BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_O05 (900 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F12.02c |p23fy||translationally controlled tumor protein ho... 105 1e-23 SPAC30D11.07 |nth1||DNA endonuclease III|Schizosaccharomyces pom... 29 0.68 SPCC74.09 |mug24||RNA-binding protein, rrm type|Schizosaccharomy... 29 0.90 SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||... 27 4.8 SPBC577.10 |||20S proteasome component beta 7|Schizosaccharomyce... 27 4.8 SPCC1442.01 |ste6|SPCC1450.17|guanyl-nucleotide exchange factor ... 26 6.3 SPAC1B3.15c |||membrane transporter|Schizosaccharomyces pombe|ch... 26 6.3 SPBC776.10c |cog6||Golgi transport complex peripheral subunit Co... 26 8.4 >SPAC1F12.02c |p23fy||translationally controlled tumor protein homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 168 Score = 105 bits (251), Expect = 1e-23 Identities = 56/124 (45%), Positives = 83/124 (66%), Gaps = 1/124 (0%) Frame = +1 Query: 130 MKIYKDIITGDEMFSDTYKMKLVDEVIYEVTGRLVTRAQ-GDIQIEGFNPSAEEADEGTD 306 M +YKD+I+GDE+ SD Y +K VD+++YE ++VT Q GD+ I G NPSAE+A+E + Sbjct: 1 MLLYKDVISGDELVSDAYDLKEVDDIVYEADCQMVTVKQGGDVDI-GANPSAEDAEENAE 59 Query: 307 SAVESGVDIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMNKV 486 E+ ++V + RL T +F DKKSY Y+K YMK + A+L+E P++V VF+ N Sbjct: 60 EGTETVNNLVYSFRLSPT-SF-DKKSYMSYIKGYMKAIKARLQESNPERVPVFEKNAIGF 117 Query: 487 MKDI 498 +K I Sbjct: 118 VKKI 121 Score = 50.8 bits (116), Expect = 3e-07 Identities = 25/48 (52%), Positives = 32/48 (66%) Frame = +3 Query: 504 AGLRNFXFFTGESMDCDGMVAMMEYRDFDGTQIPIMMFFKHGLEEEKF 647 A +++ F+ GESMD D MV +M YR+ DG P M+FFK GL EKF Sbjct: 123 ANFKDYDFYIGESMDPDAMVVLMNYRE-DGI-TPYMIFFKDGLVSEKF 168 >SPAC30D11.07 |nth1||DNA endonuclease III|Schizosaccharomyces pombe|chr 1|||Manual Length = 355 Score = 29.5 bits (63), Expect = 0.68 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = +1 Query: 325 VDIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKT 471 +D V ++L+E F ++K T+YLK + L K + PD VE T Sbjct: 89 IDEVSLNKLIEKVGFHNRK--TIYLKQMARILSEKFQGDIPDTVEDLMT 135 >SPCC74.09 |mug24||RNA-binding protein, rrm type|Schizosaccharomyces pombe|chr 3|||Manual Length = 654 Score = 29.1 bits (62), Expect = 0.90 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -1 Query: 189 HFVGVREHLITSDNVLIDLHFDGLEAIKNNKNRKNGFSPQTN 64 +F + + L T + LI + +E+IK KNR +GF TN Sbjct: 503 YFSHISDSLTTEELELILRQYGEIESIKYLKNRSSGFVAYTN 544 >SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1367 Score = 26.6 bits (56), Expect = 4.8 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -2 Query: 167 ISSPVIMSL*IFILMDWRRLKII 99 ISSP I + IFILM+ RL +I Sbjct: 1220 ISSPTIFVINIFILMNQERLNLI 1242 >SPBC577.10 |||20S proteasome component beta 7|Schizosaccharomyces pombe|chr 2|||Manual Length = 262 Score = 26.6 bits (56), Expect = 4.8 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = +1 Query: 232 VTRAQGDIQIEGFNPSAEEADEGTDSAVESGVDIVLNHRLVETYAFGD 375 +T G Q + F PS E +E TD+ ++ V ++ V F D Sbjct: 6 LTEVWGKPQKDIFFPSGSEVEESTDAPIQRTVQPIVTGSSVLALKFAD 53 >SPCC1442.01 |ste6|SPCC1450.17|guanyl-nucleotide exchange factor Ste6|Schizosaccharomyces pombe|chr 3|||Manual Length = 911 Score = 26.2 bits (55), Expect = 6.3 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -3 Query: 688 ASLELXXYFLSNI*NFSSSRPCLKNIMIGICVPSKSLY 575 AS EL NFS+ R CL+N ++ CVP +Y Sbjct: 781 ASFELLNNLTEARKNFSNYRDCLENCVLP-CVPFLGVY 817 >SPAC1B3.15c |||membrane transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 628 Score = 26.2 bits (55), Expect = 6.3 Identities = 10/20 (50%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = -1 Query: 603 VFAYHQSLYIPSWQPC-HHN 547 V A+ Q L++P W PC HN Sbjct: 336 VVAFTQGLFLPRWLPCIKHN 355 >SPBC776.10c |cog6||Golgi transport complex peripheral subunit Cog6 |Schizosaccharomyces pombe|chr 2|||Manual Length = 675 Score = 25.8 bits (54), Expect = 8.4 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -1 Query: 345 VVQDYVNSALDGRVRALVSLFSRRIKTLDLDIT 247 V++D +NS LDG + + S R +T LD++ Sbjct: 341 VLEDQMNSLLDGSLYGICRPLSSRAQTSVLDLS 373 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,069,626 Number of Sequences: 5004 Number of extensions: 60639 Number of successful extensions: 159 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 157 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 454497130 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -