BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_O14 (906 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z50006-6|CAA90298.1| 334|Caenorhabditis elegans Hypothetical pr... 29 4.6 AL132858-6|CAB60475.1| 412|Caenorhabditis elegans Hypothetical ... 29 6.0 AF078783-3|AAN63404.1| 504|Caenorhabditis elegans Nuclear hormo... 28 8.0 AC199172-10|ABO33271.1| 302|Caenorhabditis elegans F-box a prot... 28 8.0 >Z50006-6|CAA90298.1| 334|Caenorhabditis elegans Hypothetical protein T07C5.5 protein. Length = 334 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/44 (31%), Positives = 19/44 (43%) Frame = -2 Query: 299 IDHVTAHCTICLLKTTMFQYQGSDSYNCTHYSKRYYAIDSVLAC 168 +D +T C +C KTT F Y C + +R VL C Sbjct: 1 MDCITRSCKVCNEKTTGFNYGVQSCNACKMFFRRALDTPKVLKC 44 >AL132858-6|CAB60475.1| 412|Caenorhabditis elegans Hypothetical protein Y113G7A.11 protein. Length = 412 Score = 28.7 bits (61), Expect = 6.0 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 14/83 (16%) Frame = -2 Query: 224 YNCTHY--SKRYYAIDSVLACLTFFFH-----RIYSFSKGQSEHFCD*LIC*KQLFFKFY 66 YN Y +K Y + + CLT +FH +IY+++ G + F D L QL F Y Sbjct: 154 YNIPKYPDTKYIYCVRNPKDCLTSYFHHNRNFKIYNWANGTWDVFLD-LFASGQLAFGDY 212 Query: 65 -------LYCIRESKILRIPYSE 18 L C+++ +L + Y + Sbjct: 213 FEHLLSWLPCLKDDNVLFLKYED 235 >AF078783-3|AAN63404.1| 504|Caenorhabditis elegans Nuclear hormone receptor familyprotein 80, isoform b protein. Length = 504 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/53 (20%), Positives = 22/53 (41%) Frame = -2 Query: 320 RNSFLWNIDHVTAHCTICLLKTTMFQYQGSDSYNCTHYSKRYYAIDSVLACLT 162 ++ F + + C IC + T F ++ C + +R A+ C+T Sbjct: 16 KSKFRFPASSSSTRCLICSAQATGFHFEAQSCSACAAFFRRTVALTKSFKCIT 68 >AC199172-10|ABO33271.1| 302|Caenorhabditis elegans F-box a protein protein 37 protein. Length = 302 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = -2 Query: 281 HCTICLLKTTMFQYQGSDSYNCTHYSKRYYAIDSVLACLTFFFHRIYSFSK 129 H +IC+ + Y DS NC ++++ A++ V C+ FF+ + F K Sbjct: 60 HVSICVDRIETNYYYDDDSSNC--FNRKQKAVEGV-DCMNAFFNDLKLFLK 107 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,953,508 Number of Sequences: 27780 Number of extensions: 215797 Number of successful extensions: 341 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 334 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 341 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2307803960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -