BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_O09 (884 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT022711-1|AAY55127.1| 299|Drosophila melanogaster IP12323p pro... 29 8.5 BT022644-1|AAY55060.1| 319|Drosophila melanogaster IP12023p pro... 29 8.5 AE014298-782|AAF46071.1| 478|Drosophila melanogaster CG15773-PA... 29 8.5 >BT022711-1|AAY55127.1| 299|Drosophila melanogaster IP12323p protein. Length = 299 Score = 29.1 bits (62), Expect = 8.5 Identities = 12/39 (30%), Positives = 17/39 (43%) Frame = +1 Query: 88 KSFICICCFVVAAVGYVTGQHFPTRKCPKGEHSVLYCPQ 204 + +C C A G G++ PT KC G + C Q Sbjct: 260 QDIVCAACNSTANPGCRAGRNLPTEKCAAGTTACYSCEQ 298 >BT022644-1|AAY55060.1| 319|Drosophila melanogaster IP12023p protein. Length = 319 Score = 29.1 bits (62), Expect = 8.5 Identities = 12/39 (30%), Positives = 17/39 (43%) Frame = +1 Query: 88 KSFICICCFVVAAVGYVTGQHFPTRKCPKGEHSVLYCPQ 204 + +C C A G G++ PT KC G + C Q Sbjct: 280 QDIVCAACNSTANPGCRAGRNLPTEKCAAGTTACYSCEQ 318 >AE014298-782|AAF46071.1| 478|Drosophila melanogaster CG15773-PA protein. Length = 478 Score = 29.1 bits (62), Expect = 8.5 Identities = 12/39 (30%), Positives = 17/39 (43%) Frame = +1 Query: 88 KSFICICCFVVAAVGYVTGQHFPTRKCPKGEHSVLYCPQ 204 + +C C A G G++ PT KC G + C Q Sbjct: 280 QDIVCAACNSTANPGCRAGRNLPTEKCAAGTTACYSCEQ 318 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,454,860 Number of Sequences: 53049 Number of extensions: 558145 Number of successful extensions: 1462 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1419 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1462 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4311772920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -