BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_O13 (908 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK123203-1|BAC85556.1| 178|Homo sapiens protein ( Homo sapiens ... 32 3.3 AF068706-1|AAC67390.1| 751|Homo sapiens gamma2-adaptin protein. 31 7.6 >AK123203-1|BAC85556.1| 178|Homo sapiens protein ( Homo sapiens cDNA FLJ41209 fis, clone BRALZ2012848. ). Length = 178 Score = 31.9 bits (69), Expect = 3.3 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = +3 Query: 72 LHENDRLSVVRTAGWRSRPRHSTTMARHIGRITITTPSVLTFGXACWXXIRFGP--TFPT 245 ++ N +S ++A W ++TMARH G + + +P + G ++ GP + P Sbjct: 50 MYGNTWMSRQKSAAWEEPTCRTSTMARHRGNVGLESPHRVPTGALPSGAVKRGPLSSRPL 109 Query: 246 KC 251 KC Sbjct: 110 KC 111 >AF068706-1|AAC67390.1| 751|Homo sapiens gamma2-adaptin protein. Length = 751 Score = 30.7 bits (66), Expect = 7.6 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +2 Query: 89 P*CCADCWLAVSAAPQYYHGSSH-WPYHH 172 P CCA A +A PQ+ H SS WP +H Sbjct: 715 PGCCAQESPAAAAGPQWEHSSSSGWPSYH 743 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,284,154 Number of Sequences: 237096 Number of extensions: 1190776 Number of successful extensions: 3224 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2531 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3123 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11770329464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -