 bits (64), Expect = 2.6 Identities = 29/129 (22%), Positives = 30/129 (23%), Gaps = 4/129 (3%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPF----SPXXXPXGXPPPPXXGXXXG 774 P P PPP PPP PP P P PP P Sbjct: 57 PPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPP 116 Query: 773 EXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPP 594 P A PG P P +P P P PP Sbjct: 117 PPPD---ASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPP 173 Query: 593 PXPXPXXPP 567 P PP Sbjct: 174 PPATSASPP 182 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -3 Query: 885 PPXXXPPXXXSXGGPPXFXXXPPXXGPPP 799 PP PP S PP PP PPP Sbjct: 44 PPQSPPPVVSSSPPPPVVSSPPPSSSPPP 72 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = -1 Query: 440 TPXXXPFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 T P PP PP P P PPP+ PP Sbjct: 27 TQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPP 66 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 38.7 bits (86), Expect = 0.006 Identities = 33/110 (30%), Positives = 33/110 (30%), Gaps = 3/110 (2%) Frame = +1 Query: 586 GXGGGXXGXXXGXGGGGVFXXG---GGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKXGAX 756 G GGG G G GGGG GG G N G K G Sbjct: 314 GGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGG 373 Query: 757 PPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG 906 P GGGG G GG G P G G GGGG Sbjct: 374 VQMNGGPNGGKKGGGGGGGGG------GGPMSGGLPPGFRPMGGGGGGGG 417 Score = 35.5 bits (78), Expect = 0.053 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = +1 Query: 775 PXXXPXXGGGGXPXGXXXGEXGGXXX--GXXPGGGXXWGXXXGGGGXLXXXLXXGGXG 942 P GGGG P G G GG GGG G GGG L + GG G Sbjct: 307 PFPVQMGGGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGG 364 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = +1 Query: 568 GGXXGXGXGGGXX----GXXXGXGGGGVFXXGGGXG 663 GG G G GGG G G GGGG GGG G Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGGXG 942 GGGG P G GG G GGG GG GG G Sbjct: 348 GGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGG 396 Score = 28.7 bits (61), Expect = 6.1 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGG 936 GGGG G GG G GG G GGGG GG Sbjct: 327 GGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGG 373 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 38.3 bits (85), Expect = 0.008 Identities = 29/118 (24%), Positives = 30/118 (25%), Gaps = 6/118 (5%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXX----PXXXPPFSPXXXPXGXPPP--PXXGXXXGEXPXGGXAXX 744 P PP P PP P PP SP G PP P G P Sbjct: 456 PSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPS 515 Query: 743 XXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 P P PP +P P P P P P P P Sbjct: 516 PGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISP 573 Score = 37.1 bits (82), Expect = 0.017 Identities = 29/106 (27%), Positives = 30/106 (28%), Gaps = 4/106 (3%) Frame = -1 Query: 872 PPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXXXXXXXXXXXXXXXXX 693 P PG P P SP P P PP G P Sbjct: 514 PSPGGSPPS-PSISPSP-PITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPI 571 Query: 692 XPGAXKXXFXPXPPPX*KTPP----PPXPXXXPXXPPPXPXPXXPP 567 PG P PP +PP PP P P P P P PP Sbjct: 572 SPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPP 617 Score = 35.5 bits (78), Expect = 0.053 Identities = 32/131 (24%), Positives = 34/131 (25%), Gaps = 5/131 (3%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPX 762 P PP PPP + PPP P PP PPP P Sbjct: 713 PQPPPPPHY-SLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPP 771 Query: 761 GGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXP- 585 A P + P PPP PP P PP P Sbjct: 772 PSPAHYSPPPSPPVYYYNSP----PPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPPIPG 827 Query: 584 ----XPXXPPF 564 P PPF Sbjct: 828 ISYASPPPPPF 838 Score = 32.3 bits (70), Expect = 0.49 Identities = 26/106 (24%), Positives = 28/106 (26%), Gaps = 1/106 (0%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXX-PPFSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXXXXX 729 PPPP + P P P PP +P PPPP P Sbjct: 702 PPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPP---TPIHSPPPQSHPPCIEYSP 758 Query: 728 XXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPP 591 P P PP PPP P PPP Sbjct: 759 PPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPP 804 Score = 30.3 bits (65), Expect = 2.0 Identities = 28/130 (21%), Positives = 29/130 (22%), Gaps = 5/130 (3%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPX 762 P PP PP P P P P P P PP G P Sbjct: 411 PSPPTTPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPT 470 Query: 761 GGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPP-----PPXPXXXPXXP 597 P + PP T P PP P P P Sbjct: 471 SPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPP 530 Query: 596 PPXPXPXXPP 567 P P P Sbjct: 531 ITVPSPPSTP 540 Score = 29.5 bits (63), Expect = 3.5 Identities = 18/66 (27%), Positives = 19/66 (28%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGX 783 P P P PPPP + PPP PP P P PP G Sbjct: 772 PSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPPIYE---GPLPPIPGI 828 Query: 782 XXGEXP 765 P Sbjct: 829 SYASPP 834 Score = 25.0 bits (52), Expect(2) = 1.4 Identities = 18/62 (29%), Positives = 18/62 (29%), Gaps = 3/62 (4%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXP--PFSP-XXXPXGXPPPPXXGXXXGE 771 P PP PP P P P P P SP P P PP G Sbjct: 534 PSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPS 593 Query: 770 XP 765 P Sbjct: 594 SP 595 Score = 24.2 bits (50), Expect(2) = 1.4 Identities = 12/29 (41%), Positives = 12/29 (41%), Gaps = 1/29 (3%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPP-XPXP 579 P PP P PP P PPP P P Sbjct: 595 PSPPLPPVIPSPPIVGPTPSSPPPSTPTP 623 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 668 FXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 F P PPP PPPP PPP P P PP Sbjct: 40 FLPHPPPPPPPPPPPLYFSYFSLPPPPPPPHLPP 73 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 37.9 bits (84), Expect = 0.010 Identities = 36/134 (26%), Positives = 39/134 (29%), Gaps = 10/134 (7%) Frame = -1 Query: 941 PXPPXXKXXXKXP---PPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP---XXGXX 780 P PP P PPP H PPP P +S P PPPP Sbjct: 52 PPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPP 111 Query: 779 XGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXP----XPPPX*KTPPPPXPXX 612 + P P K P PPP K+PPPP Sbjct: 112 PVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYH 171 Query: 611 XPXXPPPXPXPXXP 570 P PPP P P Sbjct: 172 SP--PPPVKSPPPP 183 Score = 35.5 bits (78), Expect = 0.053 Identities = 31/116 (26%), Positives = 35/116 (30%) Frame = -1 Query: 911 KXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXXXX 732 K PPPP H PPP P + P PPPP P Sbjct: 98 KSPPPPYYY-HSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYY----HSPPPPVKSPPPPY 152 Query: 731 XXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPPF 564 P + PPP K+PPPP P PPP P P + Sbjct: 153 YYHSPPPPVKSPPPP-----YYYHSPPPPVKSPPPPYLYSSP--PPPVKSPPPPVY 201 Score = 33.1 bits (72), Expect = 0.28 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 3/52 (5%) Frame = -1 Query: 941 PXPPXXKXXXKXP---PPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP P PPP H PPP P +S P PPPP Sbjct: 148 PPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPPPVKSPPPP 199 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 PPP K+PPPP P PPP P P Sbjct: 45 PPPPVKSPPPPYEYKSP--PPPVKSPPPP 71 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = -1 Query: 662 PXPPPX*KTPPPP---XPXXXPXXPPPXPXPXXPP 567 P PP K+PPPP P PP P PP Sbjct: 36 PPPPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPP 70 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXP---XXPPPXPXPXXPP 567 P PP K+PPPP P PP P PP Sbjct: 52 PPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPP 86 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 37.9 bits (84), Expect = 0.010 Identities = 36/147 (24%), Positives = 41/147 (27%), Gaps = 15/147 (10%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPP-----PXXXPHXXPPPGXXPXXXPP----FSPXXXPXG 810 P P PP + PPP P + PPP P PP +S P Sbjct: 495 PSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSP 554 Query: 809 XPPPP---XXGXXXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*K 639 PPPP P + P + P PP Sbjct: 555 SPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYA 614 Query: 638 T---PPPPXPXXXPXXPPPXPXPXXPP 567 T PPPP P PP P P P Sbjct: 615 TQSPPPPPPPTYYAVQSPPPPPPVYYP 641 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -1 Query: 653 PPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 PP K+PPPP P P P P P Sbjct: 727 PPVAKSPPPPSPVYYPPVTQSPPPPSTP 754 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/59 (30%), Positives = 19/59 (32%) Frame = -3 Query: 939 PSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPP 763 P P Q PP PP PP S PP + PPPP PP Sbjct: 621 PPPPTYYAVQSPPPP---PPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPP 676 Score = 29.5 bits (63), Expect = 3.5 Identities = 31/133 (23%), Positives = 34/133 (25%), Gaps = 8/133 (6%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXP-----XXXPPFSPXXXP---XGXPPPPXXG 786 P PP + PPPP PPP P PP P P PPPP Sbjct: 596 PSPPYYQYTSS-PPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYY 654 Query: 785 XXXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXP 606 + P + PP PPPP Sbjct: 655 TPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPV 714 Query: 605 XXPPPXPXPXXPP 567 PP P P P Sbjct: 715 TQSPPPPSPVYYP 727 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 939 PSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 PSP PP PP PP S PP P PPPP Sbjct: 538 PSPPPPYIYSSPPPPSPSPP---PPYIYS-SPPPVVNCPPTTQSPPPP 581 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = -2 Query: 940 PXPPXXXXXPXXPPXPXXXPTXXPPXAXFPRXXPXFXXXPXRXGXPPP 797 P PP P P P PP A P P PPP Sbjct: 704 PPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPP 751 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/48 (27%), Positives = 15/48 (31%) Frame = -2 Query: 940 PXPPXXXXXPXXPPXPXXXPTXXPPXAXFPRXXPXFXXXPXRXGXPPP 797 P PP P P P PP P P + + PPP Sbjct: 661 PPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPP 708 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 G G G GGG G G GGGG + GGG G Sbjct: 583 GRGGYGGGGGGYGGGGGYGGGGGYGGGGGYG 613 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G GGG G G GGGG + GGG G Sbjct: 588 GGGGGGYGGGGGYGGGGGYGGGGGY--GGGYG 617 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG 906 GGGG G G GG G GGG G GG Sbjct: 590 GGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYGG 626 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGG 903 GGGG G G GG G G G +G GG Sbjct: 588 GGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGG 623 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 37.1 bits (82), Expect = 0.017 Identities = 38/139 (27%), Positives = 40/139 (28%), Gaps = 7/139 (5%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPH---XXPPPGXXPXXXPPFSPXXXPXGXPPPPX 792 P K P PP K PPP PH PPP P PP P PPP Sbjct: 69 PPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYP---PPIKKYPPPEQYPPPIK 125 Query: 791 XGXXXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXP---XPPPX*KTPPP-P 624 + P K + P PPP K PPP Sbjct: 126 KYPPPEQYSPPFKKYPPPEQYPPPIKKYPPPEHYPPPIK-KYPPQEQYPPPIKKYPPPEK 184 Query: 623 XPXXXPXXPPPXPXPXXPP 567 P PPP P PP Sbjct: 185 YPPPIKKYPPPEQYP--PP 201 Score = 32.3 bits (70), Expect = 0.49 Identities = 21/61 (34%), Positives = 22/61 (36%), Gaps = 5/61 (8%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXX--KXPPPPXXXPHXX---PPPGXXPXXXPPFSPXXXPXGXPPP 798 P K P PP K + PPP PH PPP PP P PPP Sbjct: 199 PPPIKKYP-PPIKKYPPPEEYPPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPPP 257 Query: 797 P 795 P Sbjct: 258 P 258 Score = 31.5 bits (68), Expect = 0.86 Identities = 34/139 (24%), Positives = 35/139 (25%), Gaps = 7/139 (5%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGX 783 P K P K PPPP P PP PP P PPP Sbjct: 57 PPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVK-YPPPEQYPPPIKKYP 115 Query: 782 XXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXP--XPPPX*KTP-----PPP 624 + P P K P PPP K P PPP Sbjct: 116 PPEQYPPPIKKYPPPEQYSPPFKKYPPPEQYPPPIKKYPPPEHYPPPIKKYPPQEQYPPP 175 Query: 623 XPXXXPXXPPPXPXPXXPP 567 P P P PP Sbjct: 176 IKKYPPPEKYPPPIKKYPP 194 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 37.1 bits (82), Expect = 0.017 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXN 669 GG G G GG G G GGGG GGG G N Sbjct: 112 GGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHGLN 145 Score = 34.3 bits (75), Expect = 0.12 Identities = 31/109 (28%), Positives = 31/109 (28%) Frame = +1 Query: 580 GXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKXGAXP 759 G G G G G G GG G GG G G G Sbjct: 42 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGG 101 Query: 760 PXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG 906 G GGGG G G GG G GG G GGGG Sbjct: 102 HYG---------GGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGG 141 Score = 31.9 bits (69), Expect = 0.65 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGGXG 942 GGGG G G GG G GGG +G GG G GG G Sbjct: 97 GGGGGHYGGGGGHYGGGGGGH--GGGGHYGGGGGGYGGGGGHHGGGGHG 143 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G GGG G G GGG GGG G Sbjct: 98 GGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGG 129 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +1 Query: 568 GGXXGXGXGGG-XXGXXXGXGGGGVFXXGGGXG 663 GG G G GGG G G GG G+ GGG G Sbjct: 48 GGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGG 80 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 G G G GGG G G GGG GGG G Sbjct: 71 GLDGYGGGGGHYGGGGGHYGGGGGHYGGGGG 101 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGG 657 GG G G GG G G GGGG + GGG Sbjct: 107 GGHYGGGGGGHGGGGHYGGGGGG-YGGGGG 135 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGGXG 942 GGGG G G GG G GGG +G GGGG GG G Sbjct: 83 GGGGGHYGGGGGHYGG-GGGHYGGGGGHYG--GGGGGHGGGGHYGGGGG 128 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G GGG G G GGG GGG G Sbjct: 77 GGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGG 108 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G GGG G G GGG GGG G Sbjct: 84 GGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGG 115 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = +1 Query: 568 GGXXGXGX--GGGXXGXXXGXGGGGVFXXGGG 657 GG G G GGG G GGGG + GGG Sbjct: 56 GGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGG 87 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +1 Query: 568 GGXXGXGXGG-GXXGXXXGXGGGGVFXXGGGXGXNXXFXAPG 690 GG G G G G G G GGG GGG G + G Sbjct: 86 GGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGG 127 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVF-XXGGGXG 663 GG G GG G G GGGG + GGG G Sbjct: 99 GGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYG 131 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 31.5 bits (68), Expect(2) = 0.021 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = -1 Query: 902 PPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXP--PPPXXGXXXGEXP 765 PPP P PPP PP+ P P PPP G P Sbjct: 306 PPPTIQPPYQPPPPTQSLHQPPYQPPPQQPQYPQQPPPQLQHPSGYNP 353 Score = 24.2 bits (50), Expect(2) = 0.021 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXP 579 PP ++ PP P P PPP P Sbjct: 356 PPYPQQSYPPNPPRQPPSHPPPGSAP 381 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 30.3 bits (65), Expect(2) = 0.028 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = +1 Query: 766 GXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGG 936 G P GGGG P G GG G GG GGGG + GG Sbjct: 295 GGHPQDGKNGGGGGGPNAGKKGNGGG---GPMAGGVSGGFRPMGGGGPQNMSMPMGG 348 Score = 29.9 bits (64), Expect = 2.6 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +1 Query: 787 PXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGGXG 942 P GGGG G G GG G PG G GGGG GG G Sbjct: 261 PAAGGGGA--GGGKGAGGGAKGG--PGNQNQGGGKNGGGGHPQDGKNGGGGG 308 Score = 25.0 bits (52), Expect(2) = 0.028 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGG 657 G G G GGG G GG GGG Sbjct: 267 GAGGGKGAGGGAKGGPGNQNQGGGKNGGGG 296 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 36.3 bits (80), Expect = 0.030 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PP PPPP P PPG P + P G PP P G GG Sbjct: 28 PPAGYPQQGYPPPPGAYPPAGYPPGAYPPAPGGYPPAPGYGGYPPAPGYGGYPPAPGHGG 87 Score = 35.1 bits (77), Expect = 0.070 Identities = 19/70 (27%), Positives = 21/70 (30%) Frame = -2 Query: 958 GXXXXGPXPPXXXXXPXXPPXPXXXPTXXPPXAXFPRXXPXFXXXPXRXGXPPPHXQGXX 779 G G PP PP P P P +P + P G PP G Sbjct: 20 GYPPPGAYPPAGYPQQGYPPPPGAYPPAGYPPGAYPPAPGGYPPAPGYGGYPPAPGYGGY 79 Query: 778 XGXPPXGGXP 749 P GG P Sbjct: 80 PPAPGHGGYP 89 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -3 Query: 903 PPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPPGGG 754 PP PP PP G P P G PP G PP G Sbjct: 17 PPAGYPPPGAYPPAGYPQQGYPPPPGAYPPAGYPPGAYPPAPGGYPPAPG 66 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 36.3 bits (80), Expect = 0.030 Identities = 20/50 (40%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -1 Query: 941 PXP-PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P P P + PPPP PPP P PP SP P PPPP Sbjct: 50 PAPSPEPEDYLPLPPPP-----QTPPPPPPPQSLPPPSPSPEPEHYPPPP 94 Score = 35.1 bits (77), Expect = 0.070 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -1 Query: 689 PGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P + P PPP PPPP P P P P P P P Sbjct: 52 PSPEPEDYLPLPPPPQTPPPPPPPQSLP-PPSPSPEPEHYP 91 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P P P PPP P PPP P P PP Sbjct: 83 PSPEPEHYPPPPYHHYITPSPPPPRPLPPPPP 114 Score = 32.3 bits (70), Expect = 0.49 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = -3 Query: 942 APSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPP 763 APSP + PP PP PP S PP P PPPP PP Sbjct: 51 APSPEPEDYLPLPPPPQTPPP---PPPPQSL--PPPSPSPEPEHYPPPPYHHYITPSPPP 105 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PPP PPPP P P P P PP Sbjct: 64 PPPQTPPPPPPPQSLPPPSPSPEPEHYPPP 93 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PP PP P P PPP P P P PPPP Sbjct: 70 PPPPPPQSLPPPSPSPEPEHYPPP-PYHHYITPSPPPPRPLPPPPPP 115 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXP 585 P PPP ++ PPP P P PP P Sbjct: 69 PPPPPPPQSLPPPSPSPEPEHYPPPP 94 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = -1 Query: 425 PFFXPPXXPPKKXPXPXPLTKXXFXPPPLF----XPXPP 321 P PP PP+ P P P + PPP + P PP Sbjct: 66 PQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPP 104 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 11/43 (25%) Frame = -1 Query: 662 PXPPPX*KTPPP---PXPXXXPXXP--------PPXPXPXXPP 567 P PPP PPP P P P P PP P P PP Sbjct: 70 PPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPP 112 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPP 864 P PP PPPP P PPP Sbjct: 91 PPPPYHHYITPSPPPPRPLPPPPPPP 116 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 35.9 bits (79), Expect = 0.040 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PPP P PP P PPP P P PP Sbjct: 708 PPPPPAPPAPPTPIVHTSSPPPPPPPPPPP 737 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXG 786 P P K PPPP P P P PP P P P P G Sbjct: 695 PPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNG 746 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXX-PXXPPPXPXPXXPP 567 P PPP PP P P PPP P P PP Sbjct: 708 PPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPP 740 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP H PP PP P PPPP Sbjct: 758 PAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPP 794 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PPP PP PPP P P PP Sbjct: 687 PRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPP 718 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP PPP PP PP P P PP P Sbjct: 694 PPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTP 742 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -1 Query: 413 PPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 PP PP P P+ PPP P PP Sbjct: 707 PPPPPPAPPAPPTPIVHTSSPPPPPPPPPPP 737 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 4/56 (7%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXP----HXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXG 786 P PP PP P PP P P S P PPPP G Sbjct: 727 PPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPPPLG 782 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 35.9 bits (79), Expect = 0.040 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP PPPP P PPP P P P PPPP Sbjct: 12 PQPPSQNSLAPPPPPPSLPPPVPPPP-------PSHQPYSYPPPPPPPP 53 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXP----XXXPPFSPXXXPXGXPPPP 795 P PP PPPP P+ PPP P P P PPPP Sbjct: 23 PPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPPPP 75 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -3 Query: 885 PPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPP 763 PP PP S PP PP PPPP + PP Sbjct: 9 PPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPP 49 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -1 Query: 662 PXPPPX*KTP-PPPXPXXXPXXPPPXPXPXXPP 567 P PPP P PPP P P PP P P PP Sbjct: 23 PPPPPSLPPPVPPPPPSHQPYSYPPPPPP--PP 53 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPP 798 P P PP PPPP PH G P F+ P PPP Sbjct: 27 PSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQG---PHYPQFNQLQAPPPPPPP 78 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = -1 Query: 662 PXPPPX*K-TPPPPXPXXXPXXPPPXP 585 P PP PPPP P P PPP P Sbjct: 12 PQPPSQNSLAPPPPPPSLPPPVPPPPP 38 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -2 Query: 412 PXXFPPKXPPXPPP*QKXXFXPPP 341 P PP PP PP Q + PPP Sbjct: 26 PPSLPPPVPPPPPSHQPYSYPPPP 49 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPP-PXPXPXXPP 567 PPP + PPP P P P P P PP Sbjct: 22 PPPPPPSLPPPVPPPPPSHQPYSYPPPPPPP 52 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 35.9 bits (79), Expect = 0.040 Identities = 29/125 (23%), Positives = 30/125 (24%), Gaps = 2/125 (1%) Frame = -1 Query: 935 PPXXKXXXKXPPP--PXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPX 762 PP PPP P P PP PP PPPP P Sbjct: 37 PPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPP----PLDSSPPPPPDLTPPPSSPPP 92 Query: 761 GGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPX 582 F P PPP + PP P PPP Sbjct: 93 PDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPPEQLPPPASS 152 Query: 581 PXXPP 567 P P Sbjct: 153 PQGGP 157 Score = 34.3 bits (75), Expect = 0.12 Identities = 31/127 (24%), Positives = 32/127 (25%), Gaps = 2/127 (1%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPX 762 P P PPP P PP P PP P P PPP P Sbjct: 18 PPPDTSSDGSAAPPPTDSAPPPSPPADSSP---PPALPSLPPAVFSPPPTVS---SPPPP 71 Query: 761 GGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXP--XPPPX*KTPPPPXPXXXPXXPPPX 588 + P F P PP T PP P PPP Sbjct: 72 PLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPA 131 Query: 587 PXPXXPP 567 PP Sbjct: 132 DEDESPP 138 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXP--PFSPXXXPXGXPPPP 795 P PP + PPP P PPP P P P P PP P Sbjct: 127 PPPPADEDESPPAPPP---PEQLPPPASSPQGGPKKPKKHHPGPATSPPAP 174 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGG 657 GG G G GGG G G GGGG GGG Sbjct: 153 GGGGGYGGGGGYGGGGGGYGGGGRGGGGGG 182 Score = 35.1 bits (77), Expect = 0.070 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 G G G GGG G G GGGG GGG G Sbjct: 147 GGGGYGGGGGGYGGGGGYGGGGGGYGGGGRG 177 Score = 34.7 bits (76), Expect = 0.093 Identities = 30/104 (28%), Positives = 31/104 (29%) Frame = +1 Query: 592 GGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKXGAXPPXGX 771 GGG G G GGG GGG G + G K G G Sbjct: 87 GGGSSGGRGGFGGG----RGGGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEP---GH 139 Query: 772 SPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGG 903 GGG G G GG G GG G GGG Sbjct: 140 MARDCSEGGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGGG 183 Score = 33.1 bits (72), Expect = 0.28 Identities = 34/120 (28%), Positives = 36/120 (30%), Gaps = 1/120 (0%) Frame = +1 Query: 544 APXXXXXXGGXXGXGXGGGXXGXXXGXG-GGGVFXXGGGXGXNXXFXAPGXXXXXXXXXX 720 AP GG G G GG G G G GGG GGG G G Sbjct: 80 APVQGNSGGGSSG-GRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPG 138 Query: 721 XXXXXVXKXGAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGG 900 + G G GGGG G G GG G GGG + G Sbjct: 139 HMARDCSEGGG----GYGGGGGGYGGGGG--YGGGGGGYGGGGRGGGGGGGSCYSCGESG 192 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 760 PXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG 906 P G G G G G GG G GGG GGGG Sbjct: 77 PDGAPVQGNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGG 125 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 35.1 bits (77), Expect = 0.070 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP PPPP PP P PP P P PPP Sbjct: 55 PPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPP 103 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPP--XXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP + PPPP P PPP P PP P P PPP Sbjct: 42 PPPPPYRSPVTIPPPPPVYSRPVAFPPP--PPIYSPPPPPIYPPPIYSPPP 90 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = -3 Query: 939 PSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPP 763 P P PP P PP PP PP PPPP PP Sbjct: 44 PPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPP 102 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = -1 Query: 662 PXPPPX*KTPPP---PXPXXXPXXPPPXPXPXXPP 567 P PPP PPP P P P PP P P P Sbjct: 67 PPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSP 101 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -3 Query: 903 PPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPP 763 PP P PP P F PP PPPP PP Sbjct: 43 PPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPP 89 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPP 801 P PP PPPP P PP P +SP P PP Sbjct: 67 PPPPPI---YSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISPPP 110 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PP +PPPP P P P P P PP Sbjct: 79 PIYPPPIYSPPPP-PIYPPPIYSPPPTPISPP 109 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/40 (32%), Positives = 16/40 (40%) Frame = -2 Query: 439 PXAXXLFXLPXXFPPKXPPXPPP*QKXXFXPPPFFXXXPP 320 P ++ P FPP P PP PPP + PP Sbjct: 54 PPPPPVYSRPVAFPPPPPIYSPP--PPPIYPPPIYSPPPP 91 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 PPP PPPP PPP P P Sbjct: 82 PPPIYSPPPPPIYPPPIYSPPPTPISPPP 110 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 35.1 bits (77), Expect = 0.070 Identities = 29/118 (24%), Positives = 33/118 (27%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGX 753 P K K PPPP PPP P + PPPP P Sbjct: 167 PSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVEYK-------SPPPPYVYSFPPPPPYYSP 219 Query: 752 AXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXP 579 + P + P P K+PPPP P PP P P Sbjct: 220 SPKVGYKSPPAPYVYSSPPPPP-----YYSPSPKVNYKSPPPPYVYSSPPPPPYSPSP 272 Score = 31.1 bits (67), Expect = 1.1 Identities = 28/118 (23%), Positives = 31/118 (26%), Gaps = 2/118 (1%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXP--XGXPPPPXXGXXXGEX 768 P P K K PPPP PP P + P PPPP Sbjct: 267 PYSPSPKVEFKSPPPPYIYNSPPPPSYYSPSPKIDYKSPPPPYVYSSPPPP---TYYSPS 323 Query: 767 PXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPP 594 P P + P P K+PPPP P PP Sbjct: 324 PRVDYKSPPPPYVYNSLPPPYVYNSPP--PPPYYSPSPTVNYKSPPPPYVYNSPPPPP 379 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPP-GXXPXXXPPFSPXXXPXGXPPPP 795 P K K PPPP PPP P P PPPP Sbjct: 245 PSPKVNYKSPPPPYVYSSPPPPPYSPSPKVEFKSPPPPYIYNSPPPP 291 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/48 (31%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXP--XGXPPPP 795 P K PPPP PPP P + P PPPP Sbjct: 357 PSPTVNYKSPPPPYVYNSPPPPPYYSPFPKVEYKSPPPPYIYNSPPPP 404 >At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226 DnaJ domain Length = 580 Score = 35.1 bits (77), Expect = 0.070 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGG 657 GG G GGG G GGGG+F GGG Sbjct: 24 GGGGGGHGGGGHGRGGHGRGGGGIFFFGGG 53 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 35.1 bits (77), Expect = 0.070 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +1 Query: 802 GGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGGXG 942 GG G G GG G GGG WG GGG GG G Sbjct: 35 GGAGGGEWGGAEGGGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGGGG 81 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGG--GVFXXGGGXGXNXXF 678 GG G G GGG G GGG G GGG G F Sbjct: 48 GGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGGGGRRGWF 86 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 799 GGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG 906 GGG G G GG G GGG G GGGG Sbjct: 47 GGGAWGGGGGG--GGAWGGEGEGGGEWGGGGEGGGG 80 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 35.1 bits (77), Expect = 0.070 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = -1 Query: 656 PPPX*KTPPP--PXPXXXPXXPPPXPXPXXPP 567 PPP + PPP P P P PPP P P P Sbjct: 82 PPPLPRLPPPLLPPPEEPPREPPPPPPPPEEP 113 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PPP PPP P P PPP P PP Sbjct: 89 PPPL--LPPPEEPPREPPPPPPPPEEPPPP 116 Score = 32.3 bits (70), Expect = 0.49 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 5/54 (9%) Frame = -1 Query: 941 PXPPXXKXXXKXPP--PPXXXPHXXP---PPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP PP PP P P PP P PP P P PPPP Sbjct: 65 PEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPP--PPPPPPEEPPPP 116 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = -1 Query: 662 PXPPPX*KTP---PPPXPXXXPXXPPPXPXPXXPP 567 P PPP +P PPP P P PP P PP Sbjct: 43 PSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPP 77 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXX-PPPXPXPXXPP 567 PPP PPPP P P PPP P PP Sbjct: 76 PPPL--FPPPPLPRLPPPLLPPPEEPPREPP 104 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 4/38 (10%) Frame = -1 Query: 668 FXPXPP--PX*KTPPPPXPXXX-PXXPPP-XPXPXXPP 567 F P PP P + PPP P P PPP P P PP Sbjct: 63 FPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPP 100 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P P PP P PPP P P P PPPP Sbjct: 58 PFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPP 106 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 903 PPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 PP PP PP PP PP PPPP Sbjct: 83 PPLPRLPPPLLPPPEEPPREPP--PPPPPPEEPPPP 116 Score = 28.7 bits (61), Expect = 6.1 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 4/51 (7%) Frame = -3 Query: 903 PPXXXXPPXXXPPXXXSXGG----PPXFXXXPPXXGPPPPXXRXXXXGXPP 763 PP PP PP PP F PP PPPP R PP Sbjct: 46 PPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLF-PPPPLPRLPPPLLPP 95 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -1 Query: 440 TPXXXPFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXP 324 +P P PP P P PL PPPLF P P Sbjct: 48 SPSSPPRLPPPF--PALFPPEPPLPPRFELPPPLFPPPP 84 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPP 798 PPP P PPP P PP P PPP Sbjct: 45 PPPSPSSPPRLPPP--FPALFPPEPPLPPRFELPPP 78 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 35.1 bits (77), Expect = 0.070 Identities = 30/127 (23%), Positives = 31/127 (24%), Gaps = 2/127 (1%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPF-SPXXXPXGXPPPPXXGXXXGEXP 765 P P PP P PPP P PP +P P P PP E P Sbjct: 95 PPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESP 154 Query: 764 XGGXAXXXXXXXXXXXXXXXXXXXXP-GAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPX 588 A P PPP P PP P Sbjct: 155 PSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDS 214 Query: 587 PXPXXPP 567 P PP Sbjct: 215 EHPSPPP 221 Score = 33.1 bits (72), Expect = 0.28 Identities = 32/134 (23%), Positives = 35/134 (26%), Gaps = 2/134 (1%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGX 783 P + P P PPP P PP P PP S P P P Sbjct: 148 PPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPS--PPASEIPPPPRHLPSPPASE 205 Query: 782 XXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXP- 606 P PG+ + P P K P P P P Sbjct: 206 RPSTPPSDSE---HPSPPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPPSPPE 262 Query: 605 -XXPPPXPXPXXPP 567 PPP P P P Sbjct: 263 ETLPPPKPSPDPLP 276 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PP +PPPP P P PP P PP Sbjct: 91 PVSPPPEPSPPPPLPTEAP--PPANPVSSPPP 120 Score = 31.1 bits (67), Expect = 1.1 Identities = 33/134 (24%), Positives = 35/134 (26%), Gaps = 10/134 (7%) Frame = -1 Query: 941 PXPPXXKXXXKXPP--PPXXXPHXXPPPGXXPXXXPPFSP--XXXPXGXPPPPXXGXXXG 774 P PP P P P PPP PP +P P PPPP Sbjct: 75 PSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPP 134 Query: 773 EXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTP---PP---PXPXX 612 P + P P PPP P PP P P Sbjct: 135 TTPITSPSPPTNPPPPPESPPSLPAPDPPS------NPLPPPKLVPPSHSPPRHLPSPPA 188 Query: 611 XPXXPPPXPXPXXP 570 PPP P P Sbjct: 189 SEIPPPPRHLPSPP 202 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = -1 Query: 656 PPPX*KTPPP----PXPXXXPXXPPPXPXPXXP 570 PPP P P P P P PPP P P P Sbjct: 71 PPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPP 103 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = -3 Query: 900 PXXXXPPXXXPPXXXSXGGPPXF--XXXPPXXGPPPP 796 P PP PP G PP PP PPPP Sbjct: 67 PLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPP 103 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 35.1 bits (77), Expect = 0.070 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PPP +PPPP P P P P P PP Sbjct: 62 PSPPPP--SPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXP---PPXPXPXXPP 567 P PPP TP PP P P PP P P PP Sbjct: 53 PSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPP 87 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PPPP P PPP P P P PPPP Sbjct: 55 PPPPSCTPSP-PPPSPPPPKKSSCPPSPLPPPPPPPP 90 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PPPP P P P PP P PPPP Sbjct: 50 PPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPP 86 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 2/61 (3%) Frame = -3 Query: 912 QXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXX--GPPPPXXRXXXXGXPPGGGXPXFX 739 Q PP PP P PP PP PPPP PPG P Sbjct: 48 QPPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPPNYVFTYPPGDLYPIEN 107 Query: 738 Y 736 Y Sbjct: 108 Y 108 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -1 Query: 662 PXPPPX*KTPPPPX--PXXXPXXPPPXPXPXXPP 567 P PPP +PPPP P P PPP PP Sbjct: 49 PPPPP---SPPPPSCTPSPPPPSPPPPKKSSCPP 79 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 34.7 bits (76), Expect = 0.093 Identities = 35/117 (29%), Positives = 38/117 (32%), Gaps = 5/117 (4%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGG--GVFXXG---GGXGXNXXFXAPGXXXXXXXXXXXXXX 732 GG G G GGG G G GGG G G GG G + + P Sbjct: 48 GGRGGYGGGGGR-GNRGGGGGGYQGGDRGGRGSGGGGRDGDWRCPN--PSCGNVNFARRV 104 Query: 733 XVXKXGAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGG 903 K GA P G S GGGG G + GG G G GG Sbjct: 105 ECNKCGALAPSGTSSGAN-DRGGGGYSRGGGDSDRGGGRGGRNDSGRSYESSRYDGG 160 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGGXG 942 GGGG P G+ G G G G GGG GG G Sbjct: 9 GGGGAPIPSYGGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGG 57 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 34.7 bits (76), Expect = 0.093 Identities = 35/117 (29%), Positives = 38/117 (32%), Gaps = 5/117 (4%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGG--GVFXXG---GGXGXNXXFXAPGXXXXXXXXXXXXXX 732 GG G G GGG G G GGG G G GG G + + P Sbjct: 48 GGRGGYGGGGGR-GNRGGGGGGYQGGDRGGRGSGGGGRDGDWRCPN--PSCGNVNFARRV 104 Query: 733 XVXKXGAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGG 903 K GA P G S GGGG G + GG G G GG Sbjct: 105 ECNKCGALAPSGTSSGAN-DRGGGGYSRGGGDSDRGGGRGGRNDSGRSYESSRYDGG 160 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGGXG 942 GGGG P G+ G G G G GGG GG G Sbjct: 9 GGGGAPIPSYGGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGG 57 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 34.7 bits (76), Expect = 0.093 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXG 786 P P PP P P PP P F P P G PPP G Sbjct: 132 PSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFPPESPPPGIDPPPPLG 183 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 662 PXP-PPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P P PP TP PP P P PP P PP Sbjct: 132 PSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPP 164 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 34.7 bits (76), Expect = 0.093 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -3 Query: 900 PXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPPGGG 754 P PP PP GGPP PP GPPPP G GGG Sbjct: 675 PGGGPPPPPPPPG----GGPPP----PPGGGPPPPPPPPGALGRGAGGG 715 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PP P P PPP P PP P P PPPP Sbjct: 672 PPLPGGGPPPPPPP---PGGGPPPPPGGGPPPPPPPP 705 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXP 585 P PPP PPP P P PPP P Sbjct: 680 PPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -3 Query: 903 PPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPPGGGXP 748 PP PP S P P PPPP PPGGG P Sbjct: 648 PPRVPRPPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPP 699 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 882 PXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPPGG 757 P PP GGPP PP GPPPP PP G Sbjct: 668 PSARPPLPG--GGPPP-PPPPPGGGPPPPPGGGPPPPPPPPG 706 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P P PPPP P PPP P PP Sbjct: 673 PLPGGGPPPPPPPPGGGPPPPPGGGPPPPP 702 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P P PPPP P P PP P PP Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPP 703 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPP 864 P PP PPPP P PPP Sbjct: 679 PPPPPPPPGGGPPPPPGGGPPPPPPP 704 >At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1 predicted transmembrane domain; Length = 175 Score = 34.7 bits (76), Expect = 0.093 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G G GGG G G GGGG GGG G Sbjct: 145 GGSHGHGCGGGGGGGGGGLGGGG--CGGGGCG 174 >At2g28670.1 68415.m03485 disease resistance-responsive family protein / fibroin-related contains similarity to silk fibroin heavy chain [Bombyx mori] gi|765323|gb|AAB31861; contains disease resistance response protien domain Pfam:FP03018 Length = 447 Score = 34.7 bits (76), Expect = 0.093 Identities = 35/127 (27%), Positives = 39/127 (30%), Gaps = 3/127 (2%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKXG 750 G G G G G G G G+ G G G + G G Sbjct: 59 GSTGFGFGAGSGSSGSGSTGSGL---GAGTG-SIPSSGSGPGLLPTASSVPGSLAGGGSG 114 Query: 751 AXPPXGXSPXXXPXXG---GGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXX 921 + P G + G GGG G G GG G GGG G GGG Sbjct: 115 SLPTTGSATGAGAGTGSALGGGPGAGSALG--GGAGAGPALGGGAGAGPALGGGAGAGSA 172 Query: 922 LXXGGXG 942 L GG G Sbjct: 173 LGGGGAG 179 Score = 33.5 bits (73), Expect = 0.21 Identities = 37/129 (28%), Positives = 40/129 (31%), Gaps = 5/129 (3%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXA-PGXXXXXXXXXXXXXXXVXKX 747 G G G G G G G + G G G + PG Sbjct: 66 GAGSGSSGSGSTGSGLGAGTGSIPSSGSGPGLLPTASSVPGSLAGGGSGSLPTTGSATGA 125 Query: 748 GAXPPXGXSPXXXPXXG---GGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG-XLX 915 GA G + P G GGG G G GG G GGG G GGGG Sbjct: 126 GAGT--GSALGGGPGAGSALGGGAGAGPALG--GGAGAGPALGGGAGAGSALGGGGAGAG 181 Query: 916 XXLXXGGXG 942 L GG G Sbjct: 182 PALGGGGAG 190 Score = 29.9 bits (64), Expect = 2.6 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +1 Query: 748 GAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG 906 GA P G GGGG G G GG G GGG GGG Sbjct: 158 GAGPALGGGAGAGSALGGGGAGAGPALG-GGGAGAGPALGGGVAGSGSALGGG 209 Score = 29.5 bits (63), Expect = 3.5 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = +1 Query: 748 GAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLX 927 GA P G P GGG G GG G GGG GGG Sbjct: 148 GAGPALGGGAGAGPALGGGAGAGSALGG--GGAGAGPALGGGGAGAGPALGGGVAGSGSA 205 Query: 928 XGG 936 GG Sbjct: 206 LGG 208 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 34.7 bits (76), Expect = 0.093 Identities = 48/221 (21%), Positives = 59/221 (26%), Gaps = 15/221 (6%) Frame = -1 Query: 941 PXPPXX----KXXXKXPPPPXXXPHXXPPPGXXPXXXPPF--SPXXXPXGXPPPPXXGXX 780 P PP K K PP P PPP P P + SP PPPP Sbjct: 542 PPPPCYSHSPKIEYKSPPTPYVYHSPPPPPYYSPSPKPAYKSSPPPYVYSSPPPPYYSPA 601 Query: 779 XG---EXPXGGXAXXXXXXXXXXXXXXXXXXXXP------GAXKXXFXPXPPPX*KTPPP 627 + P P + P P P K+PPP Sbjct: 602 PKPVYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPP 661 Query: 626 PXPXXXPXXPPPXPXPXXPPFXXXXXGAXXXXXXXXXXXXXFFXXXXXXXXXXXXXXXXX 447 P P PPP P P + ++ Sbjct: 662 PYVYSSP--PPPYYSPSPKP----TYKSPPPPYVYSSPPPPYYSPAPKPTYKSPPPPYVY 715 Query: 446 TXTPXXXPFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXP 324 + P P++ P P K P P P PPP + P P Sbjct: 716 SSPP--PPYYSPSPKPTYKSP-PPPYVYSSPPPPPYYSPSP 753 Score = 33.9 bits (74), Expect = 0.16 Identities = 33/133 (24%), Positives = 38/133 (28%), Gaps = 11/133 (8%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXP--XGXPPPPXXGXXXG---EX 768 P K K PPPP + PPP P P + P PPPP + Sbjct: 173 PSPKVDYKSPPPPYVY-NSPPPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKS 231 Query: 767 PXGGXAXXXXXXXXXXXXXXXXXXXXP------GAXKXXFXPXPPPX*KTPPPPXPXXXP 606 P P + P P P K+PPPP P Sbjct: 232 PPPPYVYSSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPIYKSPPPPYVYNSP 291 Query: 605 XXPPPXPXPXXPP 567 PPP P P Sbjct: 292 --PPPYYSPSPKP 302 Score = 33.9 bits (74), Expect = 0.16 Identities = 33/133 (24%), Positives = 38/133 (28%), Gaps = 11/133 (8%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXP--XGXPPPPXXGXXXG---EX 768 P K K PPPP + PPP P P + P PPPP + Sbjct: 273 PSPKPIYKSPPPPYVY-NSPPPPYYSPSPKPAYKSPPPPYVYSFPPPPYYSPSPKPVYKS 331 Query: 767 PXGGXAXXXXXXXXXXXXXXXXXXXXP------GAXKXXFXPXPPPX*KTPPPPXPXXXP 606 P P + P P P K+PPPP P Sbjct: 332 PPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSP 391 Query: 605 XXPPPXPXPXXPP 567 PPP P P Sbjct: 392 --PPPYYSPSPKP 402 Score = 33.9 bits (74), Expect = 0.16 Identities = 33/122 (27%), Positives = 38/122 (31%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGX 753 P K K PPPP + PPP P +SP P PPP P Sbjct: 323 PSPKPVYKSPPPPYV--YNSPPP-------PYYSPSPKPAYKSPPPPY--VYSSPPPPYY 371 Query: 752 AXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXX 573 + P + P P P K+PPPP P PPP P Sbjct: 372 SPSPKPTYKSPPPPYVYSSPPP----PYYSPSPKPVYKSPPPPYIYNSP--PPPYYSPSP 425 Query: 572 PP 567 P Sbjct: 426 KP 427 Score = 32.7 bits (71), Expect = 0.37 Identities = 33/133 (24%), Positives = 37/133 (27%), Gaps = 11/133 (8%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXP--XGXPPPPXXGXXXG---EX 768 P K K PPPP PPP P P + P PPPP + Sbjct: 98 PSPKVDYKSPPPPYVYSSP-PPPYYSPSPKPTYKSPPPPYVYNSPPPPYYSPSPKVEYKS 156 Query: 767 PXGGXAXXXXXXXXXXXXXXXXXXXXP------GAXKXXFXPXPPPX*KTPPPPXPXXXP 606 P P + P P P K+PPPP P Sbjct: 157 PPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYIYSSP 216 Query: 605 XXPPPXPXPXXPP 567 PPP P P Sbjct: 217 --PPPYYSPSPKP 227 Score = 32.7 bits (71), Expect = 0.37 Identities = 31/129 (24%), Positives = 36/129 (27%), Gaps = 11/129 (8%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXP--XGXPPPPXXG-----XXXG 774 P K K PPPP + PPP P P + P PPPP Sbjct: 398 PSPKPVYKSPPPPYIY-NSPPPPYYSPSPKPSYKSPPPPYVYSSPPPPYYSPSPKLTYKS 456 Query: 773 EXPXGGXAXXXXXXXXXXXXXXXXXXXXP----GAXKXXFXPXPPPX*KTPPPPXPXXXP 606 P + P + P P P K+PPPP P Sbjct: 457 SPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKPSYKSPPPPYVYNSP 516 Query: 605 XXPPPXPXP 579 P P P Sbjct: 517 PPPYYSPSP 525 Score = 31.5 bits (68), Expect = 0.86 Identities = 30/123 (24%), Positives = 35/123 (28%), Gaps = 2/123 (1%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGX 753 P K K PPPP + PPP P +SP P PPP P Sbjct: 650 PTPKPTYKSPPPPYV--YSSPPP-------PYYSPSPKPTYKSPPPPYVYSSPPPPYYSP 700 Query: 752 AXXXXXXXXXXXXXXXXXXXX--PGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXP 579 A + K + PPP + PPP P P P Sbjct: 701 APKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKSP 760 Query: 578 XXP 570 P Sbjct: 761 PPP 763 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXP--XGXPPPP 795 P K K PPPP PPP P + P PPPP Sbjct: 725 PSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPP 772 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXP--XGXPPPP 795 P K K PPPP PPP P + P PPPP Sbjct: 776 PSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPP 823 Score = 30.7 bits (66), Expect = 1.5 Identities = 30/124 (24%), Positives = 35/124 (28%), Gaps = 3/124 (2%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGX 753 P K K PPPP + PPP P +SP P PPP P Sbjct: 700 PAPKPTYKSPPPPYV--YSSPPP-------PYYSPSPKPTYKSPPPPYVYSSPPPPPYYS 750 Query: 752 AXXXXXXXXXXXXXXXXXXXXP---GAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPX 582 P + K + PPP + PPP P P Sbjct: 751 PSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKS 810 Query: 581 PXXP 570 P P Sbjct: 811 PPPP 814 Score = 29.5 bits (63), Expect = 3.5 Identities = 29/129 (22%), Positives = 33/129 (25%), Gaps = 11/129 (8%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXP--XGXPPPPXXGXXXG---EX 768 P K K PPPP PP P + P PPPP + Sbjct: 22 PTPKVDYKSPPPPYVYSSPPPPLSYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKS 81 Query: 767 PXGGXAXXXXXXXXXXXXXXXXXXXXP------GAXKXXFXPXPPPX*KTPPPPXPXXXP 606 P P + P P P K+PPPP P Sbjct: 82 PPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYNSP 141 Query: 605 XXPPPXPXP 579 P P P Sbjct: 142 PPPYYSPSP 150 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/48 (31%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXP--XGXPPPP 795 P K K PPPP PP P + P PPPP Sbjct: 802 PSPKVEYKSPPPPYVYSSPPPPTYYSPSPKVEYKSPPPPYVYNSPPPP 849 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 34.7 bits (76), Expect = 0.093 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXX-PPFSPXXXPXGXPPPPXXGXXXGEXPXG 759 PPPP P PPP P PP P PPPP P G Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPPPANFLYITGPPG 108 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PPP +PPPP P P PPP P PP Sbjct: 59 PPPP--SPPPPSP-PPPACPPPPALPPPPP 85 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXP 585 P PPP +PPPP P PPP P Sbjct: 62 PSPPPP--SPPPPACPPPPALPPPPP 85 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = -1 Query: 653 PPX*KTPPPPXPXXXPXXPPP--XPXPXXPP 567 P + PPPP P P PPP P P PP Sbjct: 53 PSCIQNPPPPSP-PPPSPPPPACPPPPALPP 82 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G G GGG G G G G + GGG G Sbjct: 123 GGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYG 154 Score = 33.1 bits (72), Expect = 0.28 Identities = 25/109 (22%), Positives = 28/109 (25%) Frame = +1 Query: 580 GXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKXGAXP 759 G G GGG G G G G + + Sbjct: 47 GIGIGGGGSGSGAGAGSGSGGGGSSSSSSSSSSSSSSSGGGGGDAGSEAGSYAGSHAGSG 106 Query: 760 PXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG 906 G S GGG G G GG G G G +G G GG Sbjct: 107 SGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGG 155 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPG 690 G G G GGG G G GGGG GGG G + G Sbjct: 112 GSGRGRGSGGG-GGHGGGGGGGGGRGGGGGSGNGEGYGEGG 151 Score = 30.3 bits (65), Expect = 2.0 Identities = 26/109 (23%), Positives = 28/109 (25%) Frame = +1 Query: 580 GXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKXGAXP 759 G G G G G G G G GGG + + Sbjct: 43 GIGIGIGIGGGGSGSGAGAGSGSGGGGSSSSSSSSSSSSSSSGGGGGDAGSEAGSYAGSH 102 Query: 760 PXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG 906 S G G G G GG G GGG G G GG Sbjct: 103 AGSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGG 151 Score = 29.9 bits (64), Expect = 2.6 Identities = 30/117 (25%), Positives = 30/117 (25%) Frame = +1 Query: 586 GXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKXGAXPPX 765 G G G G G GGGG G G G G G Sbjct: 39 GIGAGI-GIGIGIGGGG---SGSGAGAGSGSGGGGSSSSSSSSSSSSSSSGGGGGDAGSE 94 Query: 766 GXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGG 936 S G G G G G G GGG G GGG GG Sbjct: 95 AGSYAGSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGG 151 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGGXG 942 GGGG G G G G GG G G GG GG G Sbjct: 85 GGGGGDAGSEAGSYAGSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGG 133 Score = 29.5 bits (63), Expect = 3.5 Identities = 27/110 (24%), Positives = 29/110 (26%), Gaps = 2/110 (1%) Frame = +1 Query: 580 GXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKX-GAX 756 G G G G G GGGG + G G Sbjct: 51 GGGGSGSGAGAGSGSGGGGSSSSSSSSSSSSSSSGGGGGDAGSEAGSYAGSHAGSGSGGR 110 Query: 757 PPXGXSPXXXPXXG-GGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGG 903 G G GGG G G GG G G G +G GGG Sbjct: 111 SGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGGG 160 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXP 579 P PPP + PPPP PPP P P Sbjct: 315 PPPPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PPP PPP P PPP P P PP Sbjct: 314 PPPPPPLLQQPPPPPSVSKAPPPPPPPP--PP 343 Score = 31.5 bits (68), Expect = 0.86 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXP 579 PPP PPPP P P P P P Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPP 328 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PPP P PPP PP P PPPP Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPP 339 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PP K PPPP PPP PP P PPPP Sbjct: 303 PPPQKSIPPPPPPP-------PPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -3 Query: 885 PPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 PP PP PP PP PPPP Sbjct: 313 PPPPPPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PP PPPP PPP P S P PPPP Sbjct: 304 PPQKSIPPPPPPPPPPLLQQPPPP-------PSVSKAPPPPPPPPPP 343 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PPP PPPP P PPP PP Sbjct: 310 PPP----PPPPPPPLLQQPPPPPSVSKAPP 335 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFS 831 P PP + PPPP PPP P PP S Sbjct: 312 PPPPPPPPLLQQPPPPPSVSKAPPPP---PPPPPPKS 345 >At2g18470.1 68415.m02151 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 633 Score = 34.3 bits (75), Expect = 0.12 Identities = 20/65 (30%), Positives = 21/65 (32%), Gaps = 2/65 (3%) Frame = -3 Query: 942 APSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPP 763 +PSP P PP PP S PP PP P P PP Sbjct: 16 SPSPPSNTNSTTSSPPAPSPPSPTPPQGDSSSSPPPDSTSPPAPQAPNPPNSSNNSPSPP 75 Query: 762 --GGG 754 GGG Sbjct: 76 SQGGG 80 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 34.3 bits (75), Expect = 0.12 Identities = 26/119 (21%), Positives = 28/119 (23%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PP P P PPP P SP P PP P P Sbjct: 97 PPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPV 156 Query: 755 XAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXP 579 A + P P P +PP P P P P P Sbjct: 157 QAPSPISLPPAPAPAPTKHKRKHKHKRHHHAPAPAPIPPSPPSPPVLTDPQDTAPAPSP 215 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXP-PPXPXPXXPP 567 P PP T PPP P P P P P P PP Sbjct: 115 PVSPPPAPTSPPPTPASPPPAPASPPPAPASPP 147 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXP-PPXPXPXXPP 567 P PP PPP P P P P P P PP Sbjct: 122 PTSPPPTPASPPPAPASPPPAPASPPPAPVSPP 154 Score = 30.7 bits (66), Expect = 1.5 Identities = 28/114 (24%), Positives = 28/114 (24%), Gaps = 2/114 (1%) Frame = -1 Query: 905 PPPPXXXPHXX--PPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXXXX 732 PPP P PPP PP S P PP P A Sbjct: 39 PPPTTAAPPTTAAPPP---TTTTPPVSAAQPPASPVTPPP-AVTPTSPPAPKVAPVISPA 94 Query: 731 XXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 P P P P P P P P PPP P P Sbjct: 95 TPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPP 148 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P P PPP P PP PP SP P PP P Sbjct: 83 PAPKVAPVISPATPPPQ--PPQSPPASAPTVSPPPVSPPPAPTSPPPTP 129 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = -1 Query: 656 PPPX*KTPP--PPXPXXXPXXPPPXPXPXXPP 567 PPP TPP P P PPP P PP Sbjct: 52 PPPTTTTPPVSAAQPPASPVTPPPAVTPTSPP 83 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 P P P P P P P PPP P P Sbjct: 125 PPPTPASPPPAPASPPPAPASPPPAPVSPPP 155 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 34.3 bits (75), Expect = 0.12 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +2 Query: 749 GXPPPGGXPXXXXLXMGGGGPXXGGXXXKXGGPPXEXXXGGXXXGGXXXXGGXXWXXXXX 928 G P GG P GGG GG GG P GG G GG Sbjct: 79 GTTPTGGYPPLYGTTPPGGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTG 138 Query: 929 XGXG 940 G G Sbjct: 139 AGGG 142 Score = 32.3 bits (70), Expect = 0.49 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = +1 Query: 748 GAXPPX-GXSP-XXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGG 903 G PP G +P P G P G G GG G PGGG G G G Sbjct: 72 GGYPPLDGTTPTGGYPPLYGTTPPGGGDVGGGGGGYGGGTPGGGGGGGGDTGAG 125 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G GGG G G GGGG G G G Sbjct: 96 GGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAG 127 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGG-GVFXXGGGXGXNXXFXAPG 690 G G G GGG G G GG G GGG G A G Sbjct: 101 GGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGG 141 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 547 PXXXXXXGGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 P GG G G GGG G GGGG GGG G Sbjct: 112 PGGGGGGGGDTGAGAGGG------GYGGGGDTGAGGGVG 144 Score = 28.3 bits (60), Expect = 8.0 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 2/67 (2%) Frame = +1 Query: 748 GAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPG--GGXXWGXXXGGGGXLXXX 921 G P G P GG P GG G G GG G GGGG Sbjct: 66 GPTTPTGGYPPLDGTTPTGGYPPLYGTTPPGGGDVGGGGGGYGGGTPGGGGGGGGDTGAG 125 Query: 922 LXXGGXG 942 GG G Sbjct: 126 AGGGGYG 132 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G G GGG G G GGGG G G G Sbjct: 400 GGGGGGGDGGGGQGTGIGGGGGGEQGTGVGGG 431 Score = 32.3 bits (70), Expect = 0.49 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGGXG 942 G GG G G GG G GGG G GGGG + GG G Sbjct: 398 GCGGGGGGGDGG--GGQGTGIGGGGGGEQGTGVGGGGDTCTQVTHGGGG 444 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGG 936 GGG GG G GGG G GGGG + GG Sbjct: 386 GGGAGAVTQVMQGCGGGGGGGDGGGGQGTGIGGGGGGEQGTGVGGGG 432 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGG 936 GGGG G G G G GG GGGG + GG Sbjct: 408 GGGGQGTGIGGGGGGEQGTGVGGGGDTCTQVTHGGGGAPLTMIGGGG 454 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPX 762 P PP PP P PP P PP SP P PP P Sbjct: 49 PSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPPQSTPT 108 Query: 761 G 759 G Sbjct: 109 G 109 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXP--XXPPPXPXPXXPP 567 P PP TPPP P P PPP P PP Sbjct: 70 PNQPPN-TTPPPTPPSSPPPSITPPPSPPQPQPP 102 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PPP + PPP P P P P P P Sbjct: 78 PPPTPPSSPPPSITPPPSPPQPQPPPQSTP 107 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 3/52 (5%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXP---PPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP PPP P P P G P P P P PPP Sbjct: 80 PTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPPSLFPPP 131 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = -1 Query: 653 PPX*KTPPPPXPXXXP----XXPPPXPXPXXPP 567 PP K PPP P P PPP P PP Sbjct: 216 PPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPP 248 Score = 27.1 bits (57), Expect(2) = 0.14 Identities = 14/49 (28%), Positives = 17/49 (34%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP + PPP + PP P P + P PP P Sbjct: 181 PCPPKYSPPVEVPPPVPV--YEPPPKKEIPPPVPVYDPPPKKEVPPPVP 227 Score = 25.8 bits (54), Expect(2) = 0.14 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 2/43 (4%) Frame = -1 Query: 689 PGAXKXXFXPXPPPX*KTPPPP--XPXXXPXXPPPXPXPXXPP 567 P K P PP PP P P PPP P PP Sbjct: 239 PPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPPVPVYKPPP 281 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 653 PPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PP PPPP P PPP P P P Sbjct: 259 PPGRSAPPPPPAAAPPPQPPPPPPPKPQP 287 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PPP PPP P P PPP P P PP Sbjct: 265 PPPPPA--AAPPPQP---PPPPPPKPQPPPPP 291 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXG 786 PPPP P PPP P PP P PP P G Sbjct: 266 PPPPAAAPPPQPPPPPPPKPQPP--PPPKIARPPPAPPKG 303 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PP PPPP P PPP P PP Sbjct: 259 PPGRSAPPPPPAAAPPPQPPPPPPPKPQPP 288 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPG-XXPXXXPP 837 P P PP + PPPP P PPP P PP Sbjct: 259 PPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPP 301 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = -3 Query: 903 PPXXXXPPXXXPPXXXSXGGPPXFXXXPPXX-GPPPPXXRXXXXGXPPGGGXP 748 PP P PP + PP PP PPPP PP G P Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKGAAP 306 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -1 Query: 689 PGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PG P P + PPPP P P PP P P Sbjct: 260 PGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAP 300 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 P P ++ PPP P P PP P P P Sbjct: 255 PLKLPPGRSAPPPPPAAAPPPQPPPPPPPKP 285 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXP 579 P PPP + PPPP P PP P Sbjct: 279 PPPPPKPQPPPPPKIARPPPAPPKGAAP 306 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -1 Query: 689 PGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPP 591 P A P PPP PPPP P PP Sbjct: 269 PAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPP 301 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PPP K PPP P PPP P P Sbjct: 277 PPPPPPPKPQPPPPPKIA--RPPPAPPKGAAP 306 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G GGG G G GGGG GGG G Sbjct: 123 GGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDG 154 Score = 33.1 bits (72), Expect = 0.28 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 760 PXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG 906 P P GGGG G G GG G GGG G GGGG Sbjct: 110 PANDRPSAPRAYGGGGGYSGGGGG-YGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 586 GXGGGXXGXXXGXGGGGVFXXGGGXG 663 G GGG G G GGGG GGG G Sbjct: 122 GGGGGYSGGGGGYGGGGGGYGGGGGG 147 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGG 654 GG G G GGG G G GGG GG Sbjct: 129 GGGGGYGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGG 657 GG G GGG G G GGGG GGG Sbjct: 130 GGGGYGGGGGGYGGGGGGYGGGG--DGGGG 157 Score = 28.7 bits (61), Expect = 6.1 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 544 APXXXXXXGGXXGXGXG--GGXXGXXXGXGGGGVFXXGGG 657 AP GG G G G GG G G GG G GGG Sbjct: 117 APRAYGGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGG 156 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G G GGG G G GGGG GGG G Sbjct: 59 GGGDGGGDGGG-DGGGGGCGGGGGCGGGGGGG 89 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = -1 Query: 662 PXPPPX*KT---PPPPXPXXXPXXPPPXPXPXXP 570 P PPP + PPPP P PPP P P P Sbjct: 32 PPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLP 65 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPP 801 P PP + PPPP PPP PP P P PP Sbjct: 33 PPPPLMRRRAPPPPPPPLMRRRAPPP-------PPPPPLPRPCSRPP 72 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP + PPPP P P PP P PPPP Sbjct: 18 PPPPLMRRRAPLPPPPPPPLMRRRAP---PPPPPPLMRRRAPPPPPPPP 63 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 5/33 (15%) Frame = -1 Query: 662 PXPPPX*K-----TPPPPXPXXXPXXPPPXPXP 579 P PPP + PPPP P PPP P P Sbjct: 17 PPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPP 49 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PPP ++ P P P PPP P P P Sbjct: 26 PPPPPMRRSAPSPPPMSGRVPPPPPPPPMFDP 57 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -3 Query: 885 PPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 PP PP S PP P PPPP Sbjct: 24 PPPPPPPMRRSAPSPPPMSGRVPPPPPPPP 53 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -2 Query: 397 PKXPPXPPP*QKXXFXPPPFFXXXPP 320 P PP PPP ++ PPP PP Sbjct: 22 PLPPPPPPPMRRSAPSPPPMSGRVPP 47 >At5g04290.1 68418.m00422 KOW domain-containing transcription factor family protein Length = 1493 Score = 33.5 bits (73), Expect = 0.21 Identities = 35/137 (25%), Positives = 37/137 (27%), Gaps = 5/137 (3%) Frame = +1 Query: 547 PXXXXXXGGXXGXGXGGGXXGXXXGXGGGGVFXX-GGGXGXNXXFXAPGXXXXXXXXXXX 723 P G G G GG G GGG + G G + G Sbjct: 1126 PSGGSSWGKQDGDG-GGSSWGKENDAGGGSSWGKQDNGVGSSWGKQNDGSGGGSSWGKQN 1184 Query: 724 XXXXVXKXGAXPPXGXSPXXXPXXGGG--GXPXGXXXGEXGGXXXGXXP--GGGXXWGXX 891 G G GGG G G GG G GGG WG Sbjct: 1185 DAGGGSSWGKQDSGGDGSSWGKQDGGGDSGSAWGKQNNTSGGSSWGKQSDAGGGSSWGKQ 1244 Query: 892 XGGGGXLXXXLXXGGXG 942 GGGG GG G Sbjct: 1245 DGGGGGSSWGKQDGGGG 1261 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +1 Query: 766 GXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG 906 G S GGGG G G+ G GGG +G GGGG Sbjct: 1298 GGSSWGKQNDGGGGSSWGKQ-GDGGSKPWNEHSGGGRGFGERRGGGG 1343 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = +1 Query: 799 GGGXPXGXXXGEXGGXXXGXXP--GGGXXWGXXXGGGGXLXXXLXXGGXG 942 GGG G G GG G GGG WG GG GG G Sbjct: 1285 GGGSSWGKQDGGGGGSSWGKQNDGGGGSSWGKQGDGGSKPWNEHSGGGRG 1334 Score = 29.5 bits (63), Expect = 3.5 Identities = 30/119 (25%), Positives = 32/119 (26%), Gaps = 4/119 (3%) Frame = +1 Query: 592 GGGXXGXXXGXGGGGVFXX--GGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKXGAX-PP 762 GG G GGG + GGG G + G G Sbjct: 1225 GGSSWGKQSDAGGGSSWGKQDGGGGGSSWGKQDGGGGSGSAWGKQNETSNGSSWGKQNDS 1284 Query: 763 XGXSPXXXPXXGGGGXPXGXXXGEXGGXXXG-XXPGGGXXWGXXXGGGGXLXXXLXXGG 936 G S GGGG G GG G GG W GGG GG Sbjct: 1285 GGGSSWGKQDGGGGGSSWGKQNDGGGGSSWGKQGDGGSKPWNEHSGGGRGFGERRGGGG 1343 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 33.5 bits (73), Expect = 0.21 Identities = 18/59 (30%), Positives = 19/59 (32%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXG 759 PP + PPPP PPP PP G PPP G P G Sbjct: 241 PPPQRPPMGGPPPPPHIGGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPPPYG 299 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/65 (27%), Positives = 18/65 (27%) Frame = -3 Query: 942 APSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPP 763 A P Q PP PP G P GPPPP PP Sbjct: 238 AGGPPPQRPPMGGPPPPPHIGGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPPP 297 Query: 762 GGGXP 748 G P Sbjct: 298 YGAPP 302 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXN 669 GG G GG G G GGGG GGG G N Sbjct: 85 GGGHYGGGGGHYGGGGGGYGGGGGHHGGGGHGLN 118 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +1 Query: 568 GGXXGXGXGGG-XXGXXXGXGGGGVFXXGGGXG 663 GG G G GGG G G GG G+ GGG G Sbjct: 48 GGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGG 80 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 G G G GGG G G GGG GGG G Sbjct: 71 GLDGYGGGGGHYGGGGGHYGGGGGHYGGGGG 101 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G GGG G G GGG GGG G Sbjct: 77 GGGGHYGGGGGHYGGGGGHYGGGGGGYGGGGG 108 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = +1 Query: 568 GGXXGXGX--GGGXXGXXXGXGGGGVFXXGGG 657 GG G G GGG G GGGG + GGG Sbjct: 56 GGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGG 87 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG 906 GGGG G G GG G GGG +G GGGG Sbjct: 76 GGGGGHYGGGGGHYGG-GGGHYGGGGGGYG---GGGG 108 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXG 897 GGGG G G GG G GGG G G Sbjct: 83 GGGGGHYGGGGGHYGGGGGGYGGGGGHHGGGGHG 116 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 33.1 bits (72), Expect = 0.28 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGG--XXXGXXPGGGXXWGXXXGGGGXLXXXLXXGGXG 942 GGGG G G GG G GGG + GGGG GG G Sbjct: 91 GGGGHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGG 141 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G G G G GGGG GGG G Sbjct: 98 GGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 129 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G GGG G GGGG GGG G Sbjct: 119 GGYSSRGGGGGSYGGGRREGGGG---YGGGEG 147 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP P PP P PP S P PPPP Sbjct: 38 PSPPSSSPSSAPPSSLSPSSPPPLS--LSPSSPPPPP 72 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP P PP P PP S P PPPP Sbjct: 87 PSPPSSSPSSAPPSSLSPSSPPPLS--LSPSSPPPPP 121 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = -3 Query: 936 SPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 SP P P PP S PP P PPPP Sbjct: 76 SPLSSLSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPP 122 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G G GGG G G G G GGG G Sbjct: 192 GGGGGGGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 31.1 bits (67), Expect = 1.1 Identities = 34/126 (26%), Positives = 36/126 (28%), Gaps = 1/126 (0%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKX 747 GG G GGG G GGGG GG G N F + Sbjct: 90 GGIVVGGGGGG------GGGGGG---GGGSGGSNGSFFNGSGSGTGYGSGDGRVSSSGEY 140 Query: 748 GAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGG-XXWGXXXGGGGXLXXXL 924 A G S GGG G G G G G + GGGG Sbjct: 141 SASAGGGGSGEGSGGGGGGDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGG 200 Query: 925 XXGGXG 942 GG G Sbjct: 201 GGGGGG 206 Score = 30.3 bits (65), Expect = 2.0 Identities = 30/125 (24%), Positives = 31/125 (24%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKX 747 GG G G GGG G G G G G G Sbjct: 95 GGGGGGGGGGGGGGGSGGSNGSFFNGSGSGTGYGSGDGRVSSSGEYSASAGGGGSGEGSG 154 Query: 748 GAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLX 927 G G S G G G G GGG G GGGG + Sbjct: 155 GGGGGDGSSGSGSGSGSGSGSGTGTASGP--DVYMHVEGGGGGGGGGGGGGGGGVDGSGS 212 Query: 928 XGGXG 942 G G Sbjct: 213 GSGSG 217 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXP 579 P PPP PPPP P PPP P P Sbjct: 241 PTPPPP---PPPPIPVKQSATPPPPPPP 265 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -1 Query: 638 TPPPPXPXXXPXXPPPXPXPXXPP 567 TPPPP P P P P PP Sbjct: 242 TPPPPPPPPIPVKQSATPPPPPPP 265 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PPPP P P PP P PPPP Sbjct: 243 PPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/61 (26%), Positives = 19/61 (31%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPX 762 P P + PPPP + P P P + PPP G GE Sbjct: 249 PPIPVKQSATPPPPPPPKLKNNGPSPPPPPPLKKTAALSSSASKKPPPAPRGSSSGESSN 308 Query: 761 G 759 G Sbjct: 309 G 309 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXG-GGXGXN 669 GG G G GG G G GG G + G GG G N Sbjct: 132 GGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGN 166 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGG-GVFXXGGGXG 663 G G G GGG G G GGG G + GG G Sbjct: 126 GGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYG 157 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGG-GVF--XXGGGXGXN 669 GG G G G G G G GGG G + GGG G N Sbjct: 138 GGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGN 174 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXG-GGGVFXXGGGXG 663 GG G G GGG G G GGG GG G Sbjct: 123 GGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGG 155 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGG--GGVFXXGGGXGXNXXFXAPG 690 GG G G GG G G GG GG GG G A G Sbjct: 135 GGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAG 177 Score = 27.5 bits (58), Expect(2) = 0.53 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 592 GGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPG 690 GGG G G GGGG GG G + G Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSG 154 Score = 25.8 bits (54), Expect(2) = 3.3 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 580 GXGXGGGXXGXXXGXGGGGVFXXG-GGXGXNXXF 678 G GGG G G GG G + G GG G + + Sbjct: 123 GGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGY 156 Score = 23.4 bits (48), Expect(2) = 0.53 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXG--XXPGGGXXWGXXXGGGGXLXXXLXXGGXG 942 GG G G G GG G G G G G GG GG G Sbjct: 158 GGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGGGYGSSGGFG 208 Score = 22.2 bits (45), Expect(2) = 3.3 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = +1 Query: 799 GGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGGXG 942 GG G G GG G G G GG GG G Sbjct: 151 GGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAG 198 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 32.7 bits (71), Expect = 0.37 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPP--PP 795 P P K P P P PP P PP SP P PP PP Sbjct: 126 PPTPTVKPPTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPPTTTPPVKPP 176 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/47 (29%), Positives = 16/47 (34%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PP K PP P PP P P ++P P P P Sbjct: 154 PPTYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNPPTTPVKPPTAP 200 Score = 30.3 bits (65), Expect = 2.0 Identities = 29/115 (25%), Positives = 32/115 (27%), Gaps = 2/115 (1%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPP--PPXXGXXXGEXPXGGXAXXXXXX 732 PP P P P P P P +P P PP PP + P Sbjct: 47 PPSPALKP---PTPSYKPPTLPT-TPIKPPTTKPPVKPPTIPVTPVKPPVSTPPIKLPPV 102 Query: 731 XXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P + P P P K PP P P PP P PP Sbjct: 103 QPPTYKPPTPTVKPPSVQPPTYKP-PTPTVK-PPTTSPVKPPTTPPVQSPPVQPP 155 >At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 244 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPG 690 GG G G GG G G GGG GG + APG Sbjct: 173 GGASGGGPGGASGGGPGGASGGGPGGASGGASGDKPEGAPG 213 Score = 29.5 bits (63), Expect = 3.5 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 2/67 (2%) Frame = +1 Query: 748 GAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPG--GGXXWGXXXGGGGXLXXX 921 G P P GG P G G GG G G GG G G G Sbjct: 131 GDKPGGASGGGDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGG 190 Query: 922 LXXGGXG 942 GG G Sbjct: 191 ASGGGPG 197 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 32.7 bits (71), Expect = 0.37 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPP 591 P PPP +PPPP P PPP Sbjct: 47 PPPPPSNPSPPPPSPTTTACPPPP 70 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 32.7 bits (71), Expect = 0.37 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXX-PPPGXXPXXXPPFSPXXXPXGXPPPP 795 P P PPPP P PPP P P P P PPP Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPP 107 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PP +PPPP P PPP P P Sbjct: 84 PATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 31.9 bits (69), Expect = 0.65 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = -3 Query: 903 PPXXXXPPXXXPPXXXSXGGP--PXFXXXPPXXGPPPPXXRXXXXGXPPGGGXP 748 PP PP PP S P P PP PPPP PP P Sbjct: 59 PPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPP 112 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = -3 Query: 903 PPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPPGGGXP 748 PP PP P + PP PP PPPP PP P Sbjct: 39 PPPAATPPPVSAPPPVTTSPPPVTTAPPPA-NPPPPVSSPPPASPPPATPPP 89 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPP-XPXPXXPP 567 PPP PPP P PPP P P PP Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPP 88 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -1 Query: 413 PPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 PP PP P P + PPP+ P PP Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPPP 96 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PP PPPP P PP P PP +P P P P Sbjct: 83 PPATPPPVASPPPPVASP---PPATPPPVATPPPAPLASPPAQVPAP 126 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPP---XPXPXXPP 567 PPP +PPP P PPP P P PP Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASPP 83 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 PPP +PPP P P PPP P P Sbjct: 70 PPPPVSSPPPASP--PPATPPPVASPPPP 96 Score = 29.5 bits (63), Expect = 3.5 Identities = 28/124 (22%), Positives = 29/124 (23%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPX 762 P P PPP P P PP +P P PPP P Sbjct: 33 PPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANP--PPPVSSPPPASPPPATPPPV 90 Query: 761 GGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPX 582 P A P P P T P P P PP P Sbjct: 91 ASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAP---TTKPDSPSPSPSSSPPLPS 147 Query: 581 PXXP 570 P Sbjct: 148 SDAP 151 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PPP P P P P P P P PP Sbjct: 77 PPPASPPPATPPPVASPPPPVASPPPATPP 106 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -3 Query: 942 APSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPP 799 AP P PP PP PP PP PP PPP Sbjct: 64 APPPANPPPPVSSPPPASPPPATPPP----VASPPPPVASPPPATPPP 107 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPX-PXPXXPP 567 PPP PPPP P PPP P P P Sbjct: 65 PPPA--NPPPPVSSPPPASPPPATPPPVASP 93 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/48 (31%), Positives = 15/48 (31%), Gaps = 1/48 (2%) Frame = -3 Query: 903 PPXXXXPPXXXPPXXXSXGG-PPXFXXXPPXXGPPPPXXRXXXXGXPP 763 PP PP PP PP PP PPP PP Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPP 113 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PP TP PP P P P P PP Sbjct: 23 PTSPPT-ATPAPPTPTTPPPAATPPPVSAPPP 53 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/47 (29%), Positives = 16/47 (34%) Frame = -3 Query: 939 PSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPP 799 P+P PP PP P + PP PP PPP Sbjct: 34 PTPTTPPPAATPPPVSAPPPVTTSPPPVTT-APPPANPPPPVSSPPP 79 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 32.7 bits (71), Expect = 0.37 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXX-PPPGXXPXXXPPFSPXXXPXGXPPPP 795 P P PPPP P PPP P P P P PPP Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPP 107 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PP +PPPP P PPP P P Sbjct: 84 PATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 31.9 bits (69), Expect = 0.65 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = -3 Query: 903 PPXXXXPPXXXPPXXXSXGGP--PXFXXXPPXXGPPPPXXRXXXXGXPPGGGXP 748 PP PP PP S P P PP PPPP PP P Sbjct: 59 PPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPP 112 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = -3 Query: 903 PPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPPGGGXP 748 PP PP P + PP PP PPPP PP P Sbjct: 39 PPPAATPPPVSAPPPVTTSPPPVTTAPPPA-NPPPPVSSPPPASPPPATPPP 89 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPP-XPXPXXPP 567 PPP PPP P PPP P P PP Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPP 88 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -1 Query: 413 PPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 PP PP P P + PPP+ P PP Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPPP 96 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PP PPPP P PP P PP +P P P P Sbjct: 83 PPATPPPVASPPPPVASP---PPATPPPVATPPPAPLASPPAQVPAP 126 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPP---XPXPXXPP 567 PPP +PPP P PPP P P PP Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASPP 83 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 PPP +PPP P P PPP P P Sbjct: 70 PPPPVSSPPPASP--PPATPPPVASPPPP 96 Score = 29.5 bits (63), Expect = 3.5 Identities = 28/124 (22%), Positives = 29/124 (23%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPX 762 P P PPP P P PP +P P PPP P Sbjct: 33 PPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANP--PPPVSSPPPASPPPATPPPV 90 Query: 761 GGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPX 582 P A P P P T P P P PP P Sbjct: 91 ASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAP---TTKPDSPSPSPSSSPPLPS 147 Query: 581 PXXP 570 P Sbjct: 148 SDAP 151 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PPP P P P P P P P PP Sbjct: 77 PPPASPPPATPPPVASPPPPVASPPPATPP 106 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -3 Query: 942 APSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPP 799 AP P PP PP PP PP PP PPP Sbjct: 64 APPPANPPPPVSSPPPASPPPATPPP----VASPPPPVASPPPATPPP 107 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPX-PXPXXPP 567 PPP PPPP P PPP P P P Sbjct: 65 PPPA--NPPPPVSSPPPASPPPATPPPVASP 93 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/48 (31%), Positives = 15/48 (31%), Gaps = 1/48 (2%) Frame = -3 Query: 903 PPXXXXPPXXXPPXXXSXGG-PPXFXXXPPXXGPPPPXXRXXXXGXPP 763 PP PP PP PP PP PPP PP Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPP 113 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PP TP PP P P P P PP Sbjct: 23 PTSPPT-ATPAPPTPTTPPPAATPPPVSAPPP 53 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/47 (29%), Positives = 16/47 (34%) Frame = -3 Query: 939 PSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPP 799 P+P PP PP P + PP PP PPP Sbjct: 34 PTPTTPPPAATPPPVSAPPPVTTSPPPVTT-APPPANPPPPVSSPPP 79 >At1g55540.1 68414.m06356 proline-rich family protein contains proline rich extensin domain, INTERPRO:IPR002965 Length = 915 Score = 27.9 bits (59), Expect(2) = 0.37 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +1 Query: 568 GGXXGXGXG-GGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPG 690 GG G GG G G GGGG G G G F G Sbjct: 822 GGFAALASGSGGFAGAAPGGGGGGFGGLGSGTGGFGGFAPQG 863 Score = 23.4 bits (48), Expect(2) = 0.37 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +1 Query: 799 GGGXPXGXXXGEXGGXXXGXXPG-GGXXWGXXXGGG 903 GG P G G G G G GG G GGG Sbjct: 857 GGFAPQGSSGGFAGAAGGGGFGGFGGQAQGQAGGGG 892 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PPP + PPP P PPP P PP Sbjct: 365 PVPPP--RRSPPPLQTPPPPPPPPPLAPPPPP 394 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXP 579 PPP PPPP P PPP P Sbjct: 373 PPPLQTPPPPPPPPPLAPPPPPQKRP 398 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -1 Query: 410 PXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 P PP++ P P PPPL P PP Sbjct: 365 PVPPPRRSPPPLQTPPPPPPPPPLAPPPPP 394 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 911 KXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 K P PP P PPP P PP P PPPP Sbjct: 363 KSPVPP---PRRSPPPLQTPPPPPP----PPPLAPPPPP 394 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG 906 GGGG G G G G GGG + GGGG Sbjct: 89 GGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGG 125 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 G G G G G G GGGG + GGG G Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGG 116 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +1 Query: 568 GGXXGXGXG--GGXXGXXXGXGGGGVFXXGGGXG 663 GG G G G G G G GGGG GGG G Sbjct: 92 GGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGG 125 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGG 657 G G G GG G GGGG GGG Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGG 115 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXG--XGGGGVFXXGGGXG 663 GG G GG G G GGGG + GGG G Sbjct: 91 GGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 437 PXXXPFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXPXPP 321 P P PP PKK P P LT P P P PP Sbjct: 91 PPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPP 129 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 P PP K+PPPP P P P P P Sbjct: 90 PPPPAPKKSPPPPTPKKSPSPPSLTPFVPHP 120 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXX--PXXPPPXPXPXXPP 567 P PPP PPP P PPP P PP Sbjct: 126 PSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPP 159 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = -1 Query: 668 FXPXPPPX*KTPPPPXPXXXPXXPPPXP-XPXXPP 567 F P P P PPP P P P P P PP Sbjct: 116 FVPHPTPKKSPSPPPTPSLPPPAPKKSPSTPSLPP 150 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/53 (30%), Positives = 16/53 (30%), Gaps = 4/53 (7%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPP----GXXPXXXPPFSPXXXPXGXPPPP 795 P P PPP PPP P PF P P P PP Sbjct: 77 PSTPIPSTPSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPP 129 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = -1 Query: 662 PXPP-PX*KTPPPPXPXXXPXXPPPXPXPXXP 570 P P P +PPPP P P P P P P Sbjct: 80 PIPSTPSTPSPPPPAPKKSPPPPTPKKSPSPP 111 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 653 PPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PP PPPP P P P P P PP Sbjct: 64 PPPADLPPPPTPYYSPPADLPPPTPIYPP 92 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -1 Query: 941 PXP-PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P P P PPPP P PPP P PP +P P PPP Sbjct: 42 PLPSPVYSSPADLPPPPT--PVYSPPPADLP---PPPTPYYSPPADLPPP 86 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +1 Query: 568 GGXXGX-GXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G G GGG G G GGGG + GG G Sbjct: 79 GGHGGHYGGGGGHYGGGGGHGGGGHYGGGGHHG 111 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPG 690 GG G GG G G GGGG + GGG G + G Sbjct: 69 GGGHGLDGYGGGHGGHYG-GGGGHYGGGGGHGGGGHYGGGG 108 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXN 669 GG G GGG G GGGG GGG G N Sbjct: 86 GGGGGHYGGGGGHGGGGHYGGGG-HHGGGGHGLN 118 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PPP +PPPP P PP P P PP Sbjct: 92 PPP---SPPPPSPPPPSQACPPPPLPPSPP 118 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG 906 GGGG G G GG G G G G GGGG Sbjct: 58 GGGGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGG 94 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXF 678 GG G GG G G GGGG F G G G + F Sbjct: 72 GGWIGGSVGGFGGGIGGGFGGGG-FGGGAGKGVDGGF 107 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 G G G GGG G G GGG+ GG G Sbjct: 64 GGGGFGAGGGWIGGSVGGFGGGIGGGFGGGG 94 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPP--PXPXPXXPP 567 P PP + PPP P P PP P P P PP Sbjct: 162 PDFPPFSPSIPPPSPPYFPPEPPSIPPPPPPSPP 195 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PPP P P P PP+ P P PPPP Sbjct: 158 PPPSPDFPPFSPS---IPPPSPPYFPPEPPSIPPPPP 191 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXG 774 PP P P P P PP P P P PP G Sbjct: 159 PPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPPPSPPSAASGRG 202 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 31.9 bits (69), Expect = 0.65 Identities = 29/113 (25%), Positives = 29/113 (25%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXXXXXX 726 P PP P P P P P P P PP P A Sbjct: 26 PKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPK--------PKPAPAPTPPKPKP 77 Query: 725 XXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P P P P TPP P P P P P P P P Sbjct: 78 APAPTPPKPKPKPAPTPPNPKPTPAP---TPPKPKPAPAPA-PTPAPKPKPAP 126 Score = 31.5 bits (68), Expect = 0.86 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -1 Query: 950 KXXPXPPXXKXXXKXPPPPXXXPHXXP-PPGXXPXXXP-PFSPXXXPXGXPPPP 795 K P PP K P PP P P PP P P P +P P PP P Sbjct: 56 KPAPTPPKPKPAPA-PTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKP 108 Score = 31.5 bits (68), Expect = 0.86 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 2/66 (3%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPP-PPXXXPHXXP-PPGXXPXXXPPFSPXXXPXGXPPPPXX 789 P K P P K K P PP P P PP P P +P P P P Sbjct: 72 PPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKPAPG 131 Query: 788 GXXXGE 771 G E Sbjct: 132 GEVEDE 137 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 1/57 (1%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPP-PPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P K P P K K P PP P P P P P P P PP Sbjct: 39 PPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPP 95 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXP-PPGXXPXXXP-PFSPXXXPXGXPPPP 795 P PP K P PP P P PP P P P P P PP P Sbjct: 37 PTPPKPKPTPA-PTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKP 86 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXP 765 PPPP P P P PP +P G PPP G P Sbjct: 370 PPPPVPAPQM--PSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPP 414 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPX 762 P PP P P PPPG PP P PPPP P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPP--PPGPKGPRPPPPMSLGPKAPRPP 427 Query: 761 GGXA 750 G A Sbjct: 428 SGPA 431 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXP 765 PPPP P P P PP +P G PPP G P Sbjct: 370 PPPPVPAPQM--PSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPP 414 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPX 762 P PP P P PPPG PP P PPPP P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPP--PPGPKGPRPPPPMSLGPKAPRPP 427 Query: 761 GGXA 750 G A Sbjct: 428 SGPA 431 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/52 (30%), Positives = 18/52 (34%) Frame = -1 Query: 950 KXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 K P P + PP P + PPP PP P PPPP Sbjct: 29 KYSPQSPPPQPYVYSPPLPSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPP 80 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPP 798 PP PPPP + PPP PP P PPP Sbjct: 55 PPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPP 100 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXP----XPXXPPF 564 P P P + PPP P PPP P P PP+ Sbjct: 55 PPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPY 91 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXP----XPXXPPF 564 P PPP PPP P PP P P PPF Sbjct: 65 PPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPF 101 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PP PPPP + PP PP P PPPP Sbjct: 65 PPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPP--PPPFVYSSPPPP 109 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PP K+PPPP P PPP PP Sbjct: 87 PRPPYVYKSPPPP-PFVYSSPPPPTYIYNSPP 117 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP P PP PPP PP P PPPP Sbjct: 75 PPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTYIYNSP---PPPP 120 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPPF 564 P PPP PPP P PPP P P PF Sbjct: 9 PPPPPP---PPPRLLVLPPLPPPPPPPPPQLPF 38 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -1 Query: 653 PPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P + PPPP P PP P P PP Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPPPPP 32 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPPF 564 P PPP PP P P PP P PF Sbjct: 12 PPPPPPRLLVLPPLPPPPPPPPPQLPFGPKLPF 44 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = -1 Query: 905 PPPPXXXPH-XXPPPGXXPXXXPPFSPXXXPXGXPPPPXXG 786 PPPP PH PPP PP P G P P G Sbjct: 230 PPPPPPPPHQAQPPPPPPSGLFPPPPPPMANNGFRPMPPAG 270 Score = 31.5 bits (68), Expect = 0.86 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXP 585 P PPP + PPP P PPP P Sbjct: 232 PPPPPPHQAQPPPPPPSGLFPPPPPP 257 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -1 Query: 635 PPPPXPXXXPXXPPPXPXPXXPP 567 PPPP P PPP P PP Sbjct: 231 PPPPPPPHQAQPPPPPPSGLFPP 253 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXG 786 PPPP PPP PP P P PP G Sbjct: 232 PPPPPPHQAQPPPPPPSGLFPPPPPPMANNGFRPMPPAGG 271 >At1g49270.1 68414.m05524 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 699 Score = 31.9 bits (69), Expect = 0.65 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 4/61 (6%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXG----XPPPPXXGXXXGEX 768 PP PPP P PPP PP P G PPPP + Sbjct: 33 PPPSDNQETTSPPPPSSPDIAPPPQQQQESPPPPLPENSSDGSSSSSPPPPSDSSSQSQS 92 Query: 767 P 765 P Sbjct: 93 P 93 >At4g29030.1 68417.m04151 glycine-rich protein glycine-rich protein - Onobrychis viciifolia,PID:g2565429 Length = 115 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = +1 Query: 799 GGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGGXG 942 GG G G GG G G G G GGG + G G Sbjct: 63 GGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLGGGSGIGAGTSGGSTG 110 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +1 Query: 568 GGXXGXGX-GGGXXGXXXGXGGGGVFXXGGGXG 663 GG G G GG G G GGG GGG G Sbjct: 63 GGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLG 95 Score = 25.4 bits (53), Expect(2) = 0.77 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPG 690 G G G G G G GGGV GG G A G Sbjct: 37 GYGGGYSGVGDNGLPFGGVGGGVSGPGGNLGYGGFGGAGG 76 Score = 25.0 bits (52), Expect(2) = 0.77 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGG 903 GG G G G G G GGG G GG Sbjct: 72 GGAGGGLGGGLGGGAGSGLGGGLGGGSGIGAGTSGG 107 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 31.5 bits (68), Expect = 0.86 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 641 KTPPPPXPXXXPXXPPPXPXPXXPP 567 K PPP P P PP P P PP Sbjct: 34 KYSPPPPPVYSPPISPPPPPPPPPP 58 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PPPP P PPP P + PPPP Sbjct: 38 PPPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPP 74 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = -1 Query: 950 KXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 K P PP PPPP P PP P PPPP Sbjct: 34 KYSPPPPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPPSKYGRVYPPPP 85 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G G GGG G GGG GGG G Sbjct: 72 GGGGGRGYGGGGRREGGGYGGGDGGSYGGGGG 103 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G G GGG G GGG GGG G Sbjct: 136 GGGGGRGYGGGGRREGGGYGGGDGGSYGGGGG 167 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 G G G G G G GGGG + GGG G Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGG 116 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGG 903 GGGG G G G G GGG + GGG Sbjct: 89 GGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 580 GXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 G G GG G G GGGG GG G Sbjct: 106 GGGYSGGGGGGYSGGGGGGYERRSGGYG 133 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +1 Query: 568 GGXXGXGXG--GGXXGXXXGXGGGGVFXXGGG 657 GG G G G G G G GGGG GGG Sbjct: 92 GGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGG 123 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGG 657 G G G GG G GGGG GGG Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGG 115 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXG--XGGGGVFXXGGGXG 663 GG G GG G G GGGG + GGG G Sbjct: 91 GGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 >At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / heat shock transcription factor 7 (HSTF7) identical to heat shock factor protein 7 (HSF7) SP:Q9T0D3 from [Arabidopsis thaliana] Length = 377 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGG 636 GG G G GGG G G GGGG Sbjct: 28 GGSSGCGAGGGGGGSGGGGGGGG 50 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 G G GG G G GGGG GGG G Sbjct: 19 GAGCSAGNSGGSSGCGAGGGGGGSGGGGGGGG 50 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG 906 G GG G G GG GGG G GGGG Sbjct: 14 GVGGGGAGCSAGNSGGSSGCGAGGGGGGSGGGGGGGG 50 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 547 PXXXXXXGGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 P GG G G G GGGG GGG G Sbjct: 10 PTVAGVGGGGAGCSAGNSGGSSGCGAGGGGGGSGGGGGG 48 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 668 FXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 F P PPP PPPP P PPP PP Sbjct: 7 FTPPPPP----PPPPSFRSIPRPPPPPSFRSIPP 36 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 31.5 bits (68), Expect = 0.86 Identities = 29/105 (27%), Positives = 30/105 (28%) Frame = +1 Query: 592 GGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKXGAXPPXGX 771 G G G G GGG GG G A G G G Sbjct: 113 GSGFGGRGFGGPGGGYGASDGGYGA----PAGGYGGGAGGYGGNSSYSGNAGGGGGYGGN 168 Query: 772 SPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGG 906 S G GG P GG G GGG +G G GG Sbjct: 169 SSYGGNAGGYGGNPPYSGNAVGGGGGYGSNFGGGGGYGVAGGVGG 213 Score = 29.5 bits (63), Expect = 3.5 Identities = 22/69 (31%), Positives = 23/69 (33%), Gaps = 6/69 (8%) Frame = +1 Query: 748 GAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXP------GGGXXWGXXXGGGGX 909 GA G S GGGG G G G P GGG +G GGGG Sbjct: 145 GAGGYGGNSSYSGNAGGGGGYGGNSSYGGNAGGYGGNPPYSGNAVGGGGGYGSNFGGGGG 204 Query: 910 LXXXLXXGG 936 GG Sbjct: 205 YGVAGGVGG 213 Score = 28.7 bits (61), Expect = 6.1 Identities = 26/103 (25%), Positives = 28/103 (27%), Gaps = 2/103 (1%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGG--GGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVX 741 GG G GGG G G GG GG G N + Sbjct: 117 GGRGFGGPGGGYGASDGGYGAPAGGYGGGAGGYGGNSSYSGNAGGGGGYGGNSSYGGNAG 176 Query: 742 KXGAXPPXGXSPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGG 870 G PP + GGG G G GG GG Sbjct: 177 GYGGNPPYSGNAV------GGGGGYGSNFGGGGGYGVAGGVGG 213 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXP 585 P PPP PPPP P PPP P Sbjct: 22 PLPPPP-PPPPPPMRRRAPLPPPPPP 46 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP + PPPP P P P P P PPPP Sbjct: 30 PPPPMRRRAPLPPPPPPPMRRRAPLP---PPPPPAMRRRVLPRPPPPPP 75 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXP 585 P PPP PPPP P PPP P Sbjct: 39 PLPPP----PPPPMRRRAPLPPPPPP 60 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/58 (27%), Positives = 17/58 (29%) Frame = -3 Query: 936 SPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPP 763 SP + PP PP PP P PPPP R PP Sbjct: 14 SPPMRGRVPLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPP 71 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P + PPPP P P PP P PPPP Sbjct: 15 PPMRGRVPLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPP 60 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -1 Query: 902 PPPXXXPHXXPPP-GXXPXXXPPFSPXXXPXGXPPPPXXGXXXG 774 P P P PPP G P PP P P PPP G G Sbjct: 11 PAPGNYPQGPPPPVGVPPQYYPP--PPPPPPPPPPPRKVGFLEG 52 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P P + PPPP PPP P P PP Sbjct: 11 PAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPP 42 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -2 Query: 961 PGXXXXGPXPPXXXXXPXXPPXPXXXPTXXPP 866 PG GP PP PP P P PP Sbjct: 13 PGNYPQGPPPPVGVPPQYYPPPPPPPPPPPPP 44 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPP 837 P P PPP P PPP P PP Sbjct: 9 PYPAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPPP 43 >At4g16830.1 68417.m02540 nuclear RNA-binding protein (RGGA) identical to nuclear RNA binding protein GI:6492264 from [Arabidopsis thaliana] Length = 355 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGG 903 GGGG P G GE GG PGGG G GG Sbjct: 113 GGGGAPRGSFRGEGGG------PGGGRRGGFSNEGG 142 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 544 APXXXXXXGGXXGXGXGGGXXGXXXGXGGGGVFXXGGG 657 AP GG G GGG G G GGGG GGG Sbjct: 117 APRAYGGGGGYSYGGGGGGYGGGGGGYGGGG--DGGGG 152 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 547 PXXXXXXGGXXGXGXGGGXXGXXXGXGGGGVFXXGGG 657 P GG G GGG G G GG G GGG Sbjct: 115 PSAPRAYGGGGGYSYGGGGGGYGGGGGGYGGGGDGGG 151 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = -3 Query: 903 PPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 PP PP PP + G PP PPPP Sbjct: 124 PPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPP 159 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/48 (33%), Positives = 18/48 (37%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPP 798 P PP + + PPP P PPP P P P PPP Sbjct: 12 PLPPRLELRRQRAPPPQPPP---PPPPPPPPPPPRLGPRLRLRLLPPP 56 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -1 Query: 632 PPPXPXXXPXXPPPXPXPXXPP 567 PPP P P PPP P P P Sbjct: 25 PPPQPPPPPPPPPPPPPPRLGP 46 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXG 786 PPPP P P PP P P PPPP G Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPP--PPPPPPPPPPPPRLG 45 >At3g49840.1 68416.m05449 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 606 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXG 786 PPP P G P P P P PPPP G Sbjct: 533 PPPQQGYGQGYPAQGYPPPQYPQGHPPQYPYQGPPPPHYG 572 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = -3 Query: 942 APSPXXQXXXQXXPPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXG 808 AP P + PP PP PP G P PP G Sbjct: 494 APPPQGYPPKEGYPPAGYPPPAGYPPPQYPQAGYPPAGYPPPQQG 538 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PPP P PP P PP P PP Sbjct: 542 PLPPPARARPLPPPARARPMPPPARARPLPPP 573 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PPP P PP P PP PP Sbjct: 551 PLPPPARARPMPPPARARPLPPPARSYDRRPP 582 >At1g53620.1 68414.m06094 glycine-rich protein Length = 143 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGG 654 GG G G GGG G G GGG GG Sbjct: 70 GGCGGGGDGGGCDGDAGGGDGGGCGGCGG 98 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PPPP PP G P PP P PPPP Sbjct: 30 PPPPQGA--YPPPGGYPPQGYPPPPHGYPPAAYPPPP 64 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 885 PPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPPGGGXPXFXY 736 PP PP PP PP PPPP PP G P Y Sbjct: 25 PPGAYPPPPQGAYPPPG--GYPPQGYPPPPHGYPPAAYPPPPGAYPPAGY 72 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 4/48 (8%) Frame = -1 Query: 905 PPPPXXXPHXXPPP--GXXPXXXPPFSPXXXPXGXPPP--PXXGXXXG 774 PPP P PPP G P PP P G P P P G G Sbjct: 38 PPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGPSGPRPGFGGG 85 Score = 29.5 bits (63), Expect = 3.5 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 903 PPXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPPGGGXPXF 742 P PP PP G PP PP PPPP P G P F Sbjct: 33 PQGAYPPPGGYPPQ----GYPPPPHGYPPAAYPPPPGAYPPAGYPGPSGPRPGF 82 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 899 PPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PP P PPP P PP P P PPPP Sbjct: 869 PPEPPPEMMPPP---PQALPPPLPHSHPPLVPPPP 900 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -1 Query: 437 PXXXPFFXPPXXPPKKXPXPXPLTKXXFXPPPLFXP 330 P P PP PP+ P P P + PPP F P Sbjct: 870 PEPPPEMMPP--PPQALPPPLPHSHPPLVPPPPFSP 903 >At1g21310.1 68414.m02662 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 431 Score = 31.1 bits (67), Expect = 1.1 Identities = 33/137 (24%), Positives = 36/137 (26%), Gaps = 12/137 (8%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXX----P--HXXPPPGXX------PXXXPPFSPXXXPXGXPPP 798 P PP K PPPP P H PPP P +SP PPP Sbjct: 281 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 340 Query: 797 PXXGXXXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXP 618 P P + P PP +PPPP Sbjct: 341 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP--PPVYHSPPPPKE 398 Query: 617 XXXPXXPPPXPXPXXPP 567 PPP P P Sbjct: 399 KYVYKSPPPPPVHHYSP 415 Score = 30.7 bits (66), Expect = 1.5 Identities = 33/137 (24%), Positives = 36/137 (26%), Gaps = 12/137 (8%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXX----P--HXXPPPGXX------PXXXPPFSPXXXPXGXPPP 798 P PP K PPPP P H PPP P +SP PPP Sbjct: 57 PPPPKKHYEYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 116 Query: 797 PXXGXXXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXP 618 P P + P PP +PPPP Sbjct: 117 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP--PPVYHSPPPPKK 174 Query: 617 XXXPXXPPPXPXPXXPP 567 PPP PP Sbjct: 175 HYVYKSPPPPVKHYSPP 191 Score = 30.7 bits (66), Expect = 1.5 Identities = 33/137 (24%), Positives = 36/137 (26%), Gaps = 12/137 (8%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXX----P--HXXPPPGXX------PXXXPPFSPXXXPXGXPPP 798 P PP K PPPP P H PPP P +SP PPP Sbjct: 85 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 144 Query: 797 PXXGXXXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXP 618 P P + P PP +PPPP Sbjct: 145 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP--PPVYHSPPPPKK 202 Query: 617 XXXPXXPPPXPXPXXPP 567 PPP PP Sbjct: 203 HYVYKSPPPPVKHYSPP 219 Score = 30.7 bits (66), Expect = 1.5 Identities = 33/137 (24%), Positives = 36/137 (26%), Gaps = 12/137 (8%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXX----P--HXXPPPGXX------PXXXPPFSPXXXPXGXPPP 798 P PP K PPPP P H PPP P +SP PPP Sbjct: 113 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 172 Query: 797 PXXGXXXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXP 618 P P + P PP +PPPP Sbjct: 173 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP--PPVYHSPPPPKK 230 Query: 617 XXXPXXPPPXPXPXXPP 567 PPP PP Sbjct: 231 HYVYKSPPPPVKHYSPP 247 Score = 30.7 bits (66), Expect = 1.5 Identities = 33/137 (24%), Positives = 36/137 (26%), Gaps = 12/137 (8%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXX----P--HXXPPPGXX------PXXXPPFSPXXXPXGXPPP 798 P PP K PPPP P H PPP P +SP PPP Sbjct: 141 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 200 Query: 797 PXXGXXXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXP 618 P P + P PP +PPPP Sbjct: 201 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP--PPVYHSPPPPKK 258 Query: 617 XXXPXXPPPXPXPXXPP 567 PPP PP Sbjct: 259 HYVYKSPPPPVKHYSPP 275 Score = 30.7 bits (66), Expect = 1.5 Identities = 33/137 (24%), Positives = 36/137 (26%), Gaps = 12/137 (8%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXX----P--HXXPPPGXX------PXXXPPFSPXXXPXGXPPP 798 P PP K PPPP P H PPP P +SP PPP Sbjct: 169 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 228 Query: 797 PXXGXXXGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXP 618 P P + P PP +PPPP Sbjct: 229 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP--PPVYHSPPPPKK 286 Query: 617 XXXPXXPPPXPXPXXPP 567 PPP PP Sbjct: 287 HYVYKSPPPPVKHYSPP 303 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PPP +PPPP PPP PP Sbjct: 50 PPPVYHSPPPPKKHYEYKSPPPPVKHYSPP 79 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPP 837 P PP K K PPPP H PP PP Sbjct: 393 PPPPKEKYVYKSPPPPPVH-HYSPPHHPYLYKSPP 426 >At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein similar to human splicing factor GB:CAA59494 GI:899298 from [Homo sapiens]; contains Pfam profile PF01805: Surp module Length = 735 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXP 579 PPP + PPPP P P P P P Sbjct: 641 PPPMAEMPPPPPPGEAPPPLPEEPEP 666 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGGGVFXXGGG 657 G G G GGG G GGGG GGG Sbjct: 68 GGGGGGSGGGQRSSSGGGGGGGEGDGGGG 96 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGG 657 GG G G GGG G GGGG GGG Sbjct: 51 GGEGGGGEGGGGQKISKGGGGGG---SGGG 77 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 580 GXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 G G GGG G GGG GGG G Sbjct: 45 GGGEGGGGEGGGGEGGGGQKISKGGGGG 72 >At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly identical to RNA helicase [Arabidopsis thaliana] GI:1488521; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 671 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 592 GGGXXGXXXGXGGGGVFXXGGGXG 663 GGG G G GGG F GGG G Sbjct: 637 GGGGRGNRFGGGGGNRFGGGGGRG 660 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXP 579 PPP PP P P PPP P P Sbjct: 98 PPPQPPPPPQPLNLFSPPPPPPPPDP 123 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = +1 Query: 568 GGXXGXGXGGGXX----GXXXGXGGGGVFXXGGGXG 663 GG G G GGG G G GGGG GGG G Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 >At4g21720.1 68417.m03145 expressed protein Length = 139 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = -1 Query: 641 KTPPPPXPXXXPXXPPP-XPXPXXPP 567 K PPPP P P PPP P PP Sbjct: 105 KRPPPPPPKPQPPPPPPRSQKPMQPP 130 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPP 594 P PPP + PPPP P PP Sbjct: 108 PPPPPKPQPPPPPPRSQKPMQPP 130 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPP 591 P PPP PPPP P PP Sbjct: 107 PPPPPPKPQPPPPPPRSQKPMQPP 130 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/56 (28%), Positives = 16/56 (28%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P P P PP P P PP P P S P P PP Sbjct: 138 PSSPPSTPSTPSSPPSPPSPPSPSLPPSSLPPSASPPTNGTPDSETLTPPPAPLPP 193 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 30.7 bits (66), Expect = 1.5 Identities = 27/110 (24%), Positives = 28/110 (25%), Gaps = 3/110 (2%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGXAXXXXXXXX 726 PPP PP P PP P PP G GG + Sbjct: 89 PPPAAMARPGGPPQVSQPGGFPPVGRPVAPPSNQPPFGGRPSTGPLVGGGSSFPQPGGFP 148 Query: 725 XXXXXXXXXXXXP-GAXKXXFXPXPP--PX*KTPPPPXPXXXPXXPPPXP 585 P GA F PP P PPP P P P Sbjct: 149 ASGPPGGVPSGPPSGARPIGFGSPPPMGPGMSMPPPSGMPGGPLSNGPPP 198 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 668 FXPXPPPX*KTPPPPXPXXXPXXPPPXPXP 579 F P PP T PP P PPP P P Sbjct: 122 FSPPPPDLDTTTAPPPPSTDIPIPPPPPAP 151 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = -1 Query: 941 PXPPXXKXXXKXPPP--PXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP PPP P P PPP P P PPPP Sbjct: 99 PNPPAPIVNPNPPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPP 149 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PPP PPP PP P PP Sbjct: 116 PNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPP 147 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPP 798 P PP PPP P PPP PP +P P P Sbjct: 124 PPPPDLDTTTAPPPPSTDIPIPPPPPAPV-SASPPLTPPSSVVTSPAP 170 >At3g04640.1 68416.m00497 glycine-rich protein predicted proteins, Arabidopsis thaliana Length = 159 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGG 657 GG G GGG G GGGG GGG Sbjct: 73 GGGGGGRGGGGFGGGGRSFGGGGSSSRGGG 102 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGGXG 942 GGGG G GG G GGG + GGGG GG G Sbjct: 113 GGGGSYGGGGGRREGG---GGYSGGGGGYSSRGGGGGSYGGGRREGGGG 158 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXG-XGGGGVFXXGGG 657 GG G G GG G G GGGG + GGG Sbjct: 93 GGHRGGGGGGYRSGGGGGYSGGGGSYGGGGG 123 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGG 657 GG G GGG G GGGG GGG Sbjct: 100 GGGYRSGGGGGYSGGGGSYGGGGGRREGGG 129 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G G G G GGGG GGG G Sbjct: 115 GGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 146 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXG--XGGGGVFXXGGG 657 GG G GGG G G GGGG GGG Sbjct: 106 GGGGGYSGGGGSYGGGGGRREGGGGYSGGGGG 137 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G GGG G GGGG GGG G Sbjct: 136 GGYSSRGGGGGSYGGGRREGGGG---YGGGEG 164 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 G G G GG G GGGG GG G Sbjct: 88 GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYG 119 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -3 Query: 900 PXXXXPPXXXPPXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPPGGG 754 P PP PP G P PP PPP G P GGG Sbjct: 155 PPVTTPPGLLPPVTTPPGLLPPIINPPPVT-VPPPSSGYPPYGPPSGGG 202 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +1 Query: 757 PPXGXSPXXXPXXGGGGXPXGXXXGEXGG--XXXGXXPGGGXXWGXXXGGGG 906 PP P GGG P G+ GG G GG G GGGG Sbjct: 35 PPVPKPPQHGGGGGGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGGGG 86 Score = 28.3 bits (60), Expect = 8.0 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 7/61 (11%) Frame = -1 Query: 935 PPXXKXXXKXPP---PPXXXPHXXPPPGXXP--XXXPPFSPXXXPXGXPP--PPXXGXXX 777 PP PP PP P PPG P PP + G PP PP G Sbjct: 145 PPITTPPGLLPPVTTPPGLLPPVTTPPGLLPPIINPPPVTVPPPSSGYPPYGPPSGGGGG 204 Query: 776 G 774 G Sbjct: 205 G 205 >At1g12810.1 68414.m01488 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 129 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -1 Query: 902 PPPXXXPHXXPPPGXXPXXXPPF--SPXXXPXGXPPPPXXG 786 PPP H PPPG PP SP G PPP G Sbjct: 12 PPPGYQSHY-PPPGYPSAPPPPGYPSPPSHHEGYPPPQPYG 51 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = -3 Query: 885 PPXXXPPXXXSXGGPPXFXXXPPXXG-PPPPXXRXXXXGXPPGGGXP 748 P PP S PP + PP G P PP P GG P Sbjct: 8 PESYPPPGYQSHYPPPGYPSAPPPPGYPSPPSHHEGYPPPQPYGGYP 54 >At1g04660.1 68414.m00463 glycine-rich protein Length = 212 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGG---GGVFXXGGGXG 663 GG G G G G G G GG GGV GGG G Sbjct: 127 GGLGGVGGGVGGLGGVGGLGGAGLGGVGGVGGGIG 161 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G G GG G G G G GGG G Sbjct: 167 GGLGGLGGAGGGLGGVGGLGKAGGIGVGGGIG 198 >At3g54590.1 68416.m06040 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 743 Score = 26.6 bits (56), Expect(2) = 1.8 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 5/57 (8%) Frame = -1 Query: 950 KXXPXP---PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXP--XGXPPPP 795 K P P P K K PP P PPP P + P PPPP Sbjct: 644 KSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPP 700 Score = 22.2 bits (45), Expect(2) = 1.8 Identities = 10/33 (30%), Positives = 12/33 (36%) Frame = -1 Query: 677 KXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXP 579 K + PPP +P P P P P P Sbjct: 707 KVYYKSPPPPSYYSPSPKVEYKSPPPPSYSPSP 739 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXP-PPGXXPXXXPPFSPXXXPXGXPP 801 PG + P PP P P H P PP P PP P G PP Sbjct: 350 PGMLRFPPPPPPLDMHP--PHPGMFVGHLIPRPPYGPPPGPPPMMRPPLPPGPPP 402 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGG 756 PPPP P P P PP S PPP G P G Sbjct: 50 PPPPSPPPPSTPTTACPPPPSPPSSGGGSSYYYPPPSQSGGGSKYPPPYG 99 >At5g35190.1 68418.m04170 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 328 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P K K PPPP PPP P SP PPPP Sbjct: 239 PSPKVDYKSPPPPYVYSSPPPPPYYSP------SPEVSYKSPPPPP 278 Score = 29.9 bits (64), Expect = 2.6 Identities = 32/132 (24%), Positives = 37/132 (28%), Gaps = 6/132 (4%) Frame = -1 Query: 941 PXPPXX----KXXXKXPPPPXXXPHXXPPP--GXXPXXXPPFSPXXXPXGXPPPPXXGXX 780 P PP K K PPPP + PPP P FSP P PP Sbjct: 157 PPPPYYSLSPKVDYKSPPPPYVY-NSPPPPYYSPSPKVDYKFSPPPYVYNSPSPPYYSPS 215 Query: 779 XGEXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXX 600 P + K + PPP + PPP P P Sbjct: 216 P-------KVDYKSPPPPYVYNSPPPPYFSP-SPKVDYKSPPPPYVYSSPPPPPYYSPSP 267 Query: 599 PPPXPXPXXPPF 564 P PP+ Sbjct: 268 EVSYKSPPPPPY 279 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/48 (33%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXP--XGXPPPP 795 P K K PPPP + PPP P + P PPPP Sbjct: 89 PSPKEDYKSPPPPYVY-NSPPPPYYSPSPKVDYKSPPPPYVYNSPPPP 135 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 6/58 (10%) Frame = -1 Query: 941 PXPPXXKXXXKXPP-----PPXXXPHXXPP-PGXXPXXXPPFSPXXXPXGXPPPPXXG 786 P PP PP PP P PP P PP SP P PPP G Sbjct: 16 PSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSP--LPPSLPPPSPPG 71 Score = 29.5 bits (63), Expect = 3.5 Identities = 25/106 (23%), Positives = 26/106 (24%), Gaps = 4/106 (3%) Frame = -1 Query: 872 PPPGXXPXXXPPFSPXXXPXGXPPP----PXXGXXXGEXPXGGXAXXXXXXXXXXXXXXX 705 P PG P PP P PPP P P Sbjct: 5 PSPGTTPSPSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSL 64 Query: 704 XXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PG+ P TP PP P P P P P P Sbjct: 65 PPPSPPGSLTPPLPQPSPSAPITPSPPSP-TTPSNPRSPPSPNQGP 109 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -1 Query: 632 PPPXPXXXPXXPPPXPXPXXPPFXXXXXGA 543 PPP P P PPP P P P F G+ Sbjct: 217 PPPKPPSPPRKPPPPPPP--PAFMSSSGGS 244 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/48 (31%), Positives = 15/48 (31%), Gaps = 1/48 (2%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPF-SPXXXPXGXPPPP 795 PP PPP P PPP PP P P PP Sbjct: 44 PPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPP 91 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGG---GGVFXXGGGXG 663 G G G GGG G G GG GG F G G G Sbjct: 69 GAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAGGG 103 Score = 29.5 bits (63), Expect = 3.5 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGGXG 942 GGG G G G G GGG G GGGG L GG G Sbjct: 54 GGGAGLGGLGIGAGIGAGAGLGLGGGGG-GLGGGGGGLLGGGGFGGGAG 101 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGG 657 G G G G G G G GGGG GGG Sbjct: 65 GAGIGAGAGLGLGGGGGGLGGGGGGLLGGG 94 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 G G G GGG G G G GG GGG G Sbjct: 77 GGGGGGLGGGGGGLLGGGGFGG--GAGGGLG 105 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 30.3 bits (65), Expect = 2.0 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 2/65 (3%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXG--XPPPPXX 789 PG P PP K P PPPG PP P G PPPP Sbjct: 227 PGRAALPPPPPLPMAVRKGVAAPPL-----PPPGTAALPPPPPLPMAAGKGVAAPPPPPP 281 Query: 788 GXXXG 774 G G Sbjct: 282 GARGG 286 Score = 28.7 bits (61), Expect = 6.1 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 9/48 (18%) Frame = -1 Query: 683 AXKXXFXPXPPPX*KT---PPPPXP------XXXPXXPPPXPXPXXPP 567 A K + P PPP + PPPP P P PPP PP Sbjct: 215 AEKESYAPLPPPPGRAALPPPPPLPMAVRKGVAAPPLPPPGTAALPPP 262 >At5g22560.1 68418.m02635 hypothetical protein contains Pfam profile PF03140: Plant protein of unknown function Length = 517 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -1 Query: 653 PPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PP +T PP P P P P P PP Sbjct: 299 PPPIETKTPPLPPPPPTLTQPHPKPLTPP 327 >At5g10550.1 68418.m01221 DNA-binding bromodomain-containing protein low similarity to kinase [Gallus gallus] GI:1370092; contains Pfam profile PF00439: Bromodomain Length = 678 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PPP + P P P PPP P P P Sbjct: 411 PPPVIEITRDPSPPPSPVQPPPPPSPPPQP 440 >At4g29240.1 68417.m04182 leucine-rich repeat family protein / extensin family protein contains Pfam PF00560: Leucine Rich Repeat domains; similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana] Length = 415 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPG 690 GG G G GGG G GGGGV+ GG PG Sbjct: 33 GGGVGVGIGGG-----GGGGGGGVWVGGGYNNGGNRNAVPG 68 >At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containing protein similar to Hsc70-interacting protein (Hip) from {Homo sapiens} SP|P50502, {Rattus norvegicus} SP|P50503; contains Pfam profile PF00515: tetratricopeptide repeat (TPR) domain Length = 441 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 761 PGGXPXXXXLXMGGGGPXXGGXXXKXGGPPXEXXXGGXXXGGXXXXGG 904 PGG MGGG P GG G GG GG GG Sbjct: 335 PGGMGGGMPAGMGGGMPGMGGGMPAGMGGGGMPGAGGGMPGGGGMPGG 382 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 799 GGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXL 912 GGG P G G GG G G G G GG G + Sbjct: 290 GGGFPGGMPGGFPGGMPGGFPGGMGGMPGGFPGGMGGM 327 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = -1 Query: 656 PPPX*KTPP--PPXPXXXPXXPPPXPXPXXP 570 PPP TPP P P P PPP P P Sbjct: 62 PPPMPMTPPPMPMTPPPMPMAPPPMPMASPP 92 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PP PPP P P P PP P PPP Sbjct: 39 PPMSSGGGSSVPPPVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPPP 85 >At4g08410.1 68417.m01390 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 707 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXP--XGXPPPP 795 P K K PPPP PPP P + P P PPPP Sbjct: 442 PSPKVDYKSPPPPYV-YSSPPPPYYSPSPKVDYKPPPPPYVYSSPPPP 488 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXP--XGXPPPP 795 P K K PPPP PPP P + P G PPPP Sbjct: 242 PSPKVDYKSPPPPYVY-SSPPPPYYSPSPKVNYKSPPPPYVYGSPPPP 288 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXP--XGXPPPP 795 P K K PPPP PPP P + P G PPPP Sbjct: 292 PSPKVDYKSPPPPYVY-SSPPPPYYSPSPKVNYKSPPPPYVYGSPPPP 338 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 29.9 bits (64), Expect = 2.6 Identities = 28/127 (22%), Positives = 34/127 (26%), Gaps = 3/127 (2%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXX---PPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXP 765 PP K PP P PPP PP+ P PP P Sbjct: 288 PPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPP 347 Query: 764 XGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXP 585 + + + PPP +PPPP P PPP Sbjct: 348 YVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYTYSPPPYAYSPPPPCPDV--YKPPPYV 405 Query: 584 XPXXPPF 564 PP+ Sbjct: 406 YSSPPPY 412 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/51 (29%), Positives = 16/51 (31%), Gaps = 4/51 (7%) Frame = -3 Query: 903 PPXXXXPPXXXP----PXXXSXGGPPXFXXXPPXXGPPPPXXRXXXXGXPP 763 PP PP P P PP + PP PPP PP Sbjct: 385 PPYAYSPPPPCPDVYKPPPYVYSSPPPYVYNPPPSSPPPSPSYSYSSPPPP 435 >At4g03120.1 68417.m00425 proline-rich family protein similar to U1 small nuclear ribonucleoprotein C; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 207 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/62 (29%), Positives = 19/62 (30%), Gaps = 1/62 (1%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXP-HXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXP 765 P PP + PP P PPG P P G PPPP P Sbjct: 125 PLPPPPQNGILRPPGMAPIPGQGGGPPGMAPIPGQGGGPPPNYNGLPPPPPYHTNPAAPP 184 Query: 764 XG 759 G Sbjct: 185 SG 186 Score = 28.7 bits (61), Expect = 6.1 Identities = 19/62 (30%), Positives = 20/62 (32%), Gaps = 3/62 (4%) Frame = -1 Query: 962 PGXXKXXPXPPXXKXXXKXPP---PPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPX 792 PG PP P PP P PPG P PP + P G P P Sbjct: 87 PGSMPMGMRPPVLPRPMMPPQGYMPPPGVPQMMAPPG-APLPPPPQNGILRPPGMAPIPG 145 Query: 791 XG 786 G Sbjct: 146 QG 147 >At3g54580.1 68416.m06039 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 951 Score = 29.9 bits (64), Expect = 2.6 Identities = 30/125 (24%), Positives = 35/125 (28%), Gaps = 7/125 (5%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXP-----HXXPPPGXXPXXXPP--FSPXXXPXGXPPPPXXGXXXG 774 P K K PPPP P + PPP PP +SP PPP Sbjct: 537 PSPKVYYKSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSP 596 Query: 773 EXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPP 594 P + + P P K+PPPP P P Sbjct: 597 PPPYHSPS------PKVQYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 650 Query: 593 PXPXP 579 P P Sbjct: 651 YSPSP 655 Score = 29.9 bits (64), Expect = 2.6 Identities = 31/125 (24%), Positives = 36/125 (28%), Gaps = 7/125 (5%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXP-----HXXPPPGXXPXXXPP--FSPXXXPXGXPPPPXXGXXXG 774 P K K PPPP P + PPP PP +SP PPP Sbjct: 754 PSPKVHYKSPPPPYYAPTPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPP--YVYS 811 Query: 773 EXPXGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPP 594 P + P + P P K+PPPP P P Sbjct: 812 SPPPPYYSPSPKVEYKSPPPPYVYSSPPP----PYYSPSPKVDYKSPPPPYVYSSPPPPY 867 Query: 593 PXPXP 579 P P Sbjct: 868 YSPSP 872 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPP 591 P PPP KT P P P PPP Sbjct: 138 PSPPPPSKTHEPSRPNTPPPPPPP 161 >At3g13225.1 68416.m01660 WW domain-containing protein contains Pfam profile PF00397: WW domain Length = 863 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXG 786 PPPP PPP PP P PPPP G Sbjct: 508 PPPPGE--EWIPPPPSESEDVPPPPPDSYSEPIPPPPDNG 545 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 P PPP TP PP PPP P P Sbjct: 193 PPPPPPPPTPRPPRLLSSQPAPPPTPPVSLP 223 >At2g16630.1 68415.m01909 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 359 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -1 Query: 668 FXPXPPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 F P PP PPP P P P P P P Sbjct: 147 FCPKPPTAPVMPPPQVPVMPPPQVPVKPHPKVP 179 >At2g04190.1 68415.m00404 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 411 Score = 29.9 bits (64), Expect = 2.6 Identities = 28/104 (26%), Positives = 29/104 (27%), Gaps = 3/104 (2%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPGXXXXXXXXXXXXXXXVXKXG 750 G G G G G GGGG G G G PG + G Sbjct: 8 GGWGDFPGKGVGSCVFGGGGGGPAFGGRGGG-------PGRGYGGGPRVHGPGYGIGSRG 60 Query: 751 AXPPXGX---SPXXXPXXGGGGXPXGXXXGEXGGXXXGXXPGGG 873 P G P GGGG G G G GGG Sbjct: 61 PDPGPGFFFGGAGPGPGYGGGGGHGPGYGGGGDGRGYGSETGGG 104 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PPP P PPP P P PPPP Sbjct: 147 PPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPP 183 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PPPP P PP PP P PPP Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPP 182 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXP-PPXPXPXXP 570 PPP PP P P P PP P P P Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEPPPP 175 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PPP PP P P PP P PP Sbjct: 152 PPPESLPPPSPESPSPPSPEPPPPSSLEPP 181 >At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 359 Score = 29.9 bits (64), Expect = 2.6 Identities = 29/127 (22%), Positives = 30/127 (23%), Gaps = 2/127 (1%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPX 762 P PP P P PP P PP P P PP + P Sbjct: 50 PHPPHHHHPHPHPHPHPPAKSPVKPPVKAP-VSPPAKPPVKPPVYPPTKAPVKPPTKPPV 108 Query: 761 GGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTP--PPPXPXXXPXXPPPX 588 K P P K P PP P P PP Sbjct: 109 KPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPT 168 Query: 587 PXPXXPP 567 P PP Sbjct: 169 KAPVKPP 175 Score = 29.9 bits (64), Expect = 2.6 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 8/57 (14%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPP------PGXXPXXXPPFSPXXXPXGXPP--PP 795 P P K K P P P PP P P PP SP P PP PP Sbjct: 143 PVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPP 199 >At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ZF-HD homeobox protein-related predicted proteins, Arabidopsis thaliana Length = 334 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/47 (29%), Positives = 15/47 (31%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P + PPPP P P PP P P PPP Sbjct: 108 PDNNNDSSQIPPPPSTAVEYQPHHRHHPPPPPPPPPPRSPNSASPPP 154 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PPP P PP P P PP P PP Sbjct: 351 PPPPPSFPVPLPPVP-GLPGIPPVPLIPGIPP 381 >At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; glycine-rich protein 14 (GRP14) PMID:11431566; PIR:JQ1063 Length = 193 Score = 29.5 bits (63), Expect = 3.5 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = +1 Query: 799 GGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGGGXLXXXLXXGGXG 942 GGG G G+ GG G GGG G GGG L L G G Sbjct: 101 GGGRRFGGRFGKPGGGGLG---GGGLPGGLGGLGGGGLPGGLGGLGGG 145 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 G G G GGG G G GGGG+ GG G Sbjct: 114 GGGGLG-GGGLPGGLGGLGGGGLPGGLGGLG 143 >At4g08400.1 68417.m01388 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 513 Score = 29.5 bits (63), Expect = 3.5 Identities = 30/127 (23%), Positives = 36/127 (28%), Gaps = 5/127 (3%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXPXGGX 753 P K K PPPP + PPP P P +P PPP Sbjct: 174 PSPKVDYKSPPPPYV--YSSPPP---PYYSP--TPKVDYKSPPPPYVYSSPPPPYYSPSP 226 Query: 752 AXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXP-----XXPPPX 588 + K + PPP ++PPPP P PPP Sbjct: 227 KVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYYRSPPPPYYSPSPKVDYKSPPPPY 286 Query: 587 PXPXXPP 567 PP Sbjct: 287 VYSSPPP 293 >At3g62680.1 68416.m07041 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 313 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/30 (36%), Positives = 12/30 (40%) Frame = -3 Query: 885 PPXXXPPXXXSXGGPPXFXXXPPXXGPPPP 796 PP PP PP + P PPPP Sbjct: 137 PPVYTPPVYKPTPSPPVYKKSPSYSSPPPP 166 >At3g46740.1 68416.m05074 chloroplast outer envelope protein, putative similar to chloroplastic outer envelope membrane protein (OEP75) [Pisum sativum] GI:633607; contains Pfam profile PF01103: outer membrane protein, OMP85 family Length = 818 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +1 Query: 586 GXGGGXXGXXXGXGGGGVFXXGGGXGXNXXF 678 G GGG G G GGGG GGG G + F Sbjct: 102 GGGGGGDGNFGGFGGGG----GGGDGNDGGF 128 >At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to SP|P52597 Heterogeneous nuclear ribonucleoprotein F (hnRNP F) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 350 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXG 651 GG G G G G G G GGGG G Sbjct: 211 GGGGGLGGGNGSGGGGGGGGGGGRISGG 238 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = -1 Query: 635 PPPPXP--XXXPXXPPPXPXPXXPPF 564 PPPP P P PPP P P P + Sbjct: 55 PPPPLPDFAPQPLLPPPSPPPPPPAY 80 >At2g05540.1 68415.m00586 glycine-rich protein Length = 135 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGG 657 GG G G GG G G GGG GGG Sbjct: 48 GGFPGGGYGGFPGGGYGGNPGGGYGNRGGG 77 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGG 657 GG G GGG G GG G GGG Sbjct: 187 GGGGSFGGGGGGGAGSYGGGGAGAGSGGGG 216 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 G G GGG G GGGG GG G Sbjct: 186 GGGGGSFGGGGGGGAGSYGGGGAGAGSGGGG 216 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G GGG G GGG GGG G Sbjct: 186 GGGGGSFGGGGGGGAGSYGGGGAGAGSGGGGG 217 >At1g15130.1 68414.m01807 hydroxyproline-rich glycoprotein family protein Length = 846 Score = 26.2 bits (55), Expect(2) = 3.9 Identities = 16/62 (25%), Positives = 19/62 (30%), Gaps = 3/62 (4%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXP---PPPXXGXXXGE 771 P P + PPPP + P P PP P PPP G+ Sbjct: 735 PYPSVHQPTASSPPPPPETQNPSHPHPHAPYYRPPEQMSRPGYSIPPYGPPPPYHTPHGQ 794 Query: 770 XP 765 P Sbjct: 795 AP 796 Score = 21.4 bits (43), Expect(2) = 3.9 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = -1 Query: 650 PX*KTPPPPXPXXXPXXPP 594 P + P PP P P PP Sbjct: 819 PQGQQPRPPYPGQSPYQPP 837 >At3g21215.1 68416.m02681 RNA-binding protein, putative contains RNA recognition motif, Pfam:PF00076; contains AT-AC splice sites at intron 8 Length = 339 Score = 25.8 bits (54), Expect(2) = 4.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = -1 Query: 689 PGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPP 591 P A P PPP PPPP PP Sbjct: 22 PAAVSSAAPPHPPPIHHHPPPPPVLVDNHNRPP 54 Score = 21.8 bits (44), Expect(2) = 4.2 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -1 Query: 839 PFSPXXXPXGXPPPP 795 P+ P G PPPP Sbjct: 8 PYHQQWPPAGAPPPP 22 >At5g65630.1 68418.m08256 DNA-binding bromodomain-containing protein similar to 5.9 kb fsh membrane protein [Drosophila melanogaster] GI:157455; contains Pfam profile PF00439: Bromodomain Length = 590 Score = 29.1 bits (62), Expect = 4.6 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 638 TPPPPXPXXXPXXPPPXPXP 579 +PPPP P P P P P P Sbjct: 348 SPPPPPPVIQPELPQPQPPP 367 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 P PP PPPP P P P P SP G PP Sbjct: 95 PPPPRFYYFESTPPPPPLSPDGKGSPPSVPSSPP--SPKGQSQGQQQPP 141 >At5g04970.1 68418.m00526 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 624 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 PP T PP P P PPP P P Sbjct: 51 PPTQPPTQPPSHPPTQPPTPPPSQSPSQP 79 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PP T PP P P PP P P P Sbjct: 47 PPSQPPTQPPTQPPSHPPTQPPTPPPSQSP 76 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 29.1 bits (62), Expect = 4.6 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 638 TPPPPXPXXXPXXPPPXPXP 579 +PPPP P PPP P P Sbjct: 266 SPPPPPPGSWQPSPPPPPPP 285 >At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 202 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGG 657 GG G G G G G GGGG F GGG Sbjct: 9 GGFRGRGGRDGGGGGRFG-GGGGRFGGGGG 37 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGG 657 GG G G G G GGGG F GGG Sbjct: 15 GGRDGGGGGRFGGGGGRFGGGGGRFGGGGG 44 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 586 GXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPG 690 G GGG G G GGG GGG G F G Sbjct: 19 GGGGGRFGGGGGRFGGGGGRFGGGGGRFGGFRDEG 53 >At1g76930.2 68414.m08956 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 256 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXP---XXPPPXPXPXXPP 567 PPP K+PPPP P PP P PP Sbjct: 71 PPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPP 103 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 PPP K+PPPP P PP P P Sbjct: 39 PPPVYKSPPPPVKHYSP--PPVYKSPPPP 65 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 PPP K+PPPP P PP P P Sbjct: 55 PPPVYKSPPPPVKHYSP--PPVYKSPPPP 81 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 PPP K+PPPP P PP P P Sbjct: 95 PPPVYKSPPPPVKHYSP--PPVYKSPPPP 121 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 PPP K+PPPP P PP P P Sbjct: 111 PPPVYKSPPPPVKHYSP--PPVYKSPPPP 137 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 PPP K+PPPP P PP P P Sbjct: 127 PPPVYKSPPPPVKHYSP--PPVYKSPPPP 153 >At1g76930.1 68414.m08955 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 293 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXP---XXPPPXPXPXXPP 567 PPP K+PPPP P PP P PP Sbjct: 71 PPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPP 103 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 PPP K+PPPP P PP P P Sbjct: 39 PPPVYKSPPPPVKHYSP--PPVYKSPPPP 65 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 PPP K+PPPP P PP P P Sbjct: 55 PPPVYKSPPPPVKHYSP--PPVYKSPPPP 81 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 PPP K+PPPP P PP P P Sbjct: 95 PPPVYKSPPPPVKHYSP--PPVYKSPPPP 121 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 PPP K+PPPP P PP P P Sbjct: 111 PPPVYKSPPPPVKHYSP--PPVYKSPPPP 137 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXP 570 PPP K+PPPP P PP P P Sbjct: 127 PPPVYKSPPPPVKHYSP--PPVYKSPPPP 153 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 29.1 bits (62), Expect = 4.6 Identities = 18/60 (30%), Positives = 21/60 (35%), Gaps = 3/60 (5%) Frame = -2 Query: 913 PXXPPXPXXXPTXXPPXAXFPRXXPXFXXXPXRXGX---PPPHXQGXXXGXPPXGGXPXF 743 P PP P P P + P P P R G P + Q G PP G P + Sbjct: 50 PLVPPGPPYAPPAQIPSSLLPTNLPP--PPPFRPGMQFTPVANFQNPSSGVPPPGSMPQY 107 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 580 GXGXGGGXXGXXXGXGGGGVFXXGGG 657 G GGG G G GGGG GGG Sbjct: 780 GHHGGGGCGGGHHGGGGGGCGGCGGG 805 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G GGG G G GGGG G G G Sbjct: 785 GGCGGGHHGGG-GGGCGGCGGGGCGGGGDGGG 815 >At1g30780.1 68414.m03763 F-box family protein Length = 482 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPP 798 P P + PPPP P PP P PP P P P Sbjct: 60 PDFPSFQEAVAPPPPPPDLPLLAPPLPDVPLLPPPAFPDFEKPRLPVP 107 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = +1 Query: 580 GXGXGGGXXGXXX-GXGGGGVFXXGGGXG 663 G G GGG G G GGGG GGG G Sbjct: 39 GGGEGGGGEGTSGEGGGGGGDGTKGGGDG 67 >At5g56140.1 68418.m07003 KH domain-containing protein Length = 315 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 580 GXGXGGGXXGXXXGXGGGGVF 642 G G GGG G G GGGG F Sbjct: 9 GGGGGGGGSGGGIGGGGGGRF 29 >At4g23470.2 68417.m03383 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 199 Score = 28.7 bits (61), Expect = 6.1 Identities = 17/51 (33%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXP---PPGXXPXXXPPFSPXXXPXG-XPPPP 795 PP + PP P P PP P PP + P G PPPP Sbjct: 145 PPAVGYPPQQGYPPSGYPQHPPQGYPPSGYPQNPPPSAYSQYPPGAYPPPP 195 >At4g23470.1 68417.m03382 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 255 Score = 28.7 bits (61), Expect = 6.1 Identities = 17/51 (33%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXP---PPGXXPXXXPPFSPXXXPXG-XPPPP 795 PP + PP P P PP P PP + P G PPPP Sbjct: 201 PPAVGYPPQQGYPPSGYPQHPPQGYPPSGYPQNPPPSAYSQYPPGAYPPPP 251 >At4g23140.2 68417.m03338 receptor-like protein kinase 5 (RLK5) identical to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam domain PF00069: Protein kinase domain; identical to cDNA receptor-like protein kinase 5 (RLK5) GI:13506746 Length = 680 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 34 WPSXQTLXWLFRXPXSSKXXVXSXPPPPPPP 126 WPS L+ S PPPPPPP Sbjct: 233 WPSCTARYELYPFYNESAIETPPLPPPPPPP 263 >At4g23140.1 68417.m03337 receptor-like protein kinase 5 (RLK5) identical to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam domain PF00069: Protein kinase domain; identical to cDNA receptor-like protein kinase 5 (RLK5) GI:13506746 Length = 674 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 34 WPSXQTLXWLFRXPXSSKXXVXSXPPPPPPP 126 WPS L+ S PPPPPPP Sbjct: 233 WPSCTARYELYPFYNESAIETPPLPPPPPPP 263 >At4g19200.1 68417.m02833 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 179 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 846 GPPXFXXXPPXXGPPPPXXRXXXXGXPPGGGXPXFXY 736 G P PP G PP G PP GG P Y Sbjct: 18 GFPGGGHYPPAQGGYPPQGYPPQQGYPPAGGYPPAGY 54 >At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 646 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGGXXWGXXXGGG 903 GGGG G G G G P G +G GGG Sbjct: 577 GGGGGYGGVPGGGYGAMPGGYGPVPGGGYGNVPGGG 612 >At3g28550.1 68416.m03565 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1018 Score = 28.7 bits (61), Expect = 6.1 Identities = 19/57 (33%), Positives = 21/57 (36%), Gaps = 5/57 (8%) Frame = -1 Query: 950 KXXPXP---PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXP--XGXPPPP 795 K P P P K K PPPP + PPP P + P PPPP Sbjct: 70 KSPPPPYYSPSPKVEYKSPPPPYVY-NSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 125 >At2g21140.1 68415.m02508 hydroxyproline-rich glycoprotein family protein identical to proline-rich protein 2 [Arabidopsis thaliana] gi|7620011|gb|AAF64549 Length = 321 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -1 Query: 425 PFFXPPXXPPKKXPXPXPLTKXXFXPP-PLFXP 330 P + PP PKK P P + K + PP P++ P Sbjct: 221 PIYKPPVVIPKK-PCPPKIHKPIYKPPVPIYKP 252 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/36 (36%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -1 Query: 425 PFFXPPXXPPKKXPXPXPLTKXXFXPP-PLFXPXPP 321 P + PP PKK P K + PP P++ P P Sbjct: 186 PIYKPPVVIPKKPCPPKIAHKPIYKPPVPIYKPPVP 221 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -1 Query: 935 PPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PP K PPPP P PP P PPPP Sbjct: 228 PPQVKQSEPTPPPPPPSI-AVKQSAPTPSPPPPIKKGSSPSPPPPPP 273 >At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi domain-containing protein similar to SP|Q9XGW1 PINHEAD protein (ZWILLE protein) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 990 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -1 Query: 635 PPPPXPXXXPXXPPPXPXPXXPP 567 PPPP P P PP P PP Sbjct: 79 PPPPPPHLLPLSPPLPPLLPLPP 101 >At1g32360.1 68414.m03989 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 384 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGGG--VFXXGGGXG 663 G G G GGG G G GG V GGG G Sbjct: 214 GGYGSGGGGGSGGGSVGGGGSSSNVVVLGGGGG 246 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P PP PPP P PP P PP Sbjct: 12 PPAPPADTAPPPETPSENSALPPVDSSPPSPP 43 Score = 28.7 bits (61), Expect = 6.1 Identities = 26/121 (21%), Positives = 26/121 (21%), Gaps = 2/121 (1%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPPPPXXGXXXGEXP- 765 P PP PP PP PP P P P G E P Sbjct: 92 PSPPPPTSNESPSPPEDSETPPAPPNESNDNNPPPSQDLQSPPPSSPSPNVGPTNPESPP 151 Query: 764 -XGGXAXXXXXXXXXXXXXXXXXXXXPGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPX 588 A P PP PP P P P P Sbjct: 152 LQSPPAPPASDPTNSPPASPLDPTNPPPIQPSGPATSPPANPNAPPSPFPTVPPKTPSSG 211 Query: 587 P 585 P Sbjct: 212 P 212 >At5g61660.1 68418.m07736 glycine-rich protein Length = 134 Score = 25.0 bits (52), Expect(2) = 6.1 Identities = 12/41 (29%), Positives = 15/41 (36%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXGXNXXFXAPG 690 G G G G G G G G + G G G + + G Sbjct: 53 GSGWGYGAGSGRSPTGWGRGSGYGYGSGSGSGTGYGYGSGG 93 Score = 22.2 bits (45), Expect(2) = 6.1 Identities = 10/26 (38%), Positives = 10/26 (38%) Frame = +1 Query: 796 GGGGXPXGXXXGEXGGXXXGXXPGGG 873 GGG G G G G GGG Sbjct: 93 GGGARGGGYGYGSGNGRSGGGGGGGG 118 >At5g66400.1 68418.m08374 dehydrin (RAB18) nearly identical to SP|P30185 Dehydrin Rab18 {Arabidopsis thaliana} Length = 186 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G G GGG G G G GG GG G Sbjct: 33 GGGYGTGGGGGATGGQ-GYGTGGQGYGSGGQG 63 >At5g49080.1 68418.m06074 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 609 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/48 (33%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXP--XGXPPPP 795 P K K PPPP + PPP P + P PPPP Sbjct: 439 PSPKVDYKSPPPPYVY-NSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 485 >At5g13760.1 68418.m01604 expressed protein similar to unknown protein (gb AAF63775.1) Length = 569 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 5/42 (11%) Frame = -1 Query: 905 PPPPXXXP-----HXXPPPGXXPXXXPPFSPXXXPXGXPPPP 795 PPP P PPP P P F P PPPP Sbjct: 73 PPPNLAQPLRSSSRQPPPPPPRPQTPPTFVPEETQPQTPPPP 114 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 P P P PPP P PPP PP Sbjct: 1136 PPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPP 1167 >At5g06640.1 68418.m00750 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 689 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/48 (33%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = -1 Query: 932 PXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXP--XGXPPPP 795 P K K PPPP + PPP P + P PPPP Sbjct: 94 PSPKVNYKSPPPPNVY-NSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 140 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/47 (27%), Positives = 15/47 (31%) Frame = -1 Query: 941 PXPPXXKXXXKXPPPPXXXPHXXPPPGXXPXXXPPFSPXXXPXGXPP 801 P P + PP P+ PP P P P G PP Sbjct: 140 PSAPYAPHVPQYSAPPSASPYSTAPPYSGPSLYPQVQQYPQPSGYPP 186 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = -1 Query: 662 PXPPPX*KTPP---PPXPXXXPXXPPPXPXPXXP 570 P PPP PP PP P P P P P P Sbjct: 213 PPPPPSSAYPPQPYPPQPSYYPQGPYPGQYPPPP 246 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 GG G G GG G G G GG GGG G Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGG----GGGHG 39 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 568 GGXXGXGXGGGXXGXXXGXGGGG 636 GG G G GGG G G GGG Sbjct: 60 GGMGGGGGGGGGSGGGGGGRGGG 82 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 4/42 (9%) Frame = +1 Query: 787 PXXGGGGXPXGXXXGEXG----GXXXGXXPGGGXXWGXXXGG 900 P GGGG G + G G G GGG W GG Sbjct: 59 PSSGGGGASGGGYRNDGGRTGYGYGAGGGGGGGGGWNNRSGG 100 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 4/42 (9%) Frame = +1 Query: 787 PXXGGGGXPXGXXXGEXG----GXXXGXXPGGGXXWGXXXGG 900 P GGGG G + G G G GGG W GG Sbjct: 59 PSSGGGGASGGGYRNDGGRTGYGYGAGGGGGGGGGWNNRSGG 100 >At3g26400.1 68416.m03292 eukaryotic translation initiation factor 4B, putative/ eIF-4B, putative similar to eukaryotic initiation factor 4B [Arabidopsis thaliana] GI:6739518 Length = 532 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 586 GXGGGXXGXXXGXGGGGVFXXGGGXG 663 G GGG G G GGGG GGG G Sbjct: 194 GDGGGFGGGGSGFGGGG---GGGGGG 216 >At2g35920.1 68415.m04409 helicase domain-containing protein similar to DEIH-box RNA/DNA helicase [Arabidopsis thaliana] GI:5881579; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 995 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 547 PXXXXXXGGXXGXGXGGGXXGXXXGXGGGGVFXXGGGXG 663 P GG G G G G G GGGG GGG G Sbjct: 3 PHGPNSQGGRRGGGHSSGRRG---GRGGGGRGGGGGGRG 38 >At2g24450.1 68415.m02922 fasciclin-like arabinogalactan family protein similar to fasciclin-like arabinogalactan-protein 1 [Arabidopsis thaliana] gi|13377776|gb|AAK20857 Length = 280 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = -1 Query: 689 PGAXKXXFXPXPPPX*KTPPPPXPXXXPXXPPPXP 585 PG P PPP +PP P P P P P Sbjct: 172 PGLGSPVKVPPPPPM-SSPPAPSPKKGAATPAPAP 205 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -1 Query: 662 PXPPPX*KTPPPPXPXXXPXXPPPXP 585 P P P + PPPP P PP P Sbjct: 248 PVPIPAPRQPPPPPPQVYQTQPPSWP 273 >At2g11005.1 68415.m01177 glycine-rich protein Length = 170 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 571 GXXGXGXGGGXXGXXXGXGGGGVFXXGGG 657 G G GGG G G G GG GGG Sbjct: 13 GDGGGSGGGGGSGDGSGSGDGGGSGDGGG 41 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = -1 Query: 662 PXPPPX*KTPPPP-XPXXXPXXPPPXPXPXXPPFXXXXXG 546 P PPP PP P P P P P P PPF G Sbjct: 62 PPPPPPQWGPPSPHYPQGQPYSSPAYP-PHQPPFNAGANG 100 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = -1 Query: 662 PXPPPX*KTPPPP-XPXXXPXXPPPXPXPXXPPFXXXXXG 546 P PPP PP P P P P P P PPF G Sbjct: 62 PPPPPPQWGPPSPHYPQGQPYSSPAYP-PHQPPFNAGANG 100 >At1g70250.1 68414.m08082 receptor serine/threonine kinase, putative similar to to receptor serine/threonine kinase PR5K gi|1235680|gb|AAC49208 Length = 799 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -1 Query: 656 PPPX*KTPPPPXPXXXPXXPPPXPXPXXPP 567 PPP PPP P P P P PP Sbjct: 101 PPPPPDLFPPPSAQMLPPPPASSPAPPSPP 130 >At1g51580.1 68414.m05806 KH domain-containing protein Length = 621 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -1 Query: 905 PPPPXXXPHXXPPPGXXPXXXP 840 PPPP P+ PPP P P Sbjct: 449 PPPPFMGPYPEPPPPFGPRQYP 470 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.314 0.156 0.544 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,568,633 Number of Sequences: 28952 Number of extensions: 349571 Number of successful extensions: 16379 Number of sequences better than 10.0: 225 Number of HSP's better than 10.0 without gapping: 1043 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8634 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2324382072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits)
- SilkBase 1999-2023 -