BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_O08 (904 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 53 3e-09 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 44 2e-06 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 21 10.0 EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 pr... 21 10.0 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 53.2 bits (122), Expect = 3e-09 Identities = 25/68 (36%), Positives = 39/68 (57%) Frame = +3 Query: 411 AVKVFRVLYYAKDFDVFMRTACWMRERINGGMFVYAFTAACFHRTDCKGLYLPAPYEIYP 590 A K+ R+ A+ D + A + R+R+N +F YAF+ A HR D + L LP+ ++P Sbjct: 91 AGKLIRIFLAAESIDDLLSNAVFCRDRVNPYLFYYAFSVALLHRPDTQNLDLPSFIHVFP 150 Query: 591 YFFVDSHV 614 +VDS V Sbjct: 151 DKYVDSQV 158 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 43.6 bits (98), Expect = 2e-06 Identities = 24/82 (29%), Positives = 41/82 (50%) Frame = +3 Query: 444 KDFDVFMRTACWMRERINGGMFVYAFTAACFHRTDCKGLYLPAPYEIYPYFFVDSHVHQX 623 ++ D + A + R+R+N +F YA + A HR D + + LP+ E +P +VDS V Sbjct: 102 RNVDDLLSVAVYARDRVNPYLFSYALSVAILHRQDTQDIDLPSFIESFPDKYVDSKVFAK 161 Query: 624 SLYDEDD*SRQGPGPLEILRXH 689 + + P+EI R + Sbjct: 162 AREEATVVPEGSRTPIEIPRDY 183 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 21.4 bits (43), Expect = 10.0 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 233 PPADXV*GHQGARQGV*HRAKLRQ 304 PP H+ AR+ + H A LRQ Sbjct: 367 PPLTREEIHEKARENLKHHANLRQ 390 >EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 protein. Length = 274 Score = 21.4 bits (43), Expect = 10.0 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -1 Query: 151 AARSHHEALRLTPRPSRPGGREPAXLKN 68 ++RSH A + PRP+ P N Sbjct: 246 SSRSHQPATKSKPRPAPASRNAPEPADN 273 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,889 Number of Sequences: 336 Number of extensions: 2345 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25134219 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -