BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_O11 (894 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 62 4e-10 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) 50 3e-06 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) 48 1e-05 SB_22764| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_1272| Best HMM Match : Ras (HMM E-Value=8.9e-08) 48 1e-05 SB_49496| Best HMM Match : DUF81 (HMM E-Value=3.6) 48 1e-05 SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_21539| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 45 7e-05 SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_4052| Best HMM Match : EGF (HMM E-Value=7.2e-05) 45 7e-05 SB_45385| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_21487| Best HMM Match : MAM (HMM E-Value=0) 38 0.014 SB_33209| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.014 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 37 0.019 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 37 0.019 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 37 0.019 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 37 0.019 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 37 0.019 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 37 0.019 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 37 0.019 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 37 0.019 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 37 0.019 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 37 0.019 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 37 0.019 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 37 0.019 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 37 0.019 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 37 0.019 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 37 0.019 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 37 0.019 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 37 0.019 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 37 0.019 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 37 0.019 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 37 0.019 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 37 0.019 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 37 0.019 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 37 0.019 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 37 0.019 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 37 0.019 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 37 0.019 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 37 0.019 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 37 0.019 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 37 0.019 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_18781| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 37 0.019 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 37 0.019 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 37 0.019 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 37 0.019 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 37 0.019 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 37 0.019 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 37 0.019 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 37 0.019 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 37 0.019 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 37 0.019 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 37 0.019 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 37 0.019 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 37 0.019 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 37 0.019 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 37 0.019 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 37 0.019 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 37 0.019 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 37 0.019 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 37 0.019 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 37 0.019 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_56405| Best HMM Match : Fels1 (HMM E-Value=6.5) 37 0.019 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 37 0.019 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 37 0.019 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 37 0.019 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 37 0.019 SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 37 0.019 SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 37 0.019 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 37 0.019 SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 37 0.019 SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 37 0.019 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 37 0.019 SB_40919| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40898| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40785| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40759| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 37 0.019 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40215| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40094| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_39735| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_39642| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 37 0.019 SB_39320| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 37 0.019 SB_39131| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 37 0.019 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 37 0.019 SB_38904| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_38654| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 37 0.019 SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) 37 0.019 SB_38140| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_37833| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_37700| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_37634| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_37586| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_37467| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_37442| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_37275| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_37081| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36845| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36843| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36822| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36551| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36497| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36480| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36092| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35911| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35809| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 37 0.019 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35616| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35217| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 37 0.019 SB_34399| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34227| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 37 0.019 SB_33490| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 37 0.019 SB_33281| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 37 0.019 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_32291| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_32217| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_32188| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 37 0.019 SB_32050| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_31853| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_31071| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_30889| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_30453| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_30166| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_30004| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_29620| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_29583| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) 37 0.019 SB_29433| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_29146| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_28829| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_28797| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_28439| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_28284| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_28002| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_27895| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 37 0.019 SB_27625| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_27082| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) 37 0.019 SB_26278| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_26034| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_26029| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_25779| Best HMM Match : DUF485 (HMM E-Value=5.1) 37 0.019 SB_25252| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_25111| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_24900| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_24899| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_24625| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_24558| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_24302| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_24239| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_23976| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_23972| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_23930| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_23315| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_23224| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_22743| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) 37 0.019 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_22298| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_22087| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_21944| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 37 0.019 SB_21220| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_21197| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_21163| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_21115| Best HMM Match : Swi3 (HMM E-Value=6.9) 37 0.019 SB_20993| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_20955| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1) 37 0.019 SB_20043| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) 37 0.019 SB_19497| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_19432| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_19022| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_18824| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_18805| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_18630| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_18572| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082) 37 0.019 SB_18337| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_17968| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_17922| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_17258| Best HMM Match : DUF791 (HMM E-Value=0.002) 37 0.019 SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_16840| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 37 0.019 SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4) 37 0.019 SB_16696| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_16512| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) 37 0.019 SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) 37 0.019 SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 37 0.019 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_15771| Best HMM Match : VQ (HMM E-Value=4.3) 37 0.019 SB_15715| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_15545| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_14983| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_14379| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_14356| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_14291| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_13637| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_13233| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_12576| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_12547| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_12526| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_12145| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_11965| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_11390| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_11105| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_10967| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_10941| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_10936| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_10912| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_10853| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_10723| Best HMM Match : Chromo (HMM E-Value=0.031) 37 0.019 SB_10695| Best HMM Match : Pollen_Ole_e_I (HMM E-Value=5.2) 37 0.019 SB_10650| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_10623| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_10590| Best HMM Match : DUF485 (HMM E-Value=7.3) 37 0.019 SB_9879| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_9823| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_9713| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_9545| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_9530| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) 37 0.019 SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022) 37 0.019 SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_9371| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_9155| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_9135| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_9004| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_8423| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_8316| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_8089| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_7935| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_7697| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_7274| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_7176| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_6789| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_6524| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_6469| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_6458| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/37 (78%), Positives = 29/37 (78%) Frame = +2 Query: 623 ARGEAVCVLGXLPXPXSLTRXARSFGCGXRYXLXPRR 733 ARGEAVCVLG LP P SLTR ARSFGCG RY L RR Sbjct: 107 ARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 143 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/37 (78%), Positives = 29/37 (78%) Frame = +2 Query: 623 ARGEAVCVLGXLPXPXSLTRXARSFGCGXRYXLXPRR 733 ARGEAVCVLG LP P SLTR ARSFGCG RY L RR Sbjct: 471 ARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 507 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 51.2 bits (117), Expect = 1e-06 Identities = 30/63 (47%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = -3 Query: 859 RXGGXSX*KTPATRPFXVRX-CXGXXSQVLXWXXPLXLWITXXPPWXEXIPXXAAERPSX 683 + GG + KTPATRPF G PL LWIT PP E IP AAERPS Sbjct: 757 KRGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 816 Query: 682 XSQ 674 SQ Sbjct: 817 ASQ 819 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.8 bits (116), Expect = 1e-06 Identities = 30/61 (49%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = -3 Query: 853 GGXSX*KTPATRPFXVRX-CXGXXSQVLXWXXPLXLWITXXPPWXEXIPXXAAERPSXXS 677 GG + KTPATRPF G PL LWIT PP E IP AAERPS S Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAAS 60 Query: 676 Q 674 Q Sbjct: 61 Q 61 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 50.8 bits (116), Expect = 1e-06 Identities = 30/61 (49%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = -3 Query: 853 GGXSX*KTPATRPFXVRX-CXGXXSQVLXWXXPLXLWITXXPPWXEXIPXXAAERPSXXS 677 GG + KTPATRPF G PL LWIT PP E IP AAERPS S Sbjct: 24 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAAS 83 Query: 676 Q 674 Q Sbjct: 84 Q 84 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 50.8 bits (116), Expect = 1e-06 Identities = 30/61 (49%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = -3 Query: 853 GGXSX*KTPATRPFXVRX-CXGXXSQVLXWXXPLXLWITXXPPWXEXIPXXAAERPSXXS 677 GG + KTPATRPF G PL LWIT PP E IP AAERPS S Sbjct: 406 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAAS 465 Query: 676 Q 674 Q Sbjct: 466 Q 466 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 50.8 bits (116), Expect = 1e-06 Identities = 30/61 (49%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = -3 Query: 853 GGXSX*KTPATRPFXVRX-CXGXXSQVLXWXXPLXLWITXXPPWXEXIPXXAAERPSXXS 677 GG + KTPATRPF G PL LWIT PP E IP AAERPS S Sbjct: 23 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAAS 82 Query: 676 Q 674 Q Sbjct: 83 Q 83 >SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 49.6 bits (113), Expect = 3e-06 Identities = 28/44 (63%), Positives = 28/44 (63%) Frame = +1 Query: 628 GXGGLRIGXXXXXXLXDSXXSVVRLRXAVSPXSKAVXXLSTXSG 759 G GGLRIG L DS SVVRLR AVS SKAV LST SG Sbjct: 51 GPGGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESG 94 >SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) Length = 884 Score = 49.6 bits (113), Expect = 3e-06 Identities = 28/44 (63%), Positives = 28/44 (63%) Frame = +1 Query: 628 GXGGLRIGXXXXXXLXDSXXSVVRLRXAVSPXSKAVXXLSTXSG 759 G GGLRIG L DS SVVRLR AVS SKAV LST SG Sbjct: 34 GGGGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESG 77 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 49.2 bits (112), Expect = 4e-06 Identities = 29/61 (47%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = -3 Query: 853 GGXSX*KTPATRPFXVRX-CXGXXSQVLXWXXPLXLWITXXPPWXEXIPXXAAERPSXXS 677 GG + KTPATRPF G PL LWIT PP E IP AAERPS Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAAK 60 Query: 676 Q 674 Q Sbjct: 61 Q 61 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 48.0 bits (109), Expect = 1e-05 Identities = 28/57 (49%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = -3 Query: 853 GGXSX*KTPATRPFXVRX-CXGXXSQVLXWXXPLXLWITXXPPWXEXIPXXAAERPS 686 GG + KTPATRPF G PL LWIT PP E IP AAERPS Sbjct: 555 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPS 611 >SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 544 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = +1 Query: 634 GGLRIGXXXXXXLXDSXXSVVRLRXAVSPXSKAVXXLSTXSG 759 GGLRIG L DS SVVRLR AVS SKAV LST SG Sbjct: 448 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESG 489 >SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) Length = 623 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = +1 Query: 634 GGLRIGXXXXXXLXDSXXSVVRLRXAVSPXSKAVXXLSTXSG 759 GGLRIG L DS SVVRLR AVS SKAV LST SG Sbjct: 575 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESG 616 >SB_22764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = +1 Query: 634 GGLRIGXXXXXXLXDSXXSVVRLRXAVSPXSKAVXXLSTXSG 759 GGLRIG L DS SVVRLR AVS SKAV LST SG Sbjct: 7 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESG 48 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = +1 Query: 634 GGLRIGXXXXXXLXDSXXSVVRLRXAVSPXSKAVXXLSTXSG 759 GGLRIG L DS SVVRLR AVS SKAV LST SG Sbjct: 2 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESG 43 >SB_1272| Best HMM Match : Ras (HMM E-Value=8.9e-08) Length = 492 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = +1 Query: 634 GGLRIGXXXXXXLXDSXXSVVRLRXAVSPXSKAVXXLSTXSG 759 GGLRIG L DS SVVRLR AVS SKAV LST SG Sbjct: 309 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESG 350 >SB_49496| Best HMM Match : DUF81 (HMM E-Value=3.6) Length = 302 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = +1 Query: 634 GGLRIGXXXXXXLXDSXXSVVRLRXAVSPXSKAVXXLSTXSG 759 GGLRIG L DS SVVRLR AVS SKAV LST SG Sbjct: 254 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESG 295 >SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = +1 Query: 634 GGLRIGXXXXXXLXDSXXSVVRLRXAVSPXSKAVXXLSTXSG 759 GGLRIG L DS SVVRLR AVS SKAV LST SG Sbjct: 140 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESG 181 >SB_21539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = +1 Query: 634 GGLRIGXXXXXXLXDSXXSVVRLRXAVSPXSKAVXXLSTXSG 759 GGLRIG L DS SVVRLR AVS SKAV LST SG Sbjct: 2 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESG 43 >SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2429 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = +1 Query: 634 GGLRIGXXXXXXLXDSXXSVVRLRXAVSPXSKAVXXLSTXSG 759 GGLRIG L DS SVVRLR AVS SKAV LST SG Sbjct: 263 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESG 304 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 45.2 bits (102), Expect = 7e-05 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = +1 Query: 634 GGLRIGXXXXXXLXDSXXSVVRLRXAVSPXSKAVXXLSTXSG 759 GGLRIG L DS SVVRLR A S SKAV LST SG Sbjct: 2 GGLRIGRSSASSLTDSLRSVVRLRRAESAHSKAVIRLSTESG 43 >SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 45.2 bits (102), Expect = 7e-05 Identities = 26/41 (63%), Positives = 26/41 (63%) Frame = +1 Query: 637 GLRIGXXXXXXLXDSXXSVVRLRXAVSPXSKAVXXLSTXSG 759 GLRIG L DS SVVRLR AVS SKAV LST SG Sbjct: 210 GLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESG 250 >SB_4052| Best HMM Match : EGF (HMM E-Value=7.2e-05) Length = 117 Score = 45.2 bits (102), Expect = 7e-05 Identities = 26/41 (63%), Positives = 26/41 (63%) Frame = +1 Query: 637 GLRIGXXXXXXLXDSXXSVVRLRXAVSPXSKAVXXLSTXSG 759 GLRIG L DS SVVRLR AVS SKAV LST SG Sbjct: 70 GLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESG 110 >SB_45385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 41.9 bits (94), Expect = 7e-04 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = +1 Query: 640 LRIGXXXXXXLXDSXXSVVRLRXAVSPXSKAVXXLSTXSG 759 +RIG L DS SVVRLR AVS SKAV LST SG Sbjct: 1 MRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESG 40 >SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 19/31 (61%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXLXPR 730 +C G +P P SLTR ARSF CG R L R Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLTNR 104 >SB_21487| Best HMM Match : MAM (HMM E-Value=0) Length = 874 Score = 37.5 bits (83), Expect = 0.014 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +1 Query: 670 LXDSXXSVVRLRXAVSPXSKAVXXLSTXSG 759 L DS SVVRLR AVS SKAV LST SG Sbjct: 73 LTDSLRSVVRLRRAVSAHSKAVIRLSTESG 102 >SB_33209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.5 bits (83), Expect = 0.014 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFNCGERKWL 87 >SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWL 124 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 172 ICDTGYIPLPRSLTRYARSFDCGERKWL 199 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWL 124 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 296 ICDTGYIPLPRSLTRYARSFDCGERKWL 323 >SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWL 161 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGERKWL 148 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 146 ICDTGYIPLPRSLTRYARSFDCGERKWL 173 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 103 ICDTGYIPLPRSLTRYARSFDCGERKWL 130 >SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGERKWL 160 >SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) Length = 653 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 251 ICDTGYIPLPRSLTRYARSFDCGERKWL 278 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWL 120 >SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGERKWL 119 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 393 ICDTGYIPLPRSLTRYARSFDCGERKWL 420 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) Length = 293 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 248 ICDTGYIPLPRSLTRYARSFDCGERKWL 275 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 148 ICDTGYIPLPRSLTRYARSFDCGERKWL 175 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWL 161 >SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 611 ICDTGYIPLPRSLTRYARSFDCGERKWL 638 >SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 367 ICDTGYIPLPRSLTRYARSFDCGERKWL 394 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWL 124 >SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) Length = 255 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 210 ICDTGYIPLPRSLTRYARSFDCGERKWL 237 >SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 168 ICDTGYIPLPRSLTRYARSFDCGERKWL 195 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWL 159 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 94 ICDTGYIPLPRSLTRYARSFDCGERKWL 121 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGERKWL 160 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 179 ICDTGYIPLPRSLTRYARSFDCGERKWL 206 >SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGERKWL 129 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 137 ICDTGYIPLPRSLTRYARSFDCGERKWL 164 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGERKWL 180 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 63 ICDTGYIPLPRSLTRYARSFDCGERKWL 90 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWL 140 >SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2496 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 600 ICDTGYIPLPRSLTRYARSFDCGERKWL 627 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWL 140 >SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) Length = 216 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGERKWL 198 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWL 124 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 96 ICDTGYIPLPRSLTRYARSFDCGERKWL 123 >SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 117 ICDTGYIPLPRSLTRYARSFDCGERKWL 144 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 139 ICDTGYIPLPRSLTRYARSFDCGERKWL 166 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 116 ICDTGYIPLPRSLTRYARSFDCGERKWL 143 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGERKWL 132 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWL 159 >SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWL 157 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 99 ICDTGYIPLPRSLTRYARSFDCGERKWL 126 >SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 237 ICDTGYIPLPRSLTRYARSFDCGERKWL 264 >SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 673 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 628 ICDTGYIPLPRSLTRYARSFDCGERKWL 655 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 350 ICDTGYIPLPRSLTRYARSFDCGERKWL 377 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWL 124 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGERKWL 150 >SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 895 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 854 ICDTGYIPLPRSLTRYARSFDCGERKWL 881 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 239 ICDTGYIPLPRSLTRYARSFDCGERKWL 266 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 138 ICDTGYIPLPRSLTRYARSFDCGERKWL 165 >SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 539 ICDTGYIPLPRSLTRYARSFDCGERKWL 566 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 84 ICDTGYIPLPRSLTRYARSFDCGERKWL 111 >SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) Length = 1029 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 984 ICDTGYIPLPRSLTRYARSFDCGERKWL 1011 >SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) Length = 155 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 110 ICDTGYIPLPRSLTRYARSFDCGERKWL 137 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGERKWL 179 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 489 ICDTGYIPLPRSLTRYARSFDCGERKWL 516 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWL 120 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGERKWL 149 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 285 ICDTGYIPLPRSLTRYARSFDCGERKWL 312 >SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) Length = 149 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 104 ICDTGYIPLPRSLTRYARSFDCGERKWL 131 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWL 101 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 194 ICDTGYIPLPRSLTRYARSFDCGERKWL 221 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 279 ICDTGYIPLPRSLTRYARSFDCGERKWL 306 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGERKWL 132 >SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) Length = 198 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGERKWL 180 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWL 140 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 155 ICDTGYIPLPRSLTRYARSFDCGERKWL 182 >SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGERKWL 150 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_18781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 125 ICDTGYIPLPRSLTRYARSFDCGERKWL 152 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGERKWL 119 >SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) Length = 177 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWL 159 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWL 128 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 995 ICDTGYIPLPRSLTRYARSFDCGERKWL 1022 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 142 ICDTGYIPLPRSLTRYARSFDCGERKWL 169 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 475 ICDTGYIPLPRSLTRYARSFDCGERKWL 502 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 157 ICDTGYIPLPRSLTRYARSFDCGERKWL 184 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 523 ICDTGYIPLPRSLTRYARSFDCGERKWL 550 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWL 157 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 521 ICDTGYIPLPRSLTRYARSFDCGERKWL 548 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 143 ICDTGYIPLPRSLTRYARSFDCGERKWL 170 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWL 128 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWL 128 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 145 ICDTGYIPLPRSLTRYARSFDCGERKWL 172 >SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) Length = 197 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGERKWL 179 >SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) Length = 336 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 291 ICDTGYIPLPRSLTRYARSFDCGERKWL 318 >SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGERKWL 198 >SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 1206 ICDTGYIPLPRSLTRYARSFDCGERKWL 1233 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGERKWL 129 >SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGERKWL 149 >SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 107 ICDTGYIPLPRSLTRYARSFDCGERKWL 134 >SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) Length = 502 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 100 ICDTGYIPLPRSLTRYARSFDCGERKWL 127 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWL 157 >SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGERKWL 148 >SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 98 ICDTGYIPLPRSLTRYARSFDCGERKWL 125 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 1476 ICDTGYIPLPRSLTRYARSFDCGERKWL 1503 >SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) Length = 674 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 629 ICDTGYIPLPRSLTRYARSFDCGERKWL 656 >SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 89 ICDTGYIPLPRSLTRYARSFDCGERKWL 116 >SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 326 ICDTGYIPLPRSLTRYARSFDCGERKWL 353 >SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 174 ICDTGYIPLPRSLTRYARSFDCGERKWL 201 >SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2102 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 538 ICDTGYIPLPRSLTRYARSFDCGERKWL 565 >SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) Length = 348 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 91 ICDTGYIPLPRSLTRYARSFDCGERKWL 118 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 160 ICDTGYIPLPRSLTRYARSFDCGERKWL 187 >SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) Length = 189 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 144 ICDTGYIPLPRSLTRYARSFDCGERKWL 171 >SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) Length = 142 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWL 124 >SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 144 ICDTGYIPLPRSLTRYARSFDCGERKWL 171 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 182 ICDTGYIPLPRSLTRYARSFDCGERKWL 209 >SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) Length = 157 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 112 ICDTGYIPLPRSLTRYARSFDCGERKWL 139 >SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 154 ICDTGYIPLPRSLTRYARSFDCGERKWL 181 >SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWL 120 >SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 119 ICDTGYIPLPRSLTRYARSFDCGERKWL 146 >SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) Length = 160 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 115 ICDTGYIPLPRSLTRYARSFDCGERKWL 142 >SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) Length = 590 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 545 ICDTGYIPLPRSLTRYARSFDCGERKWL 572 >SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) Length = 521 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 440 ICDTGYIPLPRSLTRYARSFDCGERKWL 467 >SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWL 120 >SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 227 ICDTGYIPLPRSLTRYARSFDCGERKWL 254 >SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 112 ICDTGYIPLPRSLTRYARSFDCGERKWL 139 >SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_56405| Best HMM Match : Fels1 (HMM E-Value=6.5) Length = 119 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWL 101 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = +3 Query: 609 NESAXXGXRRFAYWAL 656 NESA G RRFAYWAL Sbjct: 25 NESATRGERRFAYWAL 40 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 95 ICDTGYIPLPRSLTRYARSFDCGERKWL 122 >SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) Length = 458 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 94 ICDTGYIPLPRSLTRYARSFDCGERKWL 121 >SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWL 124 >SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 637 ICDTGYIPLPRSLTRYARSFDCGERKWL 664 >SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 91 ICDTGYIPLPRSLTRYARSFDCGERKWL 118 >SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) Length = 180 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 135 ICDTGYIPLPRSLTRYARSFDCGERKWL 162 >SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1263 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 446 ICDTGYIPLPRSLTRYARSFDCGERKWL 473 >SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 75 ICDTGYIPLPRSLTRYARSFDCGERKWL 102 >SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGERKWL 119 >SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 108 ICDTGYIPLPRSLTRYARSFDCGERKWL 135 >SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGERKWL 179 >SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 186 ICDTGYIPLPRSLTRYARSFDCGERKWL 213 >SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGERKWL 119 >SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 78 ICDTGYIPLPRSLTRYARSFDCGERKWL 105 >SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 131 ICDTGYIPLPRSLTRYARSFDCGERKWL 158 >SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 159 ICDTGYIPLPRSLTRYARSFDCGERKWL 186 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWL 161 >SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) Length = 1427 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 1382 ICDTGYIPLPRSLTRYARSFDCGERKWL 1409 >SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 Query: 638 VCVLGXLPXPXSLTRXARSFGCGXRYXL 721 +C G +P P SLTR ARSF CG R L Sbjct: 128 ICDTGYIPLPRSLTRYARSFDCGERKWL 155 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,643,690 Number of Sequences: 59808 Number of extensions: 98930 Number of successful extensions: 1287 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 762 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1280 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2562198215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -