BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_O11 (894 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g59540.1 68416.m06645 60S ribosomal protein L38 (RPL38B) 60S ... 54 1e-07 At2g43460.1 68415.m05401 60S ribosomal protein L38 (RPL38A) 54 1e-07 >At3g59540.1 68416.m06645 60S ribosomal protein L38 (RPL38B) 60S RIBOSOMAL PROTEIN L38 - Lycopersicon esculentum, EMBL:X69979 Length = 69 Score = 54.4 bits (125), Expect = 1e-07 Identities = 29/67 (43%), Positives = 35/67 (52%) Frame = +2 Query: 95 MPRXIXXXXXFLIKAXXXXAXSVXXXXXPEXVXFXVRCSXFLYTLVXXDXXXAEXLKXXL 274 MP+ I FL+ A A SV + V F VRCS +LYTL D A+ LK L Sbjct: 1 MPKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKVRCSRYLYTLCVFDQEKADKLKQSL 60 Query: 275 PPGLXVK 295 PPGL V+ Sbjct: 61 PPGLSVQ 67 >At2g43460.1 68415.m05401 60S ribosomal protein L38 (RPL38A) Length = 69 Score = 54.4 bits (125), Expect = 1e-07 Identities = 29/67 (43%), Positives = 35/67 (52%) Frame = +2 Query: 95 MPRXIXXXXXFLIKAXXXXAXSVXXXXXPEXVXFXVRCSXFLYTLVXXDXXXAEXLKXXL 274 MP+ I FL+ A A SV + V F VRCS +LYTL D A+ LK L Sbjct: 1 MPKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKVRCSRYLYTLCVFDQEKADKLKQSL 60 Query: 275 PPGLXVK 295 PPGL V+ Sbjct: 61 PPGLSVQ 67 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,941,119 Number of Sequences: 28952 Number of extensions: 65256 Number of successful extensions: 45 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2100696768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -