BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_O07 (1088 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p pro... 42 0.002 AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA... 42 0.002 AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB... 42 0.002 AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p pro... 39 0.010 AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA... 39 0.010 BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p pro... 37 0.042 AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA... 37 0.042 AE014298-2543|AAF48712.2| 237|Drosophila melanogaster CG12997-P... 36 0.13 AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p pro... 35 0.17 AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC... 35 0.17 AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB... 35 0.17 AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA... 35 0.17 AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p pro... 35 0.22 AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA,... 35 0.22 AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB,... 35 0.22 AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD,... 35 0.22 AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC,... 35 0.22 BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p pro... 34 0.39 AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA... 34 0.39 AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p pro... 33 0.69 AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA... 33 0.69 U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino pro... 33 0.91 BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p pro... 33 0.91 BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p pro... 33 0.91 AE014298-3099|AAN09667.1| 388|Drosophila melanogaster CG32521-P... 33 0.91 AE014298-3098|AAF50844.2| 388|Drosophila melanogaster CG32521-P... 33 0.91 BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p pro... 32 1.2 BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p pro... 32 1.2 AY119164-1|AAM51024.1| 192|Drosophila melanogaster RH23514p pro... 32 1.2 AM412919-1|CAL85542.1| 181|Drosophila melanogaster CG16743 prot... 32 1.2 AM412917-1|CAL85540.1| 181|Drosophila melanogaster CG16743 prot... 32 1.2 AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-P... 32 1.2 AE014134-1996|AAF53039.1| 192|Drosophila melanogaster CG16743-P... 32 1.2 AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA... 32 1.2 AE014296-862|AAF47912.1| 707|Drosophila melanogaster CG13722-PA... 31 2.1 BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p pro... 31 2.8 AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p pro... 31 2.8 AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA,... 31 2.8 AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB,... 31 2.8 AE014298-683|AAN09131.1| 642|Drosophila melanogaster CG2861-PB,... 31 3.7 AE014298-682|AAF45987.2| 1893|Drosophila melanogaster CG2861-PA,... 31 3.7 BT029946-1|ABM92820.1| 637|Drosophila melanogaster IP16971p pro... 30 4.8 AE013599-669|AAF59074.1| 417|Drosophila melanogaster CG14747-PA... 30 4.8 X58183-1|CAA41170.1| 386|Drosophila melanogaster heterogeneous ... 29 8.4 U18130-1|AAC46512.1| 1047|Drosophila melanogaster masquerade pro... 29 8.4 BT001597-1|AAN71352.1| 1047|Drosophila melanogaster RE29416p pro... 29 8.4 AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p pro... 29 8.4 AY060485-1|AAL25524.1| 696|Drosophila melanogaster SD09360p pro... 29 8.4 AY058599-1|AAL13828.1| 773|Drosophila melanogaster LD29226p pro... 29 8.4 AY052044-1|AAK93468.1| 581|Drosophila melanogaster LP06006p pro... 29 8.4 AE014298-2787|AAF48900.2| 2030|Drosophila melanogaster CG32542-P... 29 8.4 AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-P... 29 8.4 AE014296-779|AAF47850.1| 1047|Drosophila melanogaster CG15002-PB... 29 8.4 AE013599-3146|AAF46686.2| 1215|Drosophila melanogaster CG4266-PA... 29 8.4 AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA... 29 8.4 >AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p protein. Length = 846 Score = 41.5 bits (93), Expect = 0.002 Identities = 21/70 (30%), Positives = 24/70 (34%) Frame = +3 Query: 711 PXXXXPPXAPXXXPXXRHXSXPXTPPXXLXXXXPPIXXPF*LXPXXYPPXXRXXPXXXPP 890 P PP +P P H P PP PP P + P P P PP Sbjct: 118 PPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPP 177 Query: 891 XGPXXPDPPP 920 P +PPP Sbjct: 178 PAPPTVEPPP 187 Score = 34.7 bits (76), Expect = 0.22 Identities = 19/75 (25%), Positives = 24/75 (32%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLPXSXPXXX 813 P PP P P P+ P+ P P + PPP P P P P Sbjct: 164 PPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPP 223 Query: 814 QSXXRSNSLPXXTPP 858 + + P PP Sbjct: 224 PAPPKVELPPPPAPP 238 Score = 33.1 bits (72), Expect = 0.69 Identities = 17/65 (26%), Positives = 20/65 (30%) Frame = +1 Query: 610 PXXSTXKAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLL 789 P + P + P P P P P S PPP P P P L+ Sbjct: 90 PKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLV 149 Query: 790 PXSXP 804 P P Sbjct: 150 PPPPP 154 Score = 31.9 bits (69), Expect = 1.6 Identities = 22/92 (23%), Positives = 27/92 (29%), Gaps = 6/92 (6%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSY------PXSXYLXXPPPXXXPPXTPQXPXPLLPX 795 P P P P+ P+ P P + P + PPP PP P P P Sbjct: 110 PAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPT 169 Query: 796 SXPXXXQSXXRSNSLPXXTPPXXGXXLXXXPP 891 P P PP + PP Sbjct: 170 VEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPP 201 Score = 31.1 bits (67), Expect = 2.8 Identities = 20/83 (24%), Positives = 25/83 (30%) Frame = +1 Query: 643 PPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLPXSXPXXXQSX 822 PP P P P+ P+ P P + PPP P P P P P + Sbjct: 133 PPHTIEPPP-PPAPPTLVPPPP-PAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPP 190 Query: 823 XRSNSLPXXTPPXXGXXLXXXPP 891 + PP PP Sbjct: 191 PAPTKVEPPPPPAPAEVEPPPPP 213 Score = 30.3 bits (65), Expect = 4.8 Identities = 21/73 (28%), Positives = 22/73 (30%) Frame = +3 Query: 702 PLIPXXXXPPXAPXXXPXXRHXSXPXTPPXXLXXXXPPIXXPF*LXPXXYPPXXRXXPXX 881 P P PP P P P PP PP P + P PP Sbjct: 165 PAPPTVEPPPPPPPAPPTVE--PPPPPPPAPTKVEPPPPPAPAEVEPPP-PPAPTELEPP 221 Query: 882 XPPXGPXXPDPPP 920 PP P PPP Sbjct: 222 PPPAPPKVELPPP 234 Score = 29.9 bits (64), Expect = 6.4 Identities = 23/88 (26%), Positives = 28/88 (31%), Gaps = 2/88 (2%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXP-PXTPQXPXPLLPXS-XPX 807 P PP P P P+ P+ P P + PPP P P + P P P P Sbjct: 153 PPAPPTIKPPPP--PAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPP 210 Query: 808 XXQSXXRSNSLPXXTPPXXGXXLXXXPP 891 + P PP PP Sbjct: 211 PPPAPTELEPPPPPAPPKVELPPPPAPP 238 Score = 29.5 bits (63), Expect = 8.4 Identities = 19/73 (26%), Positives = 21/73 (28%) Frame = +3 Query: 702 PLIPXXXXPPXAPXXXPXXRHXSXPXTPPXXLXXXXPPIXXPF*LXPXXYPPXXRXXPXX 881 P P PP P P P P + PP P + P P P Sbjct: 153 PPAPPTIKPPPPPAP-PTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPP 211 Query: 882 XPPXGPXXPDPPP 920 P P PPP Sbjct: 212 PPAPTELEPPPPP 224 >AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA, isoform A protein. Length = 1109 Score = 41.5 bits (93), Expect = 0.002 Identities = 21/70 (30%), Positives = 24/70 (34%) Frame = +3 Query: 711 PXXXXPPXAPXXXPXXRHXSXPXTPPXXLXXXXPPIXXPF*LXPXXYPPXXRXXPXXXPP 890 P PP +P P H P PP PP P + P P P PP Sbjct: 381 PPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPP 440 Query: 891 XGPXXPDPPP 920 P +PPP Sbjct: 441 PAPPTVEPPP 450 Score = 34.7 bits (76), Expect = 0.22 Identities = 19/75 (25%), Positives = 24/75 (32%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLPXSXPXXX 813 P PP P P P+ P+ P P + PPP P P P P Sbjct: 427 PPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPP 486 Query: 814 QSXXRSNSLPXXTPP 858 + + P PP Sbjct: 487 PAPPKVELPPPPAPP 501 Score = 33.1 bits (72), Expect = 0.69 Identities = 17/65 (26%), Positives = 20/65 (30%) Frame = +1 Query: 610 PXXSTXKAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLL 789 P + P + P P P P P S PPP P P P L+ Sbjct: 353 PKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLV 412 Query: 790 PXSXP 804 P P Sbjct: 413 PPPPP 417 Score = 31.9 bits (69), Expect = 1.6 Identities = 22/92 (23%), Positives = 27/92 (29%), Gaps = 6/92 (6%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSY------PXSXYLXXPPPXXXPPXTPQXPXPLLPX 795 P P P P+ P+ P P + P + PPP PP P P P Sbjct: 373 PAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPT 432 Query: 796 SXPXXXQSXXRSNSLPXXTPPXXGXXLXXXPP 891 P P PP + PP Sbjct: 433 VEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPP 464 Score = 31.1 bits (67), Expect = 2.8 Identities = 20/83 (24%), Positives = 25/83 (30%) Frame = +1 Query: 643 PPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLPXSXPXXXQSX 822 PP P P P+ P+ P P + PPP P P P P P + Sbjct: 396 PPHTIEPPP-PPAPPTLVPPPP-PAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPP 453 Query: 823 XRSNSLPXXTPPXXGXXLXXXPP 891 + PP PP Sbjct: 454 PAPTKVEPPPPPAPAEVEPPPPP 476 Score = 30.3 bits (65), Expect = 4.8 Identities = 21/73 (28%), Positives = 22/73 (30%) Frame = +3 Query: 702 PLIPXXXXPPXAPXXXPXXRHXSXPXTPPXXLXXXXPPIXXPF*LXPXXYPPXXRXXPXX 881 P P PP P P P PP PP P + P PP Sbjct: 428 PAPPTVEPPPPPPPAPPTVE--PPPPPPPAPTKVEPPPPPAPAEVEPPP-PPAPTELEPP 484 Query: 882 XPPXGPXXPDPPP 920 PP P PPP Sbjct: 485 PPPAPPKVELPPP 497 Score = 29.9 bits (64), Expect = 6.4 Identities = 23/88 (26%), Positives = 28/88 (31%), Gaps = 2/88 (2%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXP-PXTPQXPXPLLPXS-XPX 807 P PP P P P+ P+ P P + PPP P P + P P P P Sbjct: 416 PPAPPTIKPPPP--PAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPP 473 Query: 808 XXQSXXRSNSLPXXTPPXXGXXLXXXPP 891 + P PP PP Sbjct: 474 PPPAPTELEPPPPPAPPKVELPPPPAPP 501 Score = 29.5 bits (63), Expect = 8.4 Identities = 19/73 (26%), Positives = 21/73 (28%) Frame = +3 Query: 702 PLIPXXXXPPXAPXXXPXXRHXSXPXTPPXXLXXXXPPIXXPF*LXPXXYPPXXRXXPXX 881 P P PP P P P P + PP P + P P P Sbjct: 416 PPAPPTIKPPPPPAP-PTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPP 474 Query: 882 XPPXGPXXPDPPP 920 P P PPP Sbjct: 475 PPAPTELEPPPPP 487 >AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB, isoform B protein. Length = 1150 Score = 41.5 bits (93), Expect = 0.002 Identities = 21/70 (30%), Positives = 24/70 (34%) Frame = +3 Query: 711 PXXXXPPXAPXXXPXXRHXSXPXTPPXXLXXXXPPIXXPF*LXPXXYPPXXRXXPXXXPP 890 P PP +P P H P PP PP P + P P P PP Sbjct: 381 PPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPP 440 Query: 891 XGPXXPDPPP 920 P +PPP Sbjct: 441 PAPPTVEPPP 450 Score = 34.7 bits (76), Expect = 0.22 Identities = 19/75 (25%), Positives = 24/75 (32%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLPXSXPXXX 813 P PP P P P+ P+ P P + PPP P P P P Sbjct: 427 PPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPP 486 Query: 814 QSXXRSNSLPXXTPP 858 + + P PP Sbjct: 487 PAPPKVELPPPPAPP 501 Score = 33.1 bits (72), Expect = 0.69 Identities = 17/65 (26%), Positives = 20/65 (30%) Frame = +1 Query: 610 PXXSTXKAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLL 789 P + P + P P P P P S PPP P P P L+ Sbjct: 353 PKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLV 412 Query: 790 PXSXP 804 P P Sbjct: 413 PPPPP 417 Score = 31.9 bits (69), Expect = 1.6 Identities = 22/92 (23%), Positives = 27/92 (29%), Gaps = 6/92 (6%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSY------PXSXYLXXPPPXXXPPXTPQXPXPLLPX 795 P P P P+ P+ P P + P + PPP PP P P P Sbjct: 373 PAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPT 432 Query: 796 SXPXXXQSXXRSNSLPXXTPPXXGXXLXXXPP 891 P P PP + PP Sbjct: 433 VEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPP 464 Score = 31.1 bits (67), Expect = 2.8 Identities = 20/83 (24%), Positives = 25/83 (30%) Frame = +1 Query: 643 PPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLPXSXPXXXQSX 822 PP P P P+ P+ P P + PPP P P P P P + Sbjct: 396 PPHTIEPPP-PPAPPTLVPPPP-PAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPP 453 Query: 823 XRSNSLPXXTPPXXGXXLXXXPP 891 + PP PP Sbjct: 454 PAPTKVEPPPPPAPAEVEPPPPP 476 Score = 30.3 bits (65), Expect = 4.8 Identities = 21/73 (28%), Positives = 22/73 (30%) Frame = +3 Query: 702 PLIPXXXXPPXAPXXXPXXRHXSXPXTPPXXLXXXXPPIXXPF*LXPXXYPPXXRXXPXX 881 P P PP P P P PP PP P + P PP Sbjct: 428 PAPPTVEPPPPPPPAPPTVE--PPPPPPPAPTKVEPPPPPAPAEVEPPP-PPAPTELEPP 484 Query: 882 XPPXGPXXPDPPP 920 PP P PPP Sbjct: 485 PPPAPPKVELPPP 497 Score = 29.9 bits (64), Expect = 6.4 Identities = 23/88 (26%), Positives = 28/88 (31%), Gaps = 2/88 (2%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXP-PXTPQXPXPLLPXS-XPX 807 P PP P P P+ P+ P P + PPP P P + P P P P Sbjct: 416 PPAPPTIKPPPP--PAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPP 473 Query: 808 XXQSXXRSNSLPXXTPPXXGXXLXXXPP 891 + P PP PP Sbjct: 474 PPPAPTELEPPPPPAPPKVELPPPPAPP 501 Score = 29.5 bits (63), Expect = 8.4 Identities = 19/73 (26%), Positives = 21/73 (28%) Frame = +3 Query: 702 PLIPXXXXPPXAPXXXPXXRHXSXPXTPPXXLXXXXPPIXXPF*LXPXXYPPXXRXXPXX 881 P P PP P P P P + PP P + P P P Sbjct: 416 PPAPPTIKPPPPPAP-PTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPP 474 Query: 882 XPPXGPXXPDPPP 920 P P PPP Sbjct: 475 PPAPTELEPPPPP 487 >AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p protein. Length = 420 Score = 39.1 bits (87), Expect = 0.010 Identities = 28/97 (28%), Positives = 31/97 (31%), Gaps = 5/97 (5%) Frame = +1 Query: 583 PXXSXAXRXPXXSTXKAPXX---PPXRXHPTPRXPSXPSXXPSXSY-PXSXYLXXPPPXX 750 P + R P T AP PP P P+ PS PS P Y P P P Sbjct: 146 PPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSR 205 Query: 751 XPPXTPQXPXPL-LPXSXPXXXQSXXRSNSLPXXTPP 858 P P P P P P + P PP Sbjct: 206 PQPPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPP 242 Score = 39.1 bits (87), Expect = 0.010 Identities = 24/71 (33%), Positives = 25/71 (35%), Gaps = 2/71 (2%) Frame = +1 Query: 610 PXXSTXKAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXY-LXXPPPXXXP-PXTPQXPXP 783 P S + P PP R PTP P P P Y PPP P PQ P P Sbjct: 201 PTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRP 260 Query: 784 LLPXSXPXXXQ 816 P P Q Sbjct: 261 QPPRPQPPRPQ 271 Score = 38.7 bits (86), Expect = 0.014 Identities = 23/70 (32%), Positives = 25/70 (35%) Frame = +1 Query: 583 PXXSXAXRXPXXSTXKAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPX 762 P + R P T AP PP P P P P+ S P PPP PP Sbjct: 95 PPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAP------APPPSYGPPQ 148 Query: 763 TPQXPXPLLP 792 TP P P Sbjct: 149 TPPPRPPPQP 158 Score = 38.3 bits (85), Expect = 0.018 Identities = 28/82 (34%), Positives = 31/82 (37%), Gaps = 1/82 (1%) Frame = +1 Query: 562 PXSRTXXPXXSXAXRXPXXSTXKAPXXPPXRXHP-TPRXPSXPSXXPSXSYPXSXYLXXP 738 P + P + R P T AP PP P TP P P P+ S P Y Sbjct: 114 PPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTP--PPRPPPQPTPSAPAPSY---G 168 Query: 739 PPXXXPPXTPQXPXPLLPXSXP 804 PP PP PQ P P P P Sbjct: 169 PPQPQPP-APQPPSPPSPQPGP 189 Score = 33.9 bits (74), Expect = 0.39 Identities = 23/75 (30%), Positives = 25/75 (33%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLPXSXPXXX 813 P P R PTP P P P P Y PPP PP PQ P + P Sbjct: 194 PDQPKPR--PTPSRPQPPPPPPPRPQPTPGYGPPPPP---PPPKPQPTPGYGPPTPPPGP 248 Query: 814 QSXXRSNSLPXXTPP 858 + P PP Sbjct: 249 GPAQPAPQPPRPQPP 263 Score = 32.3 bits (70), Expect = 1.2 Identities = 18/65 (27%), Positives = 19/65 (29%) Frame = +1 Query: 610 PXXSTXKAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLL 789 P P P P P P P+ S P PP PP P P P Sbjct: 78 PPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSA 137 Query: 790 PXSXP 804 P P Sbjct: 138 PAPPP 142 Score = 31.5 bits (68), Expect = 2.1 Identities = 22/76 (28%), Positives = 24/76 (31%), Gaps = 1/76 (1%) Frame = +1 Query: 568 SRTXXPXXSXAXRXPXXSTXKAPXXPPXRXHPTP-RXPSXPSXXPSXSYPXSXYLXXPPP 744 SR P P P PP + PTP P P P + P PP Sbjct: 204 SRPQPPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPP 263 Query: 745 XXXPPXTPQXPXPLLP 792 PP PQ LP Sbjct: 264 RPQPP-RPQPGSEYLP 278 Score = 31.1 bits (67), Expect = 2.8 Identities = 23/87 (26%), Positives = 26/87 (29%) Frame = +1 Query: 631 APXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLPXSXPXX 810 AP P P P P P + P + PP PP P P P P P Sbjct: 60 APSAPAPSYGPPQTRPPPPPPPPQPT-PPAPRPSYGPPQTQPPRPPPQPTPSAPAPPP-- 116 Query: 811 XQSXXRSNSLPXXTPPXXGXXLXXXPP 891 S + P PP PP Sbjct: 117 -PSYGPPQTPPPRPPPQPTPSAPAPPP 142 Score = 30.3 bits (65), Expect = 4.8 Identities = 22/85 (25%), Positives = 27/85 (31%), Gaps = 11/85 (12%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSY-----------PXSXYLXXPPPXXXPPXTPQXPX 780 P PP PR P+ P+ P +Y P Y PP PP P Sbjct: 303 PPAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPPAPTYQPQ 362 Query: 781 PLLPXSXPXXXQSXXRSNSLPXXTP 855 P P + R + P TP Sbjct: 363 PPAPPAPAPGPTYQPRPPAPPAPTP 387 Score = 29.9 bits (64), Expect = 6.4 Identities = 24/83 (28%), Positives = 26/83 (31%), Gaps = 8/83 (9%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSYPX--------SXYLXXPPPXXXPPXTPQXPXPLL 789 P PP PTP P PS P + P S PP P P P P Sbjct: 75 PPPPPPPPQPTPPAPR-PSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQP 133 Query: 790 PXSXPXXXQSXXRSNSLPXXTPP 858 S P S + P PP Sbjct: 134 TPSAPAPPPSYGPPQTPPPRPPP 156 Score = 29.5 bits (63), Expect = 8.4 Identities = 22/82 (26%), Positives = 25/82 (30%), Gaps = 1/82 (1%) Frame = +1 Query: 562 PXSRTXXPXXSXAXRXPXXSTXKAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPP 741 P P S P + P P + P P P P+ S P PP Sbjct: 156 PQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQ----PPPP 211 Query: 742 PXXXPPXTP-QXPXPLLPXSXP 804 P P TP P P P P Sbjct: 212 PPPRPQPTPGYGPPPPPPPPKP 233 >AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA protein. Length = 420 Score = 39.1 bits (87), Expect = 0.010 Identities = 28/97 (28%), Positives = 31/97 (31%), Gaps = 5/97 (5%) Frame = +1 Query: 583 PXXSXAXRXPXXSTXKAPXX---PPXRXHPTPRXPSXPSXXPSXSY-PXSXYLXXPPPXX 750 P + R P T AP PP P P+ PS PS P Y P P P Sbjct: 146 PPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSR 205 Query: 751 XPPXTPQXPXPL-LPXSXPXXXQSXXRSNSLPXXTPP 858 P P P P P P + P PP Sbjct: 206 PQPPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPP 242 Score = 39.1 bits (87), Expect = 0.010 Identities = 24/71 (33%), Positives = 25/71 (35%), Gaps = 2/71 (2%) Frame = +1 Query: 610 PXXSTXKAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXY-LXXPPPXXXP-PXTPQXPXP 783 P S + P PP R PTP P P P Y PPP P PQ P P Sbjct: 201 PTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRP 260 Query: 784 LLPXSXPXXXQ 816 P P Q Sbjct: 261 QPPRPQPPRPQ 271 Score = 38.7 bits (86), Expect = 0.014 Identities = 23/70 (32%), Positives = 25/70 (35%) Frame = +1 Query: 583 PXXSXAXRXPXXSTXKAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPX 762 P + R P T AP PP P P P P+ S P PPP PP Sbjct: 95 PPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAP------APPPSYGPPQ 148 Query: 763 TPQXPXPLLP 792 TP P P Sbjct: 149 TPPPRPPPQP 158 Score = 38.3 bits (85), Expect = 0.018 Identities = 28/82 (34%), Positives = 31/82 (37%), Gaps = 1/82 (1%) Frame = +1 Query: 562 PXSRTXXPXXSXAXRXPXXSTXKAPXXPPXRXHP-TPRXPSXPSXXPSXSYPXSXYLXXP 738 P + P + R P T AP PP P TP P P P+ S P Y Sbjct: 114 PPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTP--PPRPPPQPTPSAPAPSY---G 168 Query: 739 PPXXXPPXTPQXPXPLLPXSXP 804 PP PP PQ P P P P Sbjct: 169 PPQPQPP-APQPPSPPSPQPGP 189 Score = 33.9 bits (74), Expect = 0.39 Identities = 23/75 (30%), Positives = 25/75 (33%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLPXSXPXXX 813 P P R PTP P P P P Y PPP PP PQ P + P Sbjct: 194 PDQPKPR--PTPSRPQPPPPPPPRPQPTPGYGPPPPP---PPPKPQPTPGYGPPTPPPGP 248 Query: 814 QSXXRSNSLPXXTPP 858 + P PP Sbjct: 249 GPAQPAPQPPRPQPP 263 Score = 32.3 bits (70), Expect = 1.2 Identities = 18/65 (27%), Positives = 19/65 (29%) Frame = +1 Query: 610 PXXSTXKAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLL 789 P P P P P P P+ S P PP PP P P P Sbjct: 78 PPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSA 137 Query: 790 PXSXP 804 P P Sbjct: 138 PAPPP 142 Score = 31.5 bits (68), Expect = 2.1 Identities = 22/76 (28%), Positives = 24/76 (31%), Gaps = 1/76 (1%) Frame = +1 Query: 568 SRTXXPXXSXAXRXPXXSTXKAPXXPPXRXHPTP-RXPSXPSXXPSXSYPXSXYLXXPPP 744 SR P P P PP + PTP P P P + P PP Sbjct: 204 SRPQPPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPP 263 Query: 745 XXXPPXTPQXPXPLLP 792 PP PQ LP Sbjct: 264 RPQPP-RPQPGSEYLP 278 Score = 31.1 bits (67), Expect = 2.8 Identities = 23/87 (26%), Positives = 26/87 (29%) Frame = +1 Query: 631 APXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLPXSXPXX 810 AP P P P P P + P + PP PP P P P P P Sbjct: 60 APSAPAPSYGPPQTRPPPPPPPPQPT-PPAPRPSYGPPQTQPPRPPPQPTPSAPAPPP-- 116 Query: 811 XQSXXRSNSLPXXTPPXXGXXLXXXPP 891 S + P PP PP Sbjct: 117 -PSYGPPQTPPPRPPPQPTPSAPAPPP 142 Score = 30.3 bits (65), Expect = 4.8 Identities = 22/85 (25%), Positives = 27/85 (31%), Gaps = 11/85 (12%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSY-----------PXSXYLXXPPPXXXPPXTPQXPX 780 P PP PR P+ P+ P +Y P Y PP PP P Sbjct: 303 PPAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPPAPTYQPQ 362 Query: 781 PLLPXSXPXXXQSXXRSNSLPXXTP 855 P P + R + P TP Sbjct: 363 PPAPPAPAPGPTYQPRPPAPPAPTP 387 Score = 29.9 bits (64), Expect = 6.4 Identities = 24/83 (28%), Positives = 26/83 (31%), Gaps = 8/83 (9%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSYPX--------SXYLXXPPPXXXPPXTPQXPXPLL 789 P PP PTP P PS P + P S PP P P P P Sbjct: 75 PPPPPPPPQPTPPAPR-PSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQP 133 Query: 790 PXSXPXXXQSXXRSNSLPXXTPP 858 S P S + P PP Sbjct: 134 TPSAPAPPPSYGPPQTPPPRPPP 156 Score = 29.5 bits (63), Expect = 8.4 Identities = 22/82 (26%), Positives = 25/82 (30%), Gaps = 1/82 (1%) Frame = +1 Query: 562 PXSRTXXPXXSXAXRXPXXSTXKAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPP 741 P P S P + P P + P P P P+ S P PP Sbjct: 156 PQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQ----PPPP 211 Query: 742 PXXXPPXTP-QXPXPLLPXSXP 804 P P TP P P P P Sbjct: 212 PPPRPQPTPGYGPPPPPPPPKP 233 >BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p protein. Length = 592 Score = 37.1 bits (82), Expect = 0.042 Identities = 19/59 (32%), Positives = 22/59 (37%) Frame = +1 Query: 610 PXXSTXKAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPL 786 P + P PP +P P P P P SYP Y PPP P P P+ Sbjct: 218 PPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPY-PYPPPGPYPGPWIPLPVPV 275 Score = 35.5 bits (78), Expect = 0.13 Identities = 19/59 (32%), Positives = 20/59 (33%) Frame = +1 Query: 628 KAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLPXSXP 804 K PP P P P P +YP PPP PP P P P P P Sbjct: 207 KGSKGPPGPPGPPGTGPPGPPGPPGTTYPQ----PPPPPPPPPPPPPSYPYPPYPYPPP 261 >AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA protein. Length = 594 Score = 37.1 bits (82), Expect = 0.042 Identities = 19/59 (32%), Positives = 22/59 (37%) Frame = +1 Query: 610 PXXSTXKAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPL 786 P + P PP +P P P P P SYP Y PPP P P P+ Sbjct: 220 PPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPY-PYPPPGPYPGPWIPLPVPV 277 Score = 35.5 bits (78), Expect = 0.13 Identities = 19/59 (32%), Positives = 20/59 (33%) Frame = +1 Query: 628 KAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLPXSXP 804 K PP P P P P +YP PPP PP P P P P P Sbjct: 209 KGSKGPPGPPGPPGTGPPGPPGPPGTTYPQ----PPPPPPPPPPPPPSYPYPPYPYPPP 263 >AE014298-2543|AAF48712.2| 237|Drosophila melanogaster CG12997-PA protein. Length = 237 Score = 35.5 bits (78), Expect = 0.13 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 2/67 (2%) Frame = +3 Query: 726 PPXAPXXXPXXRHXSXPXTPPXXLXXXXPPIXXPF*LXPXXYPPXXRXXPXXXPPXGP-- 899 P P P P PP PP+ P P PP PP P Sbjct: 100 PELPPDFQPELPELGQPEDPPEDQPPEPPPLFQPLEPPPLFQPPPDPPDDQPPPPSPPLF 159 Query: 900 XXPDPPP 920 PDPPP Sbjct: 160 HPPDPPP 166 Score = 29.5 bits (63), Expect = 8.4 Identities = 21/73 (28%), Positives = 23/73 (31%) Frame = +3 Query: 702 PLIPXXXXPPXAPXXXPXXRHXSXPXTPPXXLXXXXPPIXXPF*LXPXXYPPXXRXXPXX 881 P +P P P P P PP PP+ P P PP P Sbjct: 108 PELPELGQPEDPPEDQP-------PEPPPLFQPLEPPPLFQPPPDPPDDQPPPP-SPPLF 159 Query: 882 XPPXGPXXPDPPP 920 PP P PPP Sbjct: 160 HPPDPPPEDQPPP 172 >AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p protein. Length = 527 Score = 35.1 bits (77), Expect = 0.17 Identities = 21/73 (28%), Positives = 22/73 (30%), Gaps = 2/73 (2%) Frame = +3 Query: 702 PLIPXXXXPPXAPXXXPXXRHXSXPXT--PPXXLXXXXPPIXXPF*LXPXXYPPXXRXXP 875 PL P PP P P P PP PP+ P P PP P Sbjct: 335 PLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVP 394 Query: 876 XXXPPXGPXXPDP 914 PP P P Sbjct: 395 PPPPPPMPVGEIP 407 >AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC, isoform C protein. Length = 494 Score = 35.1 bits (77), Expect = 0.17 Identities = 21/73 (28%), Positives = 22/73 (30%), Gaps = 2/73 (2%) Frame = +3 Query: 702 PLIPXXXXPPXAPXXXPXXRHXSXPXT--PPXXLXXXXPPIXXPF*LXPXXYPPXXRXXP 875 PL P PP P P P PP PP+ P P PP P Sbjct: 302 PLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVP 361 Query: 876 XXXPPXGPXXPDP 914 PP P P Sbjct: 362 PPPPPPMPVGEIP 374 >AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB, isoform B protein. Length = 527 Score = 35.1 bits (77), Expect = 0.17 Identities = 21/73 (28%), Positives = 22/73 (30%), Gaps = 2/73 (2%) Frame = +3 Query: 702 PLIPXXXXPPXAPXXXPXXRHXSXPXT--PPXXLXXXXPPIXXPF*LXPXXYPPXXRXXP 875 PL P PP P P P PP PP+ P P PP P Sbjct: 335 PLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVP 394 Query: 876 XXXPPXGPXXPDP 914 PP P P Sbjct: 395 PPPPPPMPVGEIP 407 >AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA, isoform A protein. Length = 527 Score = 35.1 bits (77), Expect = 0.17 Identities = 21/73 (28%), Positives = 22/73 (30%), Gaps = 2/73 (2%) Frame = +3 Query: 702 PLIPXXXXPPXAPXXXPXXRHXSXPXT--PPXXLXXXXPPIXXPF*LXPXXYPPXXRXXP 875 PL P PP P P P PP PP+ P P PP P Sbjct: 335 PLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVP 394 Query: 876 XXXPPXGPXXPDP 914 PP P P Sbjct: 395 PPPPPPMPVGEIP 407 >AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p protein. Length = 1049 Score = 34.7 bits (76), Expect = 0.22 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLP 792 P PP H P P P P + Y PPP PP + P P P Sbjct: 477 PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 >AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA, isoform A protein. Length = 1059 Score = 34.7 bits (76), Expect = 0.22 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLP 792 P PP H P P P P + Y PPP PP + P P P Sbjct: 487 PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 539 >AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB, isoform B protein. Length = 1049 Score = 34.7 bits (76), Expect = 0.22 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLP 792 P PP H P P P P + Y PPP PP + P P P Sbjct: 477 PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 >AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD, isoform D protein. Length = 1207 Score = 34.7 bits (76), Expect = 0.22 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLP 792 P PP H P P P P + Y PPP PP + P P P Sbjct: 635 PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 687 >AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC, isoform C protein. Length = 1154 Score = 34.7 bits (76), Expect = 0.22 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLP 792 P PP H P P P P + Y PPP PP + P P P Sbjct: 582 PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 634 >BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p protein. Length = 478 Score = 33.9 bits (74), Expect = 0.39 Identities = 27/101 (26%), Positives = 31/101 (30%), Gaps = 7/101 (6%) Frame = +1 Query: 610 PXXSTXKAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTP-QXPXP- 783 P K P PP P P P+ P+ YP P P P TP P P Sbjct: 159 PLEEPEKCPLSPP----PPPSPPAMAPPLPAKPYPYPDLAAMPFPDRPPAYTPTPDPMPP 214 Query: 784 -----LLPXSXPXXXQSXXRSNSLPXXTPPXXGXXLXXXPP 891 ++P P P PP G L PP Sbjct: 215 VGGVMVMPSPTPPPPAGGVLVMPRPPPPPPPAGGVLVMPPP 255 >AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA, isoform A protein. Length = 478 Score = 33.9 bits (74), Expect = 0.39 Identities = 27/101 (26%), Positives = 31/101 (30%), Gaps = 7/101 (6%) Frame = +1 Query: 610 PXXSTXKAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTP-QXPXP- 783 P K P PP P P P+ P+ YP P P P TP P P Sbjct: 159 PLEEPEKCPLSPP----PPPSPPAMAPPLPAKPYPYPDLAAMPFPDRPPAYTPTPDPMPP 214 Query: 784 -----LLPXSXPXXXQSXXRSNSLPXXTPPXXGXXLXXXPP 891 ++P P P PP G L PP Sbjct: 215 VGGVMVMPSPTPPPPAGGVLVMPRPPPPPPPAGGVLVMPPP 255 >AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p protein. Length = 295 Score = 33.1 bits (72), Expect = 0.69 Identities = 22/74 (29%), Positives = 25/74 (33%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLPXSXPXXX 813 P PP T PS P P + YL PP P P P P++ Sbjct: 114 PPPPPPPPKATYLPPSKPEVKYLPPEPVAKYL---PPKVAPSLPPPPPPPVVAPKPTYLP 170 Query: 814 QSXXRSNSLPXXTP 855 S S LP TP Sbjct: 171 PSPPESKYLPPPTP 184 >AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA protein. Length = 295 Score = 33.1 bits (72), Expect = 0.69 Identities = 22/74 (29%), Positives = 25/74 (33%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLPXSXPXXX 813 P PP T PS P P + YL PP P P P P++ Sbjct: 114 PPPPPPPPKATYLPPSKPEVKYLPPEPVAKYL---PPKVAPSLPPPPPPPVVAPKPTYLP 170 Query: 814 QSXXRSNSLPXXTP 855 S S LP TP Sbjct: 171 PSPPESKYLPPPTP 184 >U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino protein. Length = 1058 Score = 32.7 bits (71), Expect = 0.91 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLP 792 P PP P P P P P + Y PPP PP + P P P Sbjct: 486 PPPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 538 >BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p protein. Length = 1153 Score = 32.7 bits (71), Expect = 0.91 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLP 792 P PP P P P P P + Y PPP PP + P P P Sbjct: 581 PPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPP 633 >BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p protein. Length = 1286 Score = 32.7 bits (71), Expect = 0.91 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +1 Query: 634 PXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLP 792 P PP P P P P P + Y PPP PP + P P P Sbjct: 714 PPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPP 766 >AE014298-3099|AAN09667.1| 388|Drosophila melanogaster CG32521-PB, isoform B protein. Length = 388 Score = 32.7 bits (71), Expect = 0.91 Identities = 20/58 (34%), Positives = 22/58 (37%) Frame = -2 Query: 898 GPXGGXXXGXXLXQGGYXKGXS*NGXXIGGXXXQRXXGGVXGXEXXRXXGXXXGAXGG 725 GP GG G GGY G + G GG GG+ G G GA GG Sbjct: 260 GPGGGQPAGGYQPSGGYGGGPAAGG---GGSGGSNILGGLLGSVLSGGGGGNAGAGGG 314 >AE014298-3098|AAF50844.2| 388|Drosophila melanogaster CG32521-PA, isoform A protein. Length = 388 Score = 32.7 bits (71), Expect = 0.91 Identities = 20/58 (34%), Positives = 22/58 (37%) Frame = -2 Query: 898 GPXGGXXXGXXLXQGGYXKGXS*NGXXIGGXXXQRXXGGVXGXEXXRXXGXXXGAXGG 725 GP GG G GGY G + G GG GG+ G G GA GG Sbjct: 260 GPGGGQPAGGYQPSGGYGGGPAAGG---GGSGGSNILGGLLGSVLSGGGGGNAGAGGG 314 >BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p protein. Length = 207 Score = 32.3 bits (70), Expect = 1.2 Identities = 18/59 (30%), Positives = 20/59 (33%), Gaps = 2/59 (3%) Frame = +1 Query: 622 TXKAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXP--PPXXXPPXTPQXPXPLLP 792 T AP PP P P P + P + P P P PP P P P P Sbjct: 46 TPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 104 Score = 31.5 bits (68), Expect = 2.1 Identities = 22/71 (30%), Positives = 23/71 (32%) Frame = +3 Query: 702 PLIPXXXXPPXAPXXXPXXRHXSXPXTPPXXLXXXXPPIXXPF*LXPXXYPPXXRXXPXX 881 P +P P AP P R P PP PP P P P P Sbjct: 38 PYVPDNFPTPSAPAPPPKPRPPPPPPPPPTTTR---PPTTTP---TPTTTPTPITTPPPP 91 Query: 882 XPPXGPXXPDP 914 PP P PDP Sbjct: 92 -PPSAPPPPDP 101 >BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p protein. Length = 207 Score = 32.3 bits (70), Expect = 1.2 Identities = 18/59 (30%), Positives = 20/59 (33%), Gaps = 2/59 (3%) Frame = +1 Query: 622 TXKAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXP--PPXXXPPXTPQXPXPLLP 792 T AP PP P P P + P + P P P PP P P P P Sbjct: 46 TPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 104 Score = 31.5 bits (68), Expect = 2.1 Identities = 22/71 (30%), Positives = 23/71 (32%) Frame = +3 Query: 702 PLIPXXXXPPXAPXXXPXXRHXSXPXTPPXXLXXXXPPIXXPF*LXPXXYPPXXRXXPXX 881 P +P P AP P R P PP PP P P P P Sbjct: 38 PYVPDNFPTPSAPAPPPKPRPPPPPPPPPTTTR---PPTTTP---TPTTTPTPITTPPPP 91 Query: 882 XPPXGPXXPDP 914 PP P PDP Sbjct: 92 -PPSAPPPPDP 101 >AY119164-1|AAM51024.1| 192|Drosophila melanogaster RH23514p protein. Length = 192 Score = 32.3 bits (70), Expect = 1.2 Identities = 19/71 (26%), Positives = 23/71 (32%) Frame = +1 Query: 643 PPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLPXSXPXXXQSX 822 P +P P P SYP + Y+ PPP PP Q P P + P Sbjct: 68 PSYLYNPYMPYPPYPQMGGYPSYPYNLYM--PPPPPPPPHPQQAPPPSMYPPDPSGYPGG 125 Query: 823 XRSNSLPXXTP 855 P P Sbjct: 126 YPPQGAPGQNP 136 >AM412919-1|CAL85542.1| 181|Drosophila melanogaster CG16743 protein protein. Length = 181 Score = 32.3 bits (70), Expect = 1.2 Identities = 19/71 (26%), Positives = 23/71 (32%) Frame = +1 Query: 643 PPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLPXSXPXXXQSX 822 P +P P P SYP + Y+ PPP PP Q P P + P Sbjct: 68 PSYLYNPYMPYPPYPQMGGYPSYPYNPYM--PPPPPPPPHPQQAPPPSMYPPGPSGYPGG 125 Query: 823 XRSNSLPXXTP 855 P P Sbjct: 126 YPPQGAPGQNP 136 >AM412917-1|CAL85540.1| 181|Drosophila melanogaster CG16743 protein protein. Length = 181 Score = 32.3 bits (70), Expect = 1.2 Identities = 19/71 (26%), Positives = 23/71 (32%) Frame = +1 Query: 643 PPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLPXSXPXXXQSX 822 P +P P P SYP + Y+ PPP PP Q P P + P Sbjct: 68 PSYLYNPYMPYPPYPQMGGYPSYPYNPYM--PPPPPPPPHPQQAPPPSMYPPGPSGYPGG 125 Query: 823 XRSNSLPXXTP 855 P P Sbjct: 126 YPPQGAPGQNP 136 >AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-PA protein. Length = 926 Score = 32.3 bits (70), Expect = 1.2 Identities = 21/65 (32%), Positives = 23/65 (35%), Gaps = 1/65 (1%) Frame = +3 Query: 726 PPXAPXXXPXXRHXSXPXT-PPXXLXXXXPPIXXPF*LXPXXYPPXXRXXPXXXPPXGPX 902 PP P P R + P T PP L P+ P PP R P PP P Sbjct: 189 PPTRPPTRPPTRPPTRPPTPPPTYLPPTNKPLPPVTTRLPPP-PPPPRTPPPTRPPTRPP 247 Query: 903 XPDPP 917 PP Sbjct: 248 TTRPP 252 Score = 31.9 bits (69), Expect = 1.6 Identities = 22/77 (28%), Positives = 23/77 (29%), Gaps = 4/77 (5%) Frame = +3 Query: 702 PLIPXXXXPPXAPXXXPXXRHXSXPXTPPXXLXXXXPPIXXPF*LXPXXY-PPXXRXXP- 875 P P PP P P PP PP P P Y PP + P Sbjct: 206 PTPPPTYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPPTRPPTTRPPATYLPPTNKPLPP 265 Query: 876 --XXXPPXGPXXPDPPP 920 PP P PPP Sbjct: 266 VTTRLPPPPPSPRTPPP 282 Score = 31.9 bits (69), Expect = 1.6 Identities = 21/76 (27%), Positives = 27/76 (35%) Frame = +1 Query: 556 LXPXSRTXXPXXSXAXRXPXXSTXKAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXX 735 L P ++ P + P P PP R PT R P+ + P + P Sbjct: 256 LPPTNKPLPPVTTRLPPPPPSPRTPPPTRPPTRP-PTTRPPA--TYLPPTNKPLPPVTTR 312 Query: 736 PPPXXXPPXTPQXPXP 783 PP PP TP P Sbjct: 313 LPPPPPPPRTPPPTRP 328 Score = 31.9 bits (69), Expect = 1.6 Identities = 20/70 (28%), Positives = 20/70 (28%) Frame = +3 Query: 711 PXXXXPPXAPXXXPXXRHXSXPXTPPXXLXXXXPPIXXPF*LXPXXYPPXXRXXPXXXPP 890 P PP P P PP PP P P Y P P PP Sbjct: 295 PATYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPPTKPPTTRPPATYLPPTNKPP---PP 351 Query: 891 XGPXXPDPPP 920 P PPP Sbjct: 352 VTTRRPTPPP 361 Score = 31.1 bits (67), Expect = 2.8 Identities = 25/79 (31%), Positives = 29/79 (36%) Frame = +1 Query: 622 TXKAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLPXSX 801 T + P PP R P R P+ P P P YL P PP T + P P P Sbjct: 182 TTQPPTRPPTR--PPTRPPTRPPTRPPT--PPPTYLP-PTNKPLPPVTTRLPPPPPPPRT 236 Query: 802 PXXXQSXXRSNSLPXXTPP 858 P + R P PP Sbjct: 237 PPPTRPPTRP---PTTRPP 252 Score = 31.1 bits (67), Expect = 2.8 Identities = 22/83 (26%), Positives = 27/83 (32%), Gaps = 2/83 (2%) Frame = +1 Query: 610 PXXSTXKAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLL 789 P + P PP R P P P+ P + P PP PP TP P Sbjct: 186 PTRPPTRPPTRPPTRPPTRPPTPP-PTYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPPT 244 Query: 790 --PXSXPXXXQSXXRSNSLPXXT 852 P + P + LP T Sbjct: 245 RPPTTRPPATYLPPTNKPLPPVT 267 Score = 30.7 bits (66), Expect = 3.7 Identities = 23/97 (23%), Positives = 31/97 (31%), Gaps = 3/97 (3%) Frame = +1 Query: 610 PXXSTXKAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPP---PXXXPPXTPQXPX 780 P + P PP PT P+ P +Y PP PP +P+ P Sbjct: 222 PVTTRLPPPPPPPRTPPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPSPRTPP 281 Query: 781 PLLPXSXPXXXQSXXRSNSLPXXTPPXXGXXLXXXPP 891 P P + P + + LP P PP Sbjct: 282 PTRPPTRPPTTRPP--ATYLPPTNKPLPPVTTRLPPP 316 >AE014134-1996|AAF53039.1| 192|Drosophila melanogaster CG16743-PA protein. Length = 192 Score = 32.3 bits (70), Expect = 1.2 Identities = 19/71 (26%), Positives = 23/71 (32%) Frame = +1 Query: 643 PPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXPXPLLPXSXPXXXQSX 822 P +P P P SYP + Y+ PPP PP Q P P + P Sbjct: 68 PSYLYNPYMPYPPYPQMGGYPSYPYNLYM--PPPPPPPPHPQQAPPPSMYPPDPSGYPGG 125 Query: 823 XRSNSLPXXTP 855 P P Sbjct: 126 YPPQGAPGQNP 136 >AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA protein. Length = 1118 Score = 32.3 bits (70), Expect = 1.2 Identities = 18/59 (30%), Positives = 20/59 (33%), Gaps = 2/59 (3%) Frame = +1 Query: 622 TXKAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXP--PPXXXPPXTPQXPXPLLP 792 T AP PP P P P + P + P P P PP P P P P Sbjct: 28 TPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 86 Score = 31.5 bits (68), Expect = 2.1 Identities = 22/71 (30%), Positives = 23/71 (32%) Frame = +3 Query: 702 PLIPXXXXPPXAPXXXPXXRHXSXPXTPPXXLXXXXPPIXXPF*LXPXXYPPXXRXXPXX 881 P +P P AP P R P PP PP P P P P Sbjct: 20 PYVPDNFPTPSAPAPPPKPRPPPPPPPPPTTTR---PPTTTP---TPTTTPTPITTPPPP 73 Query: 882 XPPXGPXXPDP 914 PP P PDP Sbjct: 74 -PPSAPPPPDP 83 >AE014296-862|AAF47912.1| 707|Drosophila melanogaster CG13722-PA protein. Length = 707 Score = 31.5 bits (68), Expect = 2.1 Identities = 23/80 (28%), Positives = 27/80 (33%), Gaps = 4/80 (5%) Frame = +1 Query: 631 APXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPP--PXXXPPXTPQX--PXPLLPXS 798 +P P P P P P P P S Y P P P PQ P P++P S Sbjct: 453 SPPQPKYLPPPKPTNPPQPKYLPPPQ-PKSGYDYPKPAIPFPAPTNPPQKYLPPPVIPTS 511 Query: 799 XPXXXQSXXRSNSLPXXTPP 858 P + P PP Sbjct: 512 PPVPKYLPPTNPPTPQYLPP 531 >BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p protein. Length = 212 Score = 31.1 bits (67), Expect = 2.8 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 840 PXXYPPXXRXXPXXXPPXGPXXPDPPP 920 P YPP + PP GP P PPP Sbjct: 83 PPAYPPPPQRPWGPPPPPGPPPPGPPP 109 >AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p protein. Length = 242 Score = 31.1 bits (67), Expect = 2.8 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 840 PXXYPPXXRXXPXXXPPXGPXXPDPPP 920 P YPP + PP GP P PPP Sbjct: 113 PPAYPPPPQRPWGPPPPPGPPPPGPPP 139 >AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA, isoform A protein. Length = 242 Score = 31.1 bits (67), Expect = 2.8 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 840 PXXYPPXXRXXPXXXPPXGPXXPDPPP 920 P YPP + PP GP P PPP Sbjct: 113 PPAYPPPPQRPWGPPPPPGPPPPGPPP 139 >AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB, isoform B protein. Length = 212 Score = 31.1 bits (67), Expect = 2.8 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 840 PXXYPPXXRXXPXXXPPXGPXXPDPPP 920 P YPP + PP GP P PPP Sbjct: 83 PPAYPPPPQRPWGPPPPPGPPPPGPPP 109 >AE014298-683|AAN09131.1| 642|Drosophila melanogaster CG2861-PB, isoform B protein. Length = 642 Score = 30.7 bits (66), Expect = 3.7 Identities = 16/51 (31%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +1 Query: 628 KAPXXPPXRXHP-TPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXP 777 KAP P P PR P P + P + + PP PP P+ P Sbjct: 448 KAPKEPKAPKVPKAPRVPKAPRVPKAPRVPKAPRVPKPPKEPKPPKEPKPP 498 >AE014298-682|AAF45987.2| 1893|Drosophila melanogaster CG2861-PA, isoform A protein. Length = 1893 Score = 30.7 bits (66), Expect = 3.7 Identities = 16/51 (31%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +1 Query: 628 KAPXXPPXRXHP-TPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPXTPQXP 777 KAP P P PR P P + P + + PP PP P+ P Sbjct: 667 KAPKEPKAPKVPKAPRVPKAPRVPKAPRVPKAPRVPKPPKEPKPPKEPKPP 717 >BT029946-1|ABM92820.1| 637|Drosophila melanogaster IP16971p protein. Length = 637 Score = 30.3 bits (65), Expect = 4.8 Identities = 27/99 (27%), Positives = 31/99 (31%) Frame = +1 Query: 562 PXSRTXXPXXSXAXRXPXXSTXKAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPP 741 P S + S A R P + + P PP PT P P S P S Y P Sbjct: 297 PSSGSSEERPSYAARPPRPTADR-PEYPPGPPRPTADRPEYPPRPYEGSTPPS-YGPRPS 354 Query: 742 PXXXPPXTPQXPXPLLPXSXPXXXQSXXRSNSLPXXTPP 858 P P P+ P Q N P PP Sbjct: 355 PSYDPDREPRPDYTNRPDPPSLSPQVGYGMNG-PSARPP 392 >AE013599-669|AAF59074.1| 417|Drosophila melanogaster CG14747-PA protein. Length = 417 Score = 30.3 bits (65), Expect = 4.8 Identities = 27/99 (27%), Positives = 31/99 (31%) Frame = +1 Query: 562 PXSRTXXPXXSXAXRXPXXSTXKAPXXPPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPP 741 P S + S A R P + + P PP PT P P S P S Y P Sbjct: 244 PSSGSSEERPSYAARPPRPTADR-PEYPPGPPRPTADRPEYPPRPYEGSTPPS-YGPRPS 301 Query: 742 PXXXPPXTPQXPXPLLPXSXPXXXQSXXRSNSLPXXTPP 858 P P P+ P Q N P PP Sbjct: 302 PSYDPDREPRPDYTNRPDPPSLSPQVGYGMNG-PSARPP 339 >X58183-1|CAA41170.1| 386|Drosophila melanogaster heterogeneous nuclear ribonucleoproteinprotein. Length = 386 Score = 29.5 bits (63), Expect = 8.4 Identities = 31/100 (31%), Positives = 31/100 (31%) Frame = -1 Query: 917 GGVWXXRPXGGXXXRXXPXXGGVXXGXELERXXDWXXXGXEXGRRGXGX*GVXGGWXXGG 738 GG W R GG GG G W G G G GGW GG Sbjct: 235 GGNWGGRGGGGGFGNSGGNFGGGQGGGS----GGWNQQGGTGGGPWNNQGGGNGGWNGGG 290 Query: 737 GXXRXXXXGYEXEGXXEGXDGXLGVG*XRXGGXSGAFXVE 618 G GY G G G G G GG G F E Sbjct: 291 G-----GGGY-GGGNSNGSWGGNGGG----GGGGGGFGNE 320 >U18130-1|AAC46512.1| 1047|Drosophila melanogaster masquerade protein. Length = 1047 Score = 29.5 bits (63), Expect = 8.4 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +1 Query: 661 PTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPX-TPQXPXPLLP 792 P P P P + P S Y+ PPP PP P P P P Sbjct: 590 PPPPPIGPPQAYPPQTPPYS-YMNNPPPQGPPPQMAPHHPNPYQP 633 >BT001597-1|AAN71352.1| 1047|Drosophila melanogaster RE29416p protein. Length = 1047 Score = 29.5 bits (63), Expect = 8.4 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +1 Query: 661 PTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPX-TPQXPXPLLP 792 P P P P + P S Y+ PPP PP P P P P Sbjct: 590 PPPPPIGPPQAYPPQTPPYS-YMNNPPPQGPPPQMAPHHPNPYQP 633 >AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p protein. Length = 299 Score = 29.5 bits (63), Expect = 8.4 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = -1 Query: 803 GXEXGRRGXGX*GVXGGWXXGGGXXRXXXXGYEXEGXXEGXDGXLGVG*XRXGGXSGAF 627 G G G G G GG GGG G G G G G G GG GAF Sbjct: 4 GKPRGGGGGGGRGFGGG-GGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRGAF 61 >AY060485-1|AAL25524.1| 696|Drosophila melanogaster SD09360p protein. Length = 696 Score = 29.5 bits (63), Expect = 8.4 Identities = 26/105 (24%), Positives = 30/105 (28%), Gaps = 4/105 (3%) Frame = +3 Query: 774 PXTPPXXLXXXXPPIXXPF*LXPXXYPPXXRXXPXXX--PPXGPXXPDPPPXXXXXXXXX 947 P PP PP L P Y P PP G P PPP Sbjct: 398 PGQPPSGFQPQPPPGAFQA-LPPQAYQAMQAGPPGPPMGPPQGYYGPPPPPPPNGPPGVG 456 Query: 948 XXXXXXXXXXXXGTR--GXXXPLXPYXXXXXPRPSHQXEPLPSPP 1076 R P+ P+ P+P Q +P PS P Sbjct: 457 VGVGVGVGVGVMPMRQHQHQHPVYPFMQQAPPQPPQQQQPPPSQP 501 >AY058599-1|AAL13828.1| 773|Drosophila melanogaster LD29226p protein. Length = 773 Score = 29.5 bits (63), Expect = 8.4 Identities = 18/65 (27%), Positives = 21/65 (32%), Gaps = 1/65 (1%) Frame = +1 Query: 643 PPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPP-PXXXPPXTPQXPXPLLPXSXPXXXQS 819 PP PT P P+ P + PP P PP P P +P P Q Sbjct: 177 PPPMMMPTTNMPPPMMMPPTMMPPGFPGIGGPPHPMALPPGAPFPPPGAVPPPIPSGGQI 236 Query: 820 XXRSN 834 N Sbjct: 237 SNSGN 241 >AY052044-1|AAK93468.1| 581|Drosophila melanogaster LP06006p protein. Length = 581 Score = 29.5 bits (63), Expect = 8.4 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +1 Query: 661 PTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPX-TPQXPXPLLP 792 P P P P + P S Y+ PPP PP P P P P Sbjct: 124 PPPPPIGPPQAYPPQTPPYS-YMNNPPPQGPPPQMAPHHPNPYQP 167 >AE014298-2787|AAF48900.2| 2030|Drosophila melanogaster CG32542-PA protein. Length = 2030 Score = 29.5 bits (63), Expect = 8.4 Identities = 26/105 (24%), Positives = 30/105 (28%), Gaps = 4/105 (3%) Frame = +3 Query: 774 PXTPPXXLXXXXPPIXXPF*LXPXXYPPXXRXXPXXX--PPXGPXXPDPPPXXXXXXXXX 947 P PP PP L P Y P PP G P PPP Sbjct: 1732 PGQPPSGFQPQPPPGAFQA-LPPQAYQAMQAGPPGPPMGPPQGYYGPPPPPPPNGPPGVG 1790 Query: 948 XXXXXXXXXXXXGTR--GXXXPLXPYXXXXXPRPSHQXEPLPSPP 1076 R P+ P+ P+P Q +P PS P Sbjct: 1791 VGVGVGVGVGVMPMRQHQHQHPVYPFMQQAPPQPPQQQQPPPSQP 1835 >AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-PA protein. Length = 460 Score = 29.5 bits (63), Expect = 8.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 840 PXXYPPXXRXXPXXXPPXGPXXPDPPP 920 P PP R P PP GP P PPP Sbjct: 54 PPPSPPCGRPPPGSPPP-GPPPPGPPP 79 >AE014296-779|AAF47850.1| 1047|Drosophila melanogaster CG15002-PB protein. Length = 1047 Score = 29.5 bits (63), Expect = 8.4 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +1 Query: 661 PTPRXPSXPSXXPSXSYPXSXYLXXPPPXXXPPX-TPQXPXPLLP 792 P P P P + P S Y+ PPP PP P P P P Sbjct: 590 PPPPPIGPPQAYPPQTPPYS-YMNNPPPQGPPPQMAPHHPNPYQP 633 >AE013599-3146|AAF46686.2| 1215|Drosophila melanogaster CG4266-PA protein. Length = 1215 Score = 29.5 bits (63), Expect = 8.4 Identities = 18/65 (27%), Positives = 21/65 (32%), Gaps = 1/65 (1%) Frame = +1 Query: 643 PPXRXHPTPRXPSXPSXXPSXSYPXSXYLXXPP-PXXXPPXTPQXPXPLLPXSXPXXXQS 819 PP PT P P+ P + PP P PP P P +P P Q Sbjct: 619 PPPMMMPTTNMPPPMMMPPTMMPPGFPGIGGPPHPMALPPGAPFPPPGAVPPPIPSGGQI 678 Query: 820 XXRSN 834 N Sbjct: 679 SNSGN 683 >AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA protein. Length = 237 Score = 29.5 bits (63), Expect = 8.4 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = -1 Query: 803 GXEXGRRGXGX*GVXGGWXXGGGXXRXXXXGYEXEGXXEGXDGXLGVG*XRXGGXSGAF 627 G G G G G GG GGG G G G G G G GG GAF Sbjct: 4 GKPRGGGGGGGRGFGGG-GGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRGAF 61 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,999,344 Number of Sequences: 53049 Number of extensions: 281786 Number of successful extensions: 2783 Number of sequences better than 10.0: 55 Number of HSP's better than 10.0 without gapping: 908 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2099 length of database: 24,988,368 effective HSP length: 86 effective length of database: 20,426,154 effective search space used: 5637618504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -