BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_O19 (870 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0558 + 17111138-17111996,17112474-17112564,17112647-171132... 31 1.6 03_02_0197 + 6337212-6337278,6339261-6340517,6340599-6340626,634... 30 2.8 04_03_0513 - 16681227-16683936,16685572-16685966 29 3.7 >04_03_0558 + 17111138-17111996,17112474-17112564,17112647-17113268, 17113378-17113457,17113871-17113937,17114138-17114263, 17114333-17114415,17115334-17115777,17115834-17115927, 17116038-17116124,17116474-17116594,17116671-17116709, 17116828-17116997 Length = 960 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +3 Query: 663 ELSKXTNNS*CTPTIQXPDLPQHEDRIAYLTEDVGLNAYYY 785 E K T + C P I+ P P HE+R ED N YY+ Sbjct: 681 EYGKNTEMNYCEPVIEIPPTPLHENRGETSDED-DENGYYF 720 >03_02_0197 + 6337212-6337278,6339261-6340517,6340599-6340626, 6340735-6340897 Length = 504 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/76 (23%), Positives = 35/76 (46%), Gaps = 1/76 (1%) Frame = +3 Query: 294 MKAYENFMMMYKVGFLPKNLEFSIFYE-KMREEAIALFKLFYYAKDFECFYKTACYARVY 470 + Y + M G +P L++++F +EA+ L +Y F+ A +A Y Sbjct: 197 LNVYPYYDYMRSNGVIP--LDYALFRPLPPNKEAVDANTLLHYTNVFDAVVDAAYFAMAY 254 Query: 471 MNQXNVLIRLLHSYYP 518 +N NV + + + +P Sbjct: 255 LNVTNVPVMVTETGWP 270 >04_03_0513 - 16681227-16683936,16685572-16685966 Length = 1034 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +2 Query: 272 QQGLLHKHESLRKFHDDVQGRIPSQEFGILDLL 370 Q G+LH+ ESL +D+ G IP QE LD L Sbjct: 905 QLGMLHQLESLDLSSNDLSGEIP-QELASLDFL 936 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,235,251 Number of Sequences: 37544 Number of extensions: 304455 Number of successful extensions: 599 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 599 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2444475072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -