BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_O02 (916 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A2DM31 Cluster: Putative uncharacterized protein; n=1; ... 42 0.022 UniRef50_A1CZG7 Cluster: Putative uncharacterized protein; n=2; ... 42 0.022 UniRef50_Q9A2R2 Cluster: OmpA family protein; n=5; Caulobacter|R... 42 0.029 UniRef50_Q3ECQ3 Cluster: Uncharacterized protein At1g54215.1; n=... 41 0.038 UniRef50_A4HCC8 Cluster: Putative uncharacterized protein; n=2; ... 41 0.038 UniRef50_A1C9U1 Cluster: Putative uncharacterized protein; n=1; ... 41 0.038 UniRef50_Q1IA36 Cluster: Insecticidal toxin, SepC/Tcc class; n=1... 41 0.051 UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnolioph... 41 0.051 UniRef50_Q4PSF3 Cluster: Proline-rich extensin-like family prote... 41 0.051 UniRef50_O65530 Cluster: Putative uncharacterized protein F4D11.... 41 0.051 UniRef50_A2DFC2 Cluster: Formin Homology 2 Domain containing pro... 41 0.051 UniRef50_A3GHC4 Cluster: Predicted protein; n=1; Pichia stipitis... 41 0.051 UniRef50_A0GWT4 Cluster: Putative uncharacterized protein; n=2; ... 40 0.067 UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel d... 40 0.089 UniRef50_P93845 Cluster: Putative uncharacterized protein; n=1; ... 40 0.089 UniRef50_A5BR16 Cluster: Putative uncharacterized protein; n=1; ... 40 0.089 UniRef50_A5JUU8 Cluster: Formin B; n=2; Trypanosoma brucei|Rep: ... 40 0.089 UniRef50_A2DI20 Cluster: Putative uncharacterized protein; n=1; ... 40 0.089 UniRef50_UPI0000499A11 Cluster: hypothetical protein 42.t00003; ... 40 0.12 UniRef50_Q4RLL2 Cluster: Chromosome 10 SCAF15019, whole genome s... 40 0.12 UniRef50_A3Q026 Cluster: Putative uncharacterized protein precur... 40 0.12 UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1;... 40 0.12 UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 ... 40 0.12 UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; ... 40 0.12 UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox ca... 40 0.12 UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas ... 40 0.12 UniRef50_Q0U6P9 Cluster: Predicted protein; n=1; Phaeosphaeria n... 40 0.12 UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n... 40 0.12 UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precu... 40 0.12 UniRef50_Q8VAY0 Cluster: Wsv239; n=1; Shrimp white spot syndrome... 35 0.14 UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; ... 39 0.15 UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein ca... 39 0.15 UniRef50_UPI0000D55F3A Cluster: PREDICTED: similar to CG14622-PC... 39 0.15 UniRef50_UPI0000498B36 Cluster: hypothetical protein 114.t00013;... 39 0.15 UniRef50_Q4SUB2 Cluster: Chromosome 3 SCAF13974, whole genome sh... 39 0.15 UniRef50_A3Q1Z8 Cluster: Molecular chaperone-like; n=4; Mycobact... 39 0.15 UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-depe... 39 0.15 UniRef50_Q4QBP0 Cluster: Putative uncharacterized protein; n=1; ... 39 0.15 UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1; ... 39 0.15 UniRef50_A4R0U8 Cluster: Predicted protein; n=1; Magnaporthe gri... 39 0.15 UniRef50_UPI0001552F36 Cluster: PREDICTED: similar to SH3 domain... 39 0.20 UniRef50_Q8PPF4 Cluster: Putative uncharacterized protein XAC073... 39 0.20 UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherop... 39 0.20 UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; ... 39 0.20 UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; ... 39 0.20 UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|R... 39 0.20 UniRef50_O23370 Cluster: Cell wall protein like; n=15; Magnoliop... 39 0.20 UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensi... 39 0.20 UniRef50_A7S7W0 Cluster: Predicted protein; n=1; Nematostella ve... 39 0.20 UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/M... 39 0.20 UniRef50_P13983 Cluster: Extensin precursor; n=1; Nicotiana taba... 39 0.20 UniRef50_Q6BSP4 Cluster: Branchpoint-bridging protein; n=2; Sacc... 39 0.20 UniRef50_Q9LI74 Cluster: Similarity to pherophorin; n=1; Arabido... 38 0.27 UniRef50_A7QGU9 Cluster: Chromosome chr16 scaffold_94, whole gen... 38 0.27 UniRef50_A7RXK9 Cluster: Predicted protein; n=2; Nematostella ve... 38 0.27 UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila mel... 38 0.27 UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein;... 38 0.36 UniRef50_Q4RSI9 Cluster: Chromosome 13 SCAF15000, whole genome s... 38 0.36 UniRef50_A2RV11 Cluster: FNBP4 protein; n=7; Danio rerio|Rep: FN... 38 0.36 UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=... 38 0.36 UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter lit... 38 0.36 UniRef50_Q0ANI5 Cluster: OmpA/MotB domain protein precursor; n=2... 38 0.36 UniRef50_Q41645 Cluster: Extensin; n=1; Volvox carteri|Rep: Exte... 38 0.36 UniRef50_Q2QNA7 Cluster: Exostosin family protein, expressed; n=... 38 0.36 UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukary... 38 0.36 UniRef50_A5BAX2 Cluster: Putative uncharacterized protein; n=1; ... 38 0.36 UniRef50_A3CIN4 Cluster: Putative uncharacterized protein; n=1; ... 38 0.36 UniRef50_Q7YYP6 Cluster: Hydroxyproline-rich glycoprotein dz-hrg... 38 0.36 UniRef50_Q54WZ5 Cluster: Slob family protein kinase; n=1; Dictyo... 38 0.36 UniRef50_Q4QAM2 Cluster: Formin, putative; n=3; Leishmania|Rep: ... 38 0.36 UniRef50_A2FMX2 Cluster: DnaK protein; n=2; Trichomonas vaginali... 38 0.36 UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.2... 38 0.36 UniRef50_Q2GNY9 Cluster: Putative uncharacterized protein; n=2; ... 38 0.36 UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Hu... 38 0.36 UniRef50_UPI0000F1F796 Cluster: PREDICTED: hypothetical protein;... 38 0.47 UniRef50_UPI0000D56EFA Cluster: PREDICTED: similar to Protein ca... 38 0.47 UniRef50_UPI000069F679 Cluster: Survival motor neuron protein (C... 38 0.47 UniRef50_UPI0000F30E84 Cluster: UPI0000F30E84 related cluster; n... 38 0.47 UniRef50_Q9Q5L3 Cluster: EBNA-2; n=2; Cercopithecine herpesvirus... 38 0.47 UniRef50_Q91TI4 Cluster: T117; n=1; Tupaiid herpesvirus 1|Rep: T... 38 0.47 UniRef50_Q4JY15 Cluster: Putative secreted protein precursor; n=... 38 0.47 UniRef50_A6APN4 Cluster: Insecticidal toxin, SepC/Tcc class; n=2... 38 0.47 UniRef50_A0R2X6 Cluster: Putative uncharacterized protein; n=2; ... 38 0.47 UniRef50_Q9LQZ8 Cluster: F10A5.23; n=1; Arabidopsis thaliana|Rep... 38 0.47 UniRef50_Q6H7U3 Cluster: Putative formin I2I isoform; n=2; Oryza... 38 0.47 UniRef50_Q10R38 Cluster: Transposon protein, putative, CACTA, En... 38 0.47 UniRef50_A7Q9D7 Cluster: Chromosome chr19 scaffold_66, whole gen... 38 0.47 UniRef50_A7DWG3 Cluster: Cell wall glycoprotein GP2; n=4; Chlamy... 38 0.47 UniRef50_Q7Z152 Cluster: Collagen protein 51; n=4; Caenorhabditi... 38 0.47 UniRef50_Q57ZF9 Cluster: Putative uncharacterized protein; n=1; ... 38 0.47 UniRef50_Q03173 Cluster: Protein enabled homolog; n=18; Euteleos... 38 0.47 UniRef50_O60610 Cluster: Protein diaphanous homolog 1; n=43; Eut... 38 0.47 UniRef50_UPI00015B5B2E Cluster: PREDICTED: similar to ENSANGP000... 37 0.62 UniRef50_UPI0000DB6FB3 Cluster: PREDICTED: similar to plexus CG4... 37 0.62 UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=... 37 0.62 UniRef50_Q5XHX3 Cluster: Enabled homolog; n=5; Tetrapoda|Rep: En... 37 0.62 UniRef50_Q0M671 Cluster: Glycoside hydrolase, family 16:Hemolysi... 37 0.62 UniRef50_Q0C0P5 Cluster: OmpA family protein; n=1; Hyphomonas ne... 37 0.62 UniRef50_A4T9C9 Cluster: Integral membrane protein-like protein;... 37 0.62 UniRef50_A3PW04 Cluster: U5 snRNP spliceosome subunit-like prote... 37 0.62 UniRef50_A5B045 Cluster: Putative uncharacterized protein; n=1; ... 37 0.62 UniRef50_Q4R8N9 Cluster: Testis cDNA clone: QtsA-11950, similar ... 37 0.62 UniRef50_Q61UQ5 Cluster: Putative uncharacterized protein CBG051... 37 0.62 UniRef50_Q5C200 Cluster: SJCHGC08716 protein; n=1; Schistosoma j... 37 0.62 UniRef50_A2E6V2 Cluster: WH2 motif family protein; n=3; Trichomo... 37 0.62 UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, wh... 37 0.62 UniRef50_A0D550 Cluster: Chromosome undetermined scaffold_38, wh... 37 0.62 UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, wh... 37 0.62 UniRef50_A5DZ99 Cluster: Putative uncharacterized protein; n=1; ... 37 0.62 UniRef50_A3LVW7 Cluster: Predicted protein; n=1; Pichia stipitis... 37 0.62 UniRef50_P41484 Cluster: Proline-rich antigen; n=21; Mycobacteri... 37 0.62 UniRef50_Q8NIW7 Cluster: Branchpoint-bridging protein; n=20; Euk... 37 0.62 UniRef50_UPI0000E4A382 Cluster: PREDICTED: similar to DNA-depend... 37 0.83 UniRef50_UPI0000E463CE Cluster: PREDICTED: hypothetical protein;... 37 0.83 UniRef50_UPI0000588CC7 Cluster: PREDICTED: similar to MGC68480 p... 37 0.83 UniRef50_UPI00006A2591 Cluster: Wiskott-Aldrich syndrome protein... 37 0.83 UniRef50_UPI00004D7E7F Cluster: CDNA FLJ45135 fis, clone BRAWH30... 37 0.83 UniRef50_Q7T318 Cluster: Wiskott-Aldrich syndrome; n=7; Euteleos... 37 0.83 UniRef50_Q0LCI7 Cluster: Putative uncharacterized protein; n=1; ... 37 0.83 UniRef50_Q07PB7 Cluster: Peptidase C14, caspase catalytic subuni... 37 0.83 UniRef50_A5FYS1 Cluster: Putative uncharacterized protein precur... 37 0.83 UniRef50_Q9MAV4 Cluster: F24O1.6; n=10; cellular organisms|Rep: ... 37 0.83 UniRef50_Q8RUS0 Cluster: Putative uncharacterized protein At2g18... 37 0.83 UniRef50_Q41805 Cluster: Extensin-like protein precursor; n=15; ... 37 0.83 UniRef50_Q41192 Cluster: NaPRP3; n=1; Nicotiana alata|Rep: NaPRP... 37 0.83 UniRef50_O23374 Cluster: P140mDia like protein; n=2; Arabidopsis... 37 0.83 UniRef50_Q54PM6 Cluster: Putative uncharacterized protein; n=1; ... 37 0.83 UniRef50_Q3Y407 Cluster: Groundhog (Hedgehog-like family) protei... 37 0.83 UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, w... 37 0.83 UniRef50_Q504V9 Cluster: ZNF341 protein; n=10; Euteleostomi|Rep:... 37 0.83 UniRef50_Q9BYN7 Cluster: Zinc finger protein 341; n=86; Eumetazo... 37 0.83 UniRef50_P50552 Cluster: Vasodilator-stimulated phosphoprotein; ... 37 0.83 UniRef50_UPI00015BDD6A Cluster: UPI00015BDD6A related cluster; n... 36 1.1 UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2... 36 1.1 UniRef50_UPI00015B4CAB Cluster: PREDICTED: hypothetical protein;... 36 1.1 UniRef50_UPI0000F2C6D3 Cluster: PREDICTED: hypothetical protein;... 36 1.1 UniRef50_UPI0000E7FD76 Cluster: PREDICTED: similar to SH3 domain... 36 1.1 UniRef50_UPI0000E47360 Cluster: PREDICTED: hypothetical protein;... 36 1.1 UniRef50_UPI0000E4615C Cluster: PREDICTED: similar to TamA; n=1;... 36 1.1 UniRef50_UPI0000E23AD6 Cluster: PREDICTED: Enah/Vasp-like; n=1; ... 36 1.1 UniRef50_UPI0000ECCC14 Cluster: WAS/WASL interacting protein fam... 36 1.1 UniRef50_P42859-2 Cluster: Isoform Short of P42859 ; n=7; Deuter... 36 1.1 UniRef50_Q4TB69 Cluster: Chromosome 11 SCAF7190, whole genome sh... 36 1.1 UniRef50_Q4RHV8 Cluster: Chromosome 8 SCAF15044, whole genome sh... 36 1.1 UniRef50_Q4RE14 Cluster: Chromosome undetermined SCAF15155, whol... 36 1.1 UniRef50_Q91GJ2 Cluster: Putative uncharacterized protein; n=1; ... 36 1.1 UniRef50_Q2NNS2 Cluster: 1629capsid; n=1; Hyphantria cunea nucle... 36 1.1 UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burk... 36 1.1 UniRef50_Q2RTE8 Cluster: Putative uncharacterized protein; n=1; ... 36 1.1 UniRef50_Q2JMC8 Cluster: TonB family protein; n=2; Synechococcus... 36 1.1 UniRef50_Q56B20 Cluster: Cell surface antigen Sca2-6; n=4; Ricke... 36 1.1 UniRef50_Q0M4S1 Cluster: TonB-like; n=1; Caulobacter sp. K31|Rep... 36 1.1 UniRef50_A6Q902 Cluster: Putative uncharacterized protein; n=1; ... 36 1.1 UniRef50_A6G312 Cluster: Serine/threonine protein kinase; n=1; P... 36 1.1 UniRef50_A5V8M1 Cluster: OmpA/MotB domain protein precursor; n=3... 36 1.1 UniRef50_A1UGS6 Cluster: Fibronectin-attachment family protein p... 36 1.1 UniRef50_A0J0A0 Cluster: Putative lipoprotein precursor; n=2; Al... 36 1.1 UniRef50_Q9LMQ1 Cluster: F7H2.17 protein; n=2; Arabidopsis thali... 36 1.1 UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thalian... 36 1.1 UniRef50_Q948Y7 Cluster: VMP3 protein; n=1; Volvox carteri f. na... 36 1.1 UniRef50_Q948Y6 Cluster: VMP4 protein; n=1; Volvox carteri f. na... 36 1.1 UniRef50_Q8LJ87 Cluster: Putative leucine-rich repeat/extensin 1... 36 1.1 UniRef50_Q8H9E1 Cluster: Extensin; n=6; Eukaryota|Rep: Extensin ... 36 1.1 UniRef50_Q7XAL2 Cluster: Extensin-like protein; n=1; Oryza sativ... 36 1.1 UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; ... 36 1.1 UniRef50_Q1EP07 Cluster: Putative uncharacterized protein; n=1; ... 36 1.1 UniRef50_O49946 Cluster: Extensin-like protein; n=5; Solanaceae|... 36 1.1 UniRef50_A7R244 Cluster: Chromosome undetermined scaffold_398, w... 36 1.1 UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 36 1.1 UniRef50_Q94273 Cluster: Ground-like (Grd related) protein 6; n=... 36 1.1 UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyos... 36 1.1 UniRef50_Q86BM9 Cluster: CG33003-PA; n=1; Drosophila melanogaste... 36 1.1 UniRef50_Q5CS67 Cluster: Signal peptide containing large protein... 36 1.1 UniRef50_Q54PI9 Cluster: Formin homology domain-containing prote... 36 1.1 UniRef50_A2D765 Cluster: Putative uncharacterized protein; n=1; ... 36 1.1 UniRef50_A0E1N2 Cluster: Chromosome undetermined scaffold_73, wh... 36 1.1 UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, wh... 36 1.1 UniRef50_Q9C0F0 Cluster: Protein KIAA1713; n=33; Deuterostomia|R... 36 1.1 UniRef50_Q5T8W7 Cluster: Espin; n=51; Euteleostomi|Rep: Espin - ... 36 1.1 UniRef50_Q0V5Y9 Cluster: Predicted protein; n=1; Phaeosphaeria n... 36 1.1 UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus ter... 36 1.1 UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomy... 36 1.1 UniRef50_Q9Y6X0 Cluster: SET-binding protein; n=26; Tetrapoda|Re... 36 1.1 UniRef50_Q1DMX8 Cluster: Pre-mRNA-splicing ATP-dependent RNA hel... 36 1.1 UniRef50_Q9QYX7 Cluster: Protein piccolo; n=22; cellular organis... 36 1.1 UniRef50_Q9Y6V0 Cluster: Protein piccolo; n=17; Amniota|Rep: Pro... 36 1.1 UniRef50_Q9UI08 Cluster: Ena/VASP-like protein; n=24; Tetrapoda|... 36 1.1 UniRef50_Q9NSV4 Cluster: Protein diaphanous homolog 3; n=66; Deu... 36 1.1 UniRef50_UPI0000E482F8 Cluster: PREDICTED: similar to dishevelle... 36 1.4 UniRef50_UPI0000DA3CD5 Cluster: PREDICTED: hypothetical protein;... 36 1.4 UniRef50_Q4A373 Cluster: Putative lectin protein precursor; n=1;... 36 1.4 UniRef50_Q5YPL1 Cluster: Putative stress protein; n=1; Nocardia ... 36 1.4 UniRef50_Q1GRM3 Cluster: OmpA/MotB precursor; n=7; Sphingomonada... 36 1.4 UniRef50_A3WE37 Cluster: Putative uncharacterized protein; n=2; ... 36 1.4 UniRef50_A3Q834 Cluster: Putative uncharacterized protein precur... 36 1.4 UniRef50_A1FZ88 Cluster: Outer membrane autotransporter barrel d... 36 1.4 UniRef50_A0LQ52 Cluster: Putative uncharacterized protein; n=1; ... 36 1.4 UniRef50_Q9XIB6 Cluster: F13F21.7 protein; n=5; core eudicotyled... 36 1.4 UniRef50_Q8S9B6 Cluster: PR-1 like protein; n=1; Volvox carteri ... 36 1.4 UniRef50_Q4U2V9 Cluster: Hydroxyproline-rich glycoprotein GAS30 ... 36 1.4 UniRef50_Q08194 Cluster: Cysteine-rich extensin-like protein-1; ... 36 1.4 UniRef50_A5BL77 Cluster: Putative uncharacterized protein; n=1; ... 36 1.4 UniRef50_A4S5W2 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 36 1.4 UniRef50_A4S0Z6 Cluster: Predicted protein; n=2; Ostreococcus|Re... 36 1.4 UniRef50_Q9VY31 Cluster: CG9411-PA; n=2; Sophophora|Rep: CG9411-... 36 1.4 UniRef50_Q22715 Cluster: Putative uncharacterized protein; n=3; ... 36 1.4 UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella ve... 36 1.4 UniRef50_A7RNZ0 Cluster: Predicted protein; n=1; Nematostella ve... 36 1.4 UniRef50_A2F7T1 Cluster: Putative uncharacterized protein; n=1; ... 36 1.4 UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, w... 36 1.4 UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU014... 36 1.4 UniRef50_Q6C9I8 Cluster: Similar to sp|P41832 Saccharomyces cere... 36 1.4 UniRef50_Q5AL62 Cluster: Putative uncharacterized protein; n=1; ... 36 1.4 UniRef50_A7F1V6 Cluster: Putative uncharacterized protein; n=2; ... 36 1.4 UniRef50_Q96S59 Cluster: Ran-binding protein 9; n=51; Euteleosto... 36 1.4 UniRef50_P17816 Cluster: Glycine-rich cell wall structural prote... 36 1.4 UniRef50_UPI00015B541C Cluster: PREDICTED: hypothetical protein;... 36 1.9 UniRef50_UPI00015B52EC Cluster: PREDICTED: similar to ENSANGP000... 36 1.9 UniRef50_UPI0000F1EC5C Cluster: PREDICTED: similar to Ras associ... 36 1.9 UniRef50_UPI0000E4A67F Cluster: PREDICTED: similar to rhamnospon... 36 1.9 UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA... 36 1.9 UniRef50_UPI0000DC1448 Cluster: UPI0000DC1448 related cluster; n... 36 1.9 UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome sh... 36 1.9 UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome sh... 36 1.9 UniRef50_Q4RR29 Cluster: Chromosome 14 SCAF15003, whole genome s... 36 1.9 UniRef50_Q4A2U2 Cluster: Putative membrane protein precursor; n=... 36 1.9 UniRef50_Q06KR7 Cluster: Viral capsid associated protein; n=3; N... 36 1.9 UniRef50_Q39G14 Cluster: TonB-like protein; n=15; Burkholderia|R... 36 1.9 UniRef50_Q2W2A9 Cluster: Periplasmic protein TonB, links inner a... 36 1.9 UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding pro... 36 1.9 UniRef50_Q09084 Cluster: Extensin (Class II) precursor; n=3; Sol... 36 1.9 UniRef50_Q01A68 Cluster: Chromosome 04 contig 1, DNA sequence; n... 36 1.9 UniRef50_Q7KW17 Cluster: CG14622-PC, isoform C; n=10; Coelomata|... 36 1.9 UniRef50_Q5CLH8 Cluster: Protease; n=3; Cryptosporidium|Rep: Pro... 36 1.9 UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyosteli... 36 1.9 UniRef50_Q54H12 Cluster: Actin-binding protein; n=2; Dictyosteli... 36 1.9 UniRef50_O02049 Cluster: Putative uncharacterized protein; n=2; ... 36 1.9 UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella ve... 36 1.9 UniRef50_Q2GRR5 Cluster: Putative uncharacterized protein; n=1; ... 36 1.9 UniRef50_Q0U760 Cluster: Putative uncharacterized protein; n=1; ... 36 1.9 UniRef50_A4RAI7 Cluster: Predicted protein; n=1; Magnaporthe gri... 36 1.9 UniRef50_A4QSC9 Cluster: Predicted protein; n=2; Fungi/Metazoa g... 36 1.9 UniRef50_Q86UP3 Cluster: Zinc finger homeobox protein 4; n=18; E... 36 1.9 UniRef50_Q9S8M0 Cluster: Chitin-binding lectin 1 precursor; n=1;... 36 1.9 UniRef50_UPI0000DA1F29 Cluster: PREDICTED: hypothetical protein;... 35 2.5 UniRef50_UPI0000DA1F1A Cluster: PREDICTED: hypothetical protein;... 35 2.5 UniRef50_UPI0000D56B71 Cluster: PREDICTED: similar to CG8266-PA,... 35 2.5 UniRef50_UPI0000F30AB8 Cluster: UPI0000F30AB8 related cluster; n... 35 2.5 UniRef50_Q9DEH3 Cluster: Diaphanous homologue; n=13; Eumetazoa|R... 35 2.5 UniRef50_A2A654 Cluster: Fetal Alzheimer antigen; n=8; Mammalia|... 35 2.5 UniRef50_Q1DFL6 Cluster: Ferric siderophore transporter, peripla... 35 2.5 UniRef50_A3RR20 Cluster: Proline-rich signal peptide; n=2; Ralst... 35 2.5 UniRef50_A1UKQ7 Cluster: Putative uncharacterized protein; n=3; ... 35 2.5 UniRef50_Q76KW3 Cluster: Hydroxyproline-rich glycoprotein-2; n=1... 35 2.5 UniRef50_Q43522 Cluster: Tfm5 protein; n=9; Magnoliophyta|Rep: T... 35 2.5 UniRef50_Q3HTK3 Cluster: Pherophorin-C4 protein precursor; n=1; ... 35 2.5 UniRef50_Q0D4Y8 Cluster: Os07g0596300 protein; n=7; Eukaryota|Re... 35 2.5 UniRef50_Q01DC8 Cluster: Plg protein; n=2; Eukaryota|Rep: Plg pr... 35 2.5 UniRef50_Q013M1 Cluster: Chromosome 08 contig 1, DNA sequence; n... 35 2.5 UniRef50_O65514 Cluster: Putative glycine-rich cell wall protein... 35 2.5 UniRef50_A5B2G4 Cluster: Putative uncharacterized protein; n=1; ... 35 2.5 UniRef50_A2X6K1 Cluster: Putative uncharacterized protein; n=3; ... 35 2.5 UniRef50_Q9VB86 Cluster: CG5812-PA; n=10; Endopterygota|Rep: CG5... 35 2.5 UniRef50_Q55GP8 Cluster: Putative uncharacterized protein; n=1; ... 35 2.5 UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: ... 35 2.5 UniRef50_Q4JF01 Cluster: Vasa homlogue; n=2; Eukaryota|Rep: Vasa... 35 2.5 UniRef50_A7SHT8 Cluster: Predicted protein; n=2; Nematostella ve... 35 2.5 UniRef50_A2ETA3 Cluster: WH2 motif family protein; n=1; Trichomo... 35 2.5 UniRef50_Q5AL52 Cluster: Putative uncharacterized protein BNI1; ... 35 2.5 UniRef50_A7EUH8 Cluster: Putative uncharacterized protein; n=1; ... 35 2.5 UniRef50_A4R506 Cluster: Putative uncharacterized protein; n=1; ... 35 2.5 UniRef50_P42768 Cluster: Wiskott-Aldrich syndrome protein; n=14;... 35 2.5 UniRef50_O34261 Cluster: Protein tonB; n=13; Xanthomonadaceae|Re... 35 2.5 UniRef50_P48023 Cluster: Tumor necrosis factor ligand superfamil... 35 2.5 UniRef50_O15047 Cluster: Histone-lysine N-methyltransferase, H3 ... 35 2.5 UniRef50_Q6UUV9 Cluster: CREB-regulated transcription coactivato... 35 2.5 UniRef50_Q27294 Cluster: RNA-binding protein cabeza; n=5; Endopt... 35 2.5 UniRef50_P10323 Cluster: Acrosin precursor (EC 3.4.21.10) [Conta... 35 2.5 UniRef50_UPI0000F215C4 Cluster: PREDICTED: hypothetical protein;... 35 3.3 UniRef50_UPI0000F1E7FE Cluster: PREDICTED: similar to formin 2; ... 35 3.3 UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein;... 35 3.3 UniRef50_UPI0000DB7174 Cluster: PREDICTED: similar to disco-rela... 35 3.3 UniRef50_UPI0000D5579B Cluster: PREDICTED: hypothetical protein;... 35 3.3 UniRef50_UPI00015A5D5E Cluster: UPI00015A5D5E related cluster; n... 35 3.3 UniRef50_Q7SZN7 Cluster: Enah/Vasp-like a; n=3; Danio rerio|Rep:... 35 3.3 UniRef50_Q6R7E1 Cluster: ORF88; n=1; Ostreid herpesvirus 1|Rep: ... 35 3.3 UniRef50_Q5YFM4 Cluster: Putative uncharacterized protein; n=2; ... 35 3.3 UniRef50_Q4A263 Cluster: Putative membrane protein; n=1; Emilian... 35 3.3 UniRef50_O35328 Cluster: Proline-rich protein 9-1; n=2; Mus musc... 35 3.3 UniRef50_Q8YQB7 Cluster: All3916 protein; n=2; Nostocaceae|Rep: ... 35 3.3 UniRef50_Q2W8R2 Cluster: Uncharacterized membrane-bound protein;... 35 3.3 UniRef50_Q1NAT8 Cluster: Putative uncharacterized protein; n=1; ... 35 3.3 UniRef50_A7GWT7 Cluster: Protein TonB; n=2; Campylobacter|Rep: P... 35 3.3 UniRef50_A5FXR4 Cluster: TonB family protein; n=1; Acidiphilium ... 35 3.3 UniRef50_Q9LJ64 Cluster: Extensin protein-like; n=8; Eukaryota|R... 35 3.3 UniRef50_Q8LK02 Cluster: Putative uncharacterized protein S126P2... 35 3.3 UniRef50_Q8L7S5 Cluster: AT4g18560/F28J12_220; n=2; Arabidopsis ... 35 3.3 UniRef50_Q6ZJE4 Cluster: DNA-dependent ATPase A-like protein; n=... 35 3.3 UniRef50_Q6ZD62 Cluster: Putative pherophorin-dz1 protein; n=4; ... 35 3.3 UniRef50_Q6YYS1 Cluster: Putative uncharacterized protein B1047A... 35 3.3 UniRef50_Q1PE26 Cluster: Leucine-rich repeat family protein/exte... 35 3.3 UniRef50_A7QNX2 Cluster: Chromosome chr1 scaffold_135, whole gen... 35 3.3 UniRef50_Q7PMA5 Cluster: ENSANGP00000031515; n=1; Anopheles gamb... 35 3.3 UniRef50_Q57WJ7 Cluster: Calpain, putative; n=3; Trypanosoma bru... 35 3.3 UniRef50_Q23G58 Cluster: Putative uncharacterized protein; n=1; ... 35 3.3 UniRef50_Q1HMI7 Cluster: Formin B; n=4; Trypanosoma cruzi|Rep: F... 35 3.3 UniRef50_O17265 Cluster: Putative uncharacterized protein; n=3; ... 35 3.3 UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1; ... 35 3.3 UniRef50_A2EWZ7 Cluster: Putative uncharacterized protein; n=1; ... 35 3.3 UniRef50_A0BCS6 Cluster: Chromosome undetermined scaffold_10, wh... 35 3.3 UniRef50_Q7SEW0 Cluster: Predicted protein; n=1; Neurospora cras... 35 3.3 UniRef50_Q7S9L7 Cluster: Predicted protein; n=2; Sordariales|Rep... 35 3.3 UniRef50_Q5KAA5 Cluster: Cytokinesis protein sepa (Fh1/2 protein... 35 3.3 UniRef50_A7EKZ0 Cluster: Putative uncharacterized protein; n=1; ... 35 3.3 UniRef50_A6RGJ8 Cluster: Predicted protein; n=1; Ajellomyces cap... 35 3.3 UniRef50_A6R7X5 Cluster: Putative uncharacterized protein; n=1; ... 35 3.3 UniRef50_A4RD40 Cluster: Putative uncharacterized protein; n=2; ... 35 3.3 UniRef50_P33485 Cluster: Probable nuclear antigen; n=5; root|Rep... 35 3.3 UniRef50_Q82K53 Cluster: Translation initiation factor IF-2; n=5... 35 3.3 UniRef50_P27483 Cluster: Glycine-rich cell wall structural prote... 35 3.3 UniRef50_Q9JL04 Cluster: Formin-2; n=4; Murinae|Rep: Formin-2 - ... 35 3.3 UniRef50_Q8N8S7 Cluster: Protein enabled homolog; n=9; Tetrapoda... 35 3.3 UniRef50_Q9UI36 Cluster: Dachshund homolog 1; n=34; Eukaryota|Re... 35 3.3 UniRef50_Q9FYL3 Cluster: Protein ARTEMIS, chloroplast precursor;... 35 3.3 UniRef50_UPI00015B5CAE Cluster: PREDICTED: similar to conserved ... 34 4.4 UniRef50_UPI0000F2E28C Cluster: PREDICTED: similar to high-mobil... 34 4.4 UniRef50_UPI0000E4A916 Cluster: PREDICTED: hypothetical protein;... 34 4.4 UniRef50_UPI0000E491BF Cluster: PREDICTED: similar to FHOS2L spl... 34 4.4 UniRef50_UPI0000DA3E0C Cluster: PREDICTED: similar to tumor endo... 34 4.4 UniRef50_UPI0000DBF476 Cluster: UPI0000DBF476 related cluster; n... 34 4.4 UniRef50_UPI000065D9FC Cluster: Ras-associated and pleckstrin ho... 34 4.4 UniRef50_UPI0000F30461 Cluster: Formin-2.; n=2; Bos taurus|Rep: ... 34 4.4 UniRef50_Q8N594-2 Cluster: Isoform 2 of Q8N594 ; n=2; Catarrhini... 34 4.4 UniRef50_Q4T121 Cluster: Chromosome undetermined SCAF10748, whol... 34 4.4 UniRef50_O42403 Cluster: Attachment region binding protein; n=1;... 34 4.4 UniRef50_Q91BL3 Cluster: Essential structural protein pp78/81; n... 34 4.4 UniRef50_Q8QKX8 Cluster: EsV-1-144; n=1; Ectocarpus siliculosus ... 34 4.4 UniRef50_Q89KP2 Cluster: Bll4862 protein; n=4; Bradyrhizobiaceae... 34 4.4 UniRef50_Q2W1C2 Cluster: Periplasmic protein TonB, links inner a... 34 4.4 UniRef50_O69740 Cluster: CONSERVED HYPOTHETICAL PROLINE AND ALAN... 34 4.4 UniRef50_Q1GUZ4 Cluster: TonB-like protein; n=6; Sphingomonadale... 34 4.4 UniRef50_A1W8T6 Cluster: Nuclease; n=1; Acidovorax sp. JS42|Rep:... 34 4.4 UniRef50_Q9LYH4 Cluster: Putative uncharacterized protein F14F18... 34 4.4 UniRef50_Q9AUJ7 Cluster: Eukaryotic translation initiation facto... 34 4.4 UniRef50_Q6Z495 Cluster: Putative glycine-rich cell wall structu... 34 4.4 UniRef50_Q42421 Cluster: Chitinase; n=1; Beta vulgaris subsp. vu... 34 4.4 UniRef50_Q0J5F7 Cluster: Os08g0438400 protein; n=4; Oryza sativa... 34 4.4 UniRef50_Q0J002 Cluster: Os09g0538700 protein; n=3; Oryza sativa... 34 4.4 UniRef50_Q09085 Cluster: Hydroxyproline-rich glycoprotein; n=2; ... 34 4.4 UniRef50_Q01942 Cluster: Extensin; n=22; root|Rep: Extensin - So... 34 4.4 UniRef50_A2Z3J4 Cluster: Putative uncharacterized protein; n=3; ... 34 4.4 UniRef50_Q9NGX2 Cluster: Diaphanous protein; n=3; Entamoeba hist... 34 4.4 UniRef50_Q7PNI8 Cluster: ENSANGP00000013088; n=1; Anopheles gamb... 34 4.4 UniRef50_Q55DK4 Cluster: Actin-binding protein; n=2; Dictyosteli... 34 4.4 UniRef50_Q555A2 Cluster: Class VII unconventional myosin; n=5; D... 34 4.4 UniRef50_Q4E4C9 Cluster: Formin, putative; n=1; Trypanosoma cruz... 34 4.4 UniRef50_Q4DD51 Cluster: Putative uncharacterized protein; n=2; ... 34 4.4 UniRef50_Q23JZ2 Cluster: Formin Homology 2 Domain containing pro... 34 4.4 UniRef50_Q23137 Cluster: Ground-like (Grd related) protein 22; n... 34 4.4 UniRef50_A7RKG0 Cluster: Predicted protein; n=1; Nematostella ve... 34 4.4 UniRef50_A7RJG2 Cluster: Predicted protein; n=1; Nematostella ve... 34 4.4 UniRef50_A7RES3 Cluster: Predicted protein; n=3; Nematostella ve... 34 4.4 UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing pro... 34 4.4 UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, wh... 34 4.4 UniRef50_A0D9V1 Cluster: Chromosome undetermined scaffold_42, wh... 34 4.4 UniRef50_Q96JH1 Cluster: KIAA1856 protein; n=21; Eutheria|Rep: K... 34 4.4 UniRef50_Q6CDQ5 Cluster: Similarity; n=2; Saccharomycetales|Rep:... 34 4.4 UniRef50_Q4WNW8 Cluster: KH domain protein; n=13; Pezizomycotina... 34 4.4 UniRef50_Q2GMB7 Cluster: Predicted protein; n=1; Chaetomium glob... 34 4.4 UniRef50_Q0U6P3 Cluster: Predicted protein; n=1; Phaeosphaeria n... 34 4.4 UniRef50_Q0CUB4 Cluster: Predicted protein; n=1; Aspergillus ter... 34 4.4 UniRef50_Q0CLE5 Cluster: Predicted protein; n=1; Aspergillus ter... 34 4.4 UniRef50_A6RH13 Cluster: Predicted protein; n=2; Onygenales|Rep:... 34 4.4 UniRef50_A5DA90 Cluster: Predicted protein; n=1; Pichia guillier... 34 4.4 UniRef50_A4QQZ5 Cluster: Predicted protein; n=1; Magnaporthe gri... 34 4.4 UniRef50_A2QQW4 Cluster: Contig An08c0110, complete genome; n=2;... 34 4.4 UniRef50_Q8N594 Cluster: MPN domain-containing protein; n=18; Te... 34 4.4 UniRef50_Q03250 Cluster: Glycine-rich RNA-binding protein 7; n=1... 34 4.4 UniRef50_UPI0000D561BD Cluster: PREDICTED: hypothetical protein;... 27 4.9 UniRef50_Q2QR52 Cluster: Transposon protein, putative, CACTA, En... 29 5.1 UniRef50_UPI00015B58C3 Cluster: PREDICTED: similar to topoisomer... 34 5.8 UniRef50_UPI00015B56FF Cluster: PREDICTED: similar to splicing f... 34 5.8 UniRef50_UPI00015056F9 Cluster: DNA binding / ligand-dependent n... 34 5.8 UniRef50_UPI0000F1EAF3 Cluster: PREDICTED: similar to B1160F02.4... 34 5.8 UniRef50_UPI0000E48D03 Cluster: PREDICTED: hypothetical protein,... 34 5.8 UniRef50_UPI0000E48C31 Cluster: PREDICTED: hypothetical protein;... 34 5.8 UniRef50_UPI0000DD7C02 Cluster: PREDICTED: hypothetical protein;... 34 5.8 UniRef50_UPI0000D57944 Cluster: PREDICTED: hypothetical protein;... 34 5.8 UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoe... 34 5.8 UniRef50_UPI000049858C Cluster: hypothetical protein 101.t00009;... 34 5.8 UniRef50_UPI0000DC0483 Cluster: UPI0000DC0483 related cluster; n... 34 5.8 UniRef50_Q5ZIC9 Cluster: Putative uncharacterized protein; n=4; ... 34 5.8 UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome s... 34 5.8 UniRef50_Q4A2S6 Cluster: Putative membrane protein precursor; n=... 34 5.8 UniRef50_Q197B3 Cluster: Putative uncharacterized protein; n=1; ... 34 5.8 UniRef50_A2A9I7 Cluster: DMRT-like family B with proline-rich C-... 34 5.8 UniRef50_Q828N1 Cluster: Putative secreted protein; n=5; Strepto... 34 5.8 UniRef50_Q2INY4 Cluster: Putative uncharacterized protein precur... 34 5.8 UniRef50_Q2IIP5 Cluster: Putative uncharacterized protein; n=1; ... 34 5.8 UniRef50_Q2IHS3 Cluster: Putative uncharacterized protein precur... 34 5.8 UniRef50_Q127H7 Cluster: Putative uncharacterized protein precur... 34 5.8 UniRef50_Q02AB7 Cluster: RNP-1 like RNA-binding protein; n=2; ce... 34 5.8 UniRef50_Q01XU2 Cluster: Putative uncharacterized protein precur... 34 5.8 UniRef50_A7CSF4 Cluster: Helicase domain protein; n=1; Opitutace... 34 5.8 UniRef50_A4M4S8 Cluster: Putative uncharacterized protein precur... 34 5.8 UniRef50_A4FBY5 Cluster: Putative uncharacterized protein; n=1; ... 34 5.8 UniRef50_A3TG50 Cluster: Putative uncharacterized protein; n=1; ... 34 5.8 UniRef50_A3ET02 Cluster: Putative uncharacterized protein; n=2; ... 34 5.8 UniRef50_A1ULP9 Cluster: Transglycosylase domain protein precurs... 34 5.8 UniRef50_Q9FHA7 Cluster: Emb|CAB62312.1; n=3; Arabidopsis thalia... 34 5.8 UniRef50_Q7XMC9 Cluster: OSJNBb0018A10.6 protein; n=11; Oryza sa... 34 5.8 UniRef50_Q69XV3 Cluster: Putative glycine-rich cell wall structu... 34 5.8 UniRef50_Q10Q04 Cluster: Expressed protein; n=3; Oryza sativa|Re... 34 5.8 UniRef50_Q10L59 Cluster: PWWP domain containing protein, express... 34 5.8 UniRef50_Q0DLG0 Cluster: Os05g0104000 protein; n=9; Oryza sativa... 34 5.8 UniRef50_Q014T0 Cluster: Putative transcription regulatory prote... 34 5.8 UniRef50_O48809 Cluster: T3P18.1; n=9; Eukaryota|Rep: T3P18.1 - ... 34 5.8 UniRef50_A7UE73 Cluster: LRR receptor-like kinase; n=1; Solanum ... 34 5.8 UniRef50_A7P7D2 Cluster: Chromosome chr9 scaffold_7, whole genom... 34 5.8 UniRef50_A5B0K8 Cluster: Putative uncharacterized protein; n=1; ... 34 5.8 UniRef50_A4S9A6 Cluster: Predicted protein; n=1; Ostreococcus lu... 34 5.8 UniRef50_A2X6I7 Cluster: Putative uncharacterized protein; n=2; ... 34 5.8 UniRef50_Q9W3E3 Cluster: CG33181-PA; n=3; Endopterygota|Rep: CG3... 34 5.8 UniRef50_Q9VZC0 Cluster: CG11345-PA; n=1; Drosophila melanogaste... 34 5.8 UniRef50_Q9VX66 Cluster: CG12997-PA; n=1; Drosophila melanogaste... 34 5.8 UniRef50_Q9TZM9 Cluster: Temporarily assigned gene name protein ... 34 5.8 UniRef50_Q8WT46 Cluster: Putative uncharacterized protein; n=3; ... 34 5.8 UniRef50_Q8IMM6 Cluster: CG5514-PB, isoform B; n=3; Drosophila m... 34 5.8 UniRef50_Q55FU3 Cluster: Putative uncharacterized protein; n=1; ... 34 5.8 UniRef50_Q22872 Cluster: CE; n=4; Caenorhabditis|Rep: CE - Caeno... 34 5.8 UniRef50_Q1HMI6 Cluster: Formin A; n=4; Trypanosoma cruzi|Rep: F... 34 5.8 UniRef50_Q172S1 Cluster: Stretchin-mlck; n=1; Aedes aegypti|Rep:... 34 5.8 UniRef50_A2FFZ7 Cluster: Putative uncharacterized protein; n=1; ... 34 5.8 UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU074... 34 5.8 UniRef50_Q560V3 Cluster: Putative uncharacterized protein; n=2; ... 34 5.8 UniRef50_Q2H9M3 Cluster: Putative uncharacterized protein; n=1; ... 34 5.8 UniRef50_Q2H4B1 Cluster: Putative uncharacterized protein; n=1; ... 34 5.8 UniRef50_A7EH03 Cluster: Putative uncharacterized protein; n=1; ... 34 5.8 UniRef50_A6RU25 Cluster: Putative uncharacterized protein; n=1; ... 34 5.8 UniRef50_A6QWU5 Cluster: Predicted protein; n=10; Pezizomycotina... 34 5.8 UniRef50_A4R6E5 Cluster: Putative uncharacterized protein; n=2; ... 34 5.8 UniRef50_A4QXQ3 Cluster: Putative uncharacterized protein; n=6; ... 34 5.8 UniRef50_A1CD74 Cluster: DUF1720 domain protein; n=17; Pezizomyc... 34 5.8 UniRef50_O00401 Cluster: Neural Wiskott-Aldrich syndrome protein... 34 5.8 UniRef50_Q70EK9 Cluster: Ubiquitin carboxyl-terminal hydrolase 5... 34 5.8 UniRef50_Q8N3X1 Cluster: Formin-binding protein 4; n=28; Eumetaz... 34 5.8 UniRef50_Q9NZ56 Cluster: Formin-2; n=13; Eumetazoa|Rep: Formin-2... 34 5.8 UniRef50_O60885 Cluster: Bromodomain-containing protein 4; n=70;... 34 5.8 UniRef50_UPI0000F2CB43 Cluster: PREDICTED: hypothetical protein;... 33 7.7 UniRef50_UPI0000EBD1A6 Cluster: PREDICTED: hypothetical protein;... 33 7.7 UniRef50_UPI0000E4A721 Cluster: PREDICTED: similar to LOC397922 ... 33 7.7 UniRef50_UPI0000E48DD8 Cluster: PREDICTED: similar to MGC81512 p... 33 7.7 UniRef50_UPI0000E48C90 Cluster: PREDICTED: hypothetical protein;... 33 7.7 UniRef50_UPI0000DB7674 Cluster: PREDICTED: hypothetical protein;... 33 7.7 UniRef50_UPI0000D561AD Cluster: PREDICTED: hypothetical protein;... 33 7.7 UniRef50_UPI000023E328 Cluster: hypothetical protein FG01070.1; ... 33 7.7 UniRef50_UPI00004D6F7D Cluster: formin-like 2; n=3; Euteleostomi... 33 7.7 UniRef50_Q90WR5 Cluster: Keratin alpha; n=1; Lampetra fluviatili... 33 7.7 UniRef50_Q4THH6 Cluster: Chromosome undetermined SCAF2934, whole... 33 7.7 UniRef50_Q08BP2 Cluster: LOC562403 protein; n=5; Danio rerio|Rep... 33 7.7 UniRef50_Q0ILB7 Cluster: ORF1629; n=1; Leucania separata nuclear... 33 7.7 UniRef50_Q8NNC9 Cluster: Chromosome segregation ATPases; n=4; Co... 33 7.7 UniRef50_Q6M9P0 Cluster: Putative uncharacterized protein; n=1; ... 33 7.7 UniRef50_Q2IHA5 Cluster: Putative uncharacterized protein; n=1; ... 33 7.7 UniRef50_Q1LE58 Cluster: Type II and III secretion system protei... 33 7.7 UniRef50_Q08Y94 Cluster: Putative prolin-rich exported protein; ... 33 7.7 UniRef50_A5WD13 Cluster: Putative uncharacterized protein precur... 33 7.7 UniRef50_A4T3A4 Cluster: Mammalian cell entry related domain pro... 33 7.7 UniRef50_A3ZRC6 Cluster: Putative uncharacterized protein; n=2; ... 33 7.7 UniRef50_A0VCM8 Cluster: Putative uncharacterized protein precur... 33 7.7 UniRef50_Q9SUX2 Cluster: Extensin-like protein; n=2; Arabidopsis... 33 7.7 UniRef50_Q9SAD7 Cluster: F3F19.4 protein; n=10; Brassicaceae|Rep... 33 7.7 UniRef50_Q9MA04 Cluster: F20B17.16; n=5; core eudicotyledons|Rep... 33 7.7 UniRef50_Q6ZKL7 Cluster: Putative uncharacterized protein OJ1118... 33 7.7 UniRef50_Q10I10 Cluster: Transposon protein, putative, CACTA, En... 33 7.7 UniRef50_Q0JD12 Cluster: Os04g0438100 protein; n=2; Oryza sativa... 33 7.7 UniRef50_Q01B16 Cluster: Chromosome 04 contig 1, DNA sequence; n... 33 7.7 UniRef50_Q013S1 Cluster: Chromosome 08 contig 1, DNA sequence; n... 33 7.7 UniRef50_Q00TD0 Cluster: Chromosome 17 contig 1, DNA sequence; n... 33 7.7 UniRef50_A4S1Y9 Cluster: Predicted protein; n=1; Ostreococcus lu... 33 7.7 UniRef50_A4RW22 Cluster: Predicted protein; n=1; Ostreococcus lu... 33 7.7 UniRef50_A4RU01 Cluster: Predicted protein; n=1; Ostreococcus lu... 33 7.7 UniRef50_A2YH88 Cluster: Putative uncharacterized protein; n=1; ... 33 7.7 UniRef50_Q9VAT0 Cluster: CG1520-PA, isoform A; n=3; Sophophora|R... 33 7.7 UniRef50_Q581B0 Cluster: Putative uncharacterized protein; n=5; ... 33 7.7 UniRef50_Q54ER5 Cluster: Formin homology domain-containing prote... 33 7.7 UniRef50_Q4D508 Cluster: Putative uncharacterized protein; n=2; ... 33 7.7 UniRef50_Q38EF1 Cluster: Putative uncharacterized protein; n=1; ... 33 7.7 UniRef50_Q23RC8 Cluster: Protein kinase domain containing protei... 33 7.7 UniRef50_Q18880 Cluster: Putative uncharacterized protein grl-17... 33 7.7 UniRef50_A7TC21 Cluster: Predicted protein; n=1; Nematostella ve... 33 7.7 UniRef50_A2DNB1 Cluster: Putative uncharacterized protein; n=2; ... 33 7.7 UniRef50_A2D8Z8 Cluster: Putative uncharacterized protein; n=1; ... 33 7.7 UniRef50_Q8WZK9 Cluster: Putative uncharacterized protein B14D6.... 33 7.7 UniRef50_Q872W5 Cluster: Putative uncharacterized protein B2G14.... 33 7.7 UniRef50_Q6C7Q8 Cluster: Similar to tr|Q95JC9 Sus scrofa Basic p... 33 7.7 UniRef50_Q6BNL1 Cluster: Similar to sp|P32521 Saccharomyces cere... 33 7.7 UniRef50_Q3HYB9 Cluster: Proline-and threonine-rich protein; n=2... 33 7.7 UniRef50_Q2HEQ9 Cluster: Predicted protein; n=1; Chaetomium glob... 33 7.7 UniRef50_Q2GUA6 Cluster: Predicted protein; n=2; Pezizomycotina|... 33 7.7 >UniRef50_A2DM31 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 560 Score = 41.9 bits (94), Expect = 0.022 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PPPPP + PPPP PPP P Sbjct: 462 APPPPGIGLPPPPPPAFGIPPPPPGVGVPPPPP 494 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 464 PPPGIGLPPPPPPAFGIPPPPPGVGVPPPPP 494 >UniRef50_A1CZG7 Cluster: Putative uncharacterized protein; n=2; Trichocomaceae|Rep: Putative uncharacterized protein - Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / NRRL 181)(Aspergillus fischerianus (strain ATCC 1020 / DSM 3700 / NRRL 181)) Length = 961 Score = 41.9 bits (94), Expect = 0.022 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 F P P F PPPPP PPPP PPP Sbjct: 922 FQRPPLPGFLSGPPPPPLYYTHPPPPGPTGPPP 954 >UniRef50_Q9A2R2 Cluster: OmpA family protein; n=5; Caulobacter|Rep: OmpA family protein - Caulobacter crescentus (Caulobacter vibrioides) Length = 449 Score = 41.5 bits (93), Expect = 0.029 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFD 499 F SP P PPPPP PPPP PPP F+ Sbjct: 303 FASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPAFE 339 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 >UniRef50_Q3ECQ3 Cluster: Uncharacterized protein At1g54215.1; n=1; Arabidopsis thaliana|Rep: Uncharacterized protein At1g54215.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 169 Score = 41.1 bits (92), Expect = 0.038 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 L S P F PPPPP PPPP PPP P Sbjct: 29 LVQSQDPPLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 >UniRef50_A4HCC8 Cluster: Putative uncharacterized protein; n=2; Leishmania|Rep: Putative uncharacterized protein - Leishmania braziliensis Length = 814 Score = 41.1 bits (92), Expect = 0.038 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP V PPPP PPP P Sbjct: 344 PPPPPAASLPPPPPAASVPPPPPAASLPPPPP 375 Score = 41.1 bits (92), Expect = 0.038 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP V PPPP PPP P Sbjct: 362 PPPPPAASLPPPPPAASVPPPPPAASLPPPPP 393 Score = 41.1 bits (92), Expect = 0.038 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP V PPPP PPP P Sbjct: 380 PPPPPAASLPPPPPAASVPPPPPAASVPPPPP 411 Score = 41.1 bits (92), Expect = 0.038 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP V PPPP PPP P Sbjct: 389 PPPPPAASVPPPPPAASVPPPPPAASVPPPPP 420 Score = 41.1 bits (92), Expect = 0.038 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP V PPPP PPP P Sbjct: 398 PPPPPAASVPPPPPAASVPPPPPAASVPPPPP 429 Score = 41.1 bits (92), Expect = 0.038 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP V PPPP PPP P Sbjct: 407 PPPPPAASVPPPPPAASVPPPPPAASLPPPPP 438 Score = 39.9 bits (89), Expect = 0.089 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP + PPPP PPP P Sbjct: 353 PPPPPAASVPPPPPAASLPPPPPAASVPPPPP 384 Score = 39.9 bits (89), Expect = 0.089 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP + PPPP PPP P Sbjct: 371 PPPPPAASVPPPPPAASLPPPPPAASVPPPPP 402 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P PPPPP + PPPP PPP P Sbjct: 338 PPAASVPPPPPAASLPPPPPAASVPPPPP 366 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 345 PPPPAASLPPPPPAASVPPPPPAASLPPPPP 375 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 354 PPPPAASVPPPPPAASLPPPPPAASVPPPPP 384 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 363 PPPPAASLPPPPPAASVPPPPPAASLPPPPP 393 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 372 PPPPAASVPPPPPAASLPPPPPAASVPPPPP 402 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 381 PPPPAASLPPPPPAASVPPPPPAASVPPPPP 411 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 390 PPPPAASVPPPPPAASVPPPPPAASVPPPPP 420 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 399 PPPPAASVPPPPPAASVPPPPPAASVPPPPP 429 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 408 PPPPAASVPPPPPAASVPPPPPAASLPPPPP 438 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = -2 Query: 573 PP--PPPXXXVKPPPPXXXXPPPXP 505 PP PPP V PPPP PPP P Sbjct: 333 PPSTPPPAASVPPPPPAASLPPPPP 357 >UniRef50_A1C9U1 Cluster: Putative uncharacterized protein; n=1; Aspergillus clavatus|Rep: Putative uncharacterized protein - Aspergillus clavatus Length = 919 Score = 41.1 bits (92), Expect = 0.038 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 F P P F PPPPP PPPP PPP Sbjct: 880 FQRPPLPGFLPGPPPPPLYYSHPPPPGPGIPPP 912 >UniRef50_Q1IA36 Cluster: Insecticidal toxin, SepC/Tcc class; n=1; Pseudomonas entomophila L48|Rep: Insecticidal toxin, SepC/Tcc class - Pseudomonas entomophila (strain L48) Length = 990 Score = 40.7 bits (91), Expect = 0.051 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP + PPPP PPP P Sbjct: 716 PPPPGMGTPPPPPPGMGLPPPPPGLRPPPPGP 747 Score = 35.1 bits (77), Expect = 2.5 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPPP PPPP PPP Sbjct: 715 PPPPPGMGTPPPPPPGMGLPPPPPGLRPPP 744 Score = 33.5 bits (73), Expect = 7.7 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXV---KPPPPXXXXPPPXP 505 P P PPPPP + PPPP PPP P Sbjct: 704 PPPPSGMRLPPPPPPPGMGTPPPPPPGMGLPPPPP 738 >UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnoliophyta|Rep: Extensin protein-like - Arabidopsis thaliana (Mouse-ear cress) Length = 470 Score = 40.7 bits (91), Expect = 0.051 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPF 502 SP P PPPPP PPPP PPP P+ Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPY 408 Score = 37.5 bits (83), Expect = 0.47 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P + PPPPP PP P PPP P Sbjct: 418 PSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPP 449 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP P P P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPP 415 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 34.3 bits (75), Expect = 4.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 585 FXXXPPPPPXXXVKPPPPXXXXPPPXP 505 F PP PP PPPP PPP P Sbjct: 372 FGCSPPSPPPPPPPPPPPPPPPPPPPP 398 Score = 34.3 bits (75), Expect = 4.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSPP 414 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYP 426 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 >UniRef50_Q4PSF3 Cluster: Proline-rich extensin-like family protein; n=3; Arabidopsis thaliana|Rep: Proline-rich extensin-like family protein - Arabidopsis thaliana (Mouse-ear cress) Length = 249 Score = 40.7 bits (91), Expect = 0.051 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 61 SPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPP 93 Score = 40.7 bits (91), Expect = 0.051 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 70 SPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPP 102 Score = 40.7 bits (91), Expect = 0.051 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 79 SPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPP 111 Score = 40.7 bits (91), Expect = 0.051 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 88 SPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPP 120 Score = 40.7 bits (91), Expect = 0.051 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 97 SPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPP 129 Score = 40.7 bits (91), Expect = 0.051 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 106 SPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPP 138 Score = 40.7 bits (91), Expect = 0.051 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 115 SPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPP 147 Score = 40.7 bits (91), Expect = 0.051 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 124 SPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPP 156 Score = 39.1 bits (87), Expect = 0.15 Identities = 37/137 (27%), Positives = 38/137 (27%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSPXXXXXXXXXXXXXXXXXKQXXX 412 P PPPPP PPPP PPP P + P Sbjct: 38 PLVDLSPPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLS 97 Query: 411 XXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPFFXLXPPF 232 P S PPP P P P PP P L PP Sbjct: 98 PPPPPVNLS--------PPPPPVNLSPPPPPVLLSPP--PPPVLLSPPP--PPVNLSPPP 145 Query: 231 XPFLXXXPPPRXFFXPP 181 P L PPP F PP Sbjct: 146 PPVLLSPPPPPVLFSPP 162 Score = 38.3 bits (85), Expect = 0.27 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 SP P PPPPP PPPP PPP Sbjct: 133 SPPPPPVNLSPPPPPVLLSPPPPPVLFSPPP 163 Score = 37.9 bits (84), Expect = 0.36 Identities = 33/130 (25%), Positives = 38/130 (29%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP PPPP PPPPP+ PP P P+ + PPP N Sbjct: 54 PPPPVNLSPPPPPVNLSPPPPPVN--LSPPPPPVNLSPPPPPVLL---SPPPPPVNLSPP 108 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXXXS 210 P+ L + PP PP P Sbjct: 109 PPPVNLSPPPPPVLLSPPPPP---------------VLLSPPPPPVNLSPPPPPVLLSPP 153 Query: 209 PPPXFFXXPP 180 PPP F PP Sbjct: 154 PPPVLFSPPP 163 Score = 37.5 bits (83), Expect = 0.47 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPP PPPP PPP P Sbjct: 43 SPPPPPVNISSPPPPVNLSPPPPPVNLSPPPPP 75 Score = 37.5 bits (83), Expect = 0.47 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 S P PPPPP PPPP PPP P Sbjct: 52 SSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPP 84 Score = 37.5 bits (83), Expect = 0.47 Identities = 20/54 (37%), Positives = 23/54 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP+ PP P P+ F + PPP Sbjct: 117 PPPPVLLSPPPPPVLLSPPPPPVN--LSPPPPPVLLSPPPPPVLF----SPPPP 164 Score = 37.5 bits (83), Expect = 0.47 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 142 SPPPPPVLLSPPPPP-VLFSPPPPTVTRPPPPP 173 Score = 36.7 bits (81), Expect = 0.83 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP +PPPP PPPPP+ PP Sbjct: 45 PPPPVNISSPPPPVNLSPPPPPVNLSPPPPP 75 Score = 36.3 bits (80), Expect = 1.1 Identities = 18/54 (33%), Positives = 20/54 (37%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPP +T P + P K PPP Sbjct: 144 PPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPP 197 Score = 35.9 bits (79), Expect = 1.4 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPP PP P P PPP Sbjct: 143 PPPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPP 196 >UniRef50_O65530 Cluster: Putative uncharacterized protein F4D11.90; n=5; cellular organisms|Rep: Putative uncharacterized protein F4D11.90 - Arabidopsis thaliana (Mouse-ear cress) Length = 731 Score = 40.7 bits (91), Expect = 0.051 Identities = 23/54 (42%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP-XSXPLFFLGKNNXPPP 408 PP +PPPP PPPPPL PP P S PL FL PPP Sbjct: 71 PPSPPIESPPPPLLESPPPPPLESP--SPPSPHVSAPSGSPPLPFLPAKPSPPP 122 Score = 34.3 bits (75), Expect = 4.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPP PPPP PP P GSP Sbjct: 79 PPPPLLESPPPPPLESPSPPSPHVSAPSGSP 109 >UniRef50_A2DFC2 Cluster: Formin Homology 2 Domain containing protein; n=2; Eukaryota|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1189 Score = 40.7 bits (91), Expect = 0.051 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 +P P PPPPP PPPP PPP P G P Sbjct: 661 APAAPGLVPPPPPPPGGVPPPPPPPGGVPPPPPPPGGVPPPP 702 Score = 37.5 bits (83), Expect = 0.47 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 L P P PPPPP V PPPP PP P Sbjct: 667 LVPPPPPPPGGVPPPPPPPGGVPPPPPPPGGVPPPP 702 >UniRef50_A3GHC4 Cluster: Predicted protein; n=1; Pichia stipitis|Rep: Predicted protein - Pichia stipitis (Yeast) Length = 392 Score = 40.7 bits (91), Expect = 0.051 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP V PPPP PPP P Sbjct: 358 PPPPSEVKVPPPPPEVKVPPPPPEVKVPPPPP 389 Score = 39.1 bits (87), Expect = 0.15 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PPPPP PPPP PPP P Sbjct: 329 APPPPPATGFPPPPPPSVKPPPPPSAAKPPPPP 361 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP V PPPP PPP P Sbjct: 349 PPPPSAAKPPPPPSEVKVPPPPPEVKVPPPPP 380 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 G PPP PPPP PPPPP PP Sbjct: 337 GFPPPPPPSVKPPPPPSAAKPPPPPSEVKVPPPP 370 Score = 34.7 bits (76), Expect = 3.3 Identities = 20/54 (37%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP + PP + P P K PPP Sbjct: 331 PPPPATGFPPPPPPSVKPPPPP-SAAKPPPPPSEVKVPPPPPEV---KVPPPPP 380 Score = 34.3 bits (75), Expect = 4.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 339 PPPPPPSVKPPPPPSAAKPPPPPSEVKVPPPP 370 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 359 PPPSEVKVPPPPPEVKVPPPPPEVKVPPPPP 389 Score = 33.5 bits (73), Expect = 7.7 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -2 Query: 600 PXXPXFXXX--PPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 319 PPLPVGIKPPAPPPPPATGFPPPPPPSVKPPPPP 352 >UniRef50_A0GWT4 Cluster: Putative uncharacterized protein; n=2; Chloroflexus|Rep: Putative uncharacterized protein - Chloroflexus aggregans DSM 9485 Length = 600 Score = 40.3 bits (90), Expect = 0.067 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PPPPP PPPP PPP P Sbjct: 515 APPPPPHAPAPPPPPHAPAPPPPPHAPAPPPPP 547 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P PPPPP PPPP PPP P Sbjct: 510 PPHAPAPPPPPHAPAPPPPPHAPAPPPPP 538 Score = 34.3 bits (75), Expect = 4.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXP 505 PPPP PPPP PPP P Sbjct: 508 PPPPHAPAPPPPPHAPAPPPPP 529 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P PPPPP PPPP PPP P Sbjct: 493 PPHAPAPPPPPSHHA-PPPPHAPAPPPPP 520 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 499 PPPPPSHHAPPPPHAPAPPPPPHAPAPPPPP 529 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 517 PPPPHAPAPPPPPHAPAPPPPPHAPAPPPPP 547 >UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel domain; n=1; Sinorhizobium medicae WSM419|Rep: Outer membrane autotransporter barrel domain - Sinorhizobium medicae WSM419 Length = 864 Score = 39.9 bits (89), Expect = 0.089 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 485 SPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPP 517 Score = 39.5 bits (88), Expect = 0.12 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 504 SPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGP 536 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 487 PPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPP 518 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 488 PPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPP 519 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 489 PPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPP 520 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 496 PPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPP 527 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 497 PPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPP 528 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 498 PPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPP 529 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PPP P Sbjct: 499 PPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPP 530 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP + PP P P Sbjct: 489 PPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPP 530 Score = 35.1 bits (77), Expect = 2.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P P PPP PPPP PPP P Sbjct: 494 PPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPP 525 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPL 441 PPP PPPP PPPPP PP P P+ Sbjct: 497 PPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPI 539 Score = 35.1 bits (77), Expect = 2.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP P P P Sbjct: 507 PPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSP 538 Score = 34.7 bits (76), Expect = 3.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 490 PPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPP 531 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 490 PPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPP 521 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PPP P Sbjct: 495 PPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPP 526 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPP P PPPP PPP P Sbjct: 500 PPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPP 531 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 488 PPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPP 529 Score = 33.5 bits (73), Expect = 7.7 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PP +PPPP PPPPP PP P P Sbjct: 505 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITPSVRP 545 >UniRef50_P93845 Cluster: Putative uncharacterized protein; n=1; Pisum sativum|Rep: Putative uncharacterized protein - Pisum sativum (Garden pea) Length = 306 Score = 39.9 bits (89), Expect = 0.089 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 77 SPPPPPRRSSPPPPPPRIRSPPPPRPPPPPPPP 109 Score = 36.7 bits (81), Expect = 0.83 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFF 435 PPP PPPP PPPPP PP + P PL F Sbjct: 70 PPPPPRRSPPPPPRRSSPPPPP--PRIRSPPPPRPPPPPPPPLLF 112 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 SP P PPPP PPPP PPP Sbjct: 69 SPPPPPRRSPPPPPRRSSPPPPPPRIRSPPP 99 >UniRef50_A5BR16 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 196 Score = 39.9 bits (89), Expect = 0.089 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 16 SPPPPPPSPSPPPPPSPSPSPPPPPSPSPPPSP 48 Score = 35.9 bits (79), Expect = 1.4 Identities = 20/54 (37%), Positives = 23/54 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP + PP P S P ++ PPP Sbjct: 9 PPPPTPLSPPPPPPSPSPPPPP-SPSPSPPPPPSPSPPPSPP----PPSSPPPP 57 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 9 PPPPTPLSPPPPPPSPSPPPPPSPSPSPPPPP 40 >UniRef50_A5JUU8 Cluster: Formin B; n=2; Trypanosoma brucei|Rep: Formin B - Trypanosoma brucei TREU927 Length = 1004 Score = 39.9 bits (89), Expect = 0.089 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPPPP PPPP PPP P G P Sbjct: 503 PPPPGGKLPPPPPPPGKAPPPPPGGKLPPPPPPGGKGAPPP 543 Score = 38.3 bits (85), Expect = 0.27 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP--XKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP PP K P P LG PPP Sbjct: 504 PPPGGKLPPPPPPPGKAPPPPPGGKLPPPPPPGGKGAPPPPPPPPGKLGPGGGPPP 559 Score = 35.9 bits (79), Expect = 1.4 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXX---VKPPPPXXXXPPPXPFDGXXXGSP 478 SP P PPPPP PPPP PPP P G P Sbjct: 458 SPLPPSATLPPPPPPAAERLPAPPPPPVKLPPPPPPPGGKLPPPP 502 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPPPP PPPP PP P G P Sbjct: 502 PPPPPGGKLPPPPPPPGKAPPPPPGGKLPPPPPPGGKGAPP 542 Score = 35.5 bits (78), Expect = 1.9 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP PP K P P GK PPP Sbjct: 482 PPPVKLPPPPPPPGGKLPPPPP------PPPGGKLPPPPPPP----GKAPPPPP 525 Score = 34.3 bits (75), Expect = 4.4 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXV---KPPPPXXXXPPPXPFDGXXXGSP 478 P P PPPPP + PPPP PPP P G P Sbjct: 481 PPPPVKLPPPPPPPGGKLPPPPPPPPGGKLPPPPPPPGKAPPPP 524 Score = 33.9 bits (74), Expect = 5.8 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXX--XXPPPXP 505 P P PPPPP + PPPP PPP P Sbjct: 512 PPPPPPGKAPPPPPGGKLPPPPPPGGKGAPPPPP 545 Score = 33.5 bits (73), Expect = 7.7 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 G PPP PPPP PPPP PP P P GK PPP Sbjct: 496 GKLPPP------PPPPPGGKLPPPPPPPGKAPPPPPGGKLPPPPPPG--GKGAPPPP 544 >UniRef50_A2DI20 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 460 Score = 39.9 bits (89), Expect = 0.089 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PPPPP PPPP PPP P Sbjct: 331 APQAPSAPAAPPPPPAPAAPPPPPAPAAPPPPP 363 Score = 36.7 bits (81), Expect = 0.83 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PPPPP PPPP P P P Sbjct: 340 APPPPPAPAAPPPPPAPAAPPPPPPPSVPAPPP 372 Score = 34.3 bits (75), Expect = 4.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 342 PPPPAPAAPPPPPAPAAPPPPPPPSVPAPPP 372 >UniRef50_UPI0000499A11 Cluster: hypothetical protein 42.t00003; n=2; Eukaryota|Rep: hypothetical protein 42.t00003 - Entamoeba histolytica HM-1:IMSS Length = 1575 Score = 39.5 bits (88), Expect = 0.12 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP T PP P P L PPP Sbjct: 1424 PPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPPP-TLSMPPPPPP 1476 Score = 39.5 bits (88), Expect = 0.12 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP T PP P P L PPP Sbjct: 1444 PPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPPP-TLSMPPPPPP 1496 Score = 37.1 bits (82), Expect = 0.62 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP + PPPP PP P Sbjct: 1423 PPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPP 1454 Score = 37.1 bits (82), Expect = 0.62 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP + PPPP PP P Sbjct: 1433 PPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPP 1464 Score = 37.1 bits (82), Expect = 0.62 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP + PPPP PP P Sbjct: 1443 PPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPP 1474 Score = 37.1 bits (82), Expect = 0.62 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP + PPPP PP P Sbjct: 1453 PPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPP 1484 Score = 37.1 bits (82), Expect = 0.62 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP + PPPP PP P Sbjct: 1463 PPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPP 1494 Score = 35.1 bits (77), Expect = 2.5 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPPP PPPPP T PP P P L PPP Sbjct: 1423 PPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPPP-TLSMPPPPPP 1466 Score = 33.9 bits (74), Expect = 5.8 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP + PPPP PP P Sbjct: 1422 PPPPPTLSMPPPPPPTLSMPPPP 1444 Score = 33.5 bits (73), Expect = 7.7 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -2 Query: 600 PXXPXFXXXPPPPP--XXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 1422 PPPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPP 1455 Score = 33.5 bits (73), Expect = 7.7 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -2 Query: 600 PXXPXFXXXPPPPP--XXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 1432 PPPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPP 1465 Score = 33.5 bits (73), Expect = 7.7 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -2 Query: 600 PXXPXFXXXPPPPP--XXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 1442 PPPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPP 1475 Score = 33.5 bits (73), Expect = 7.7 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -2 Query: 600 PXXPXFXXXPPPPP--XXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 1452 PPPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPP 1485 Score = 33.5 bits (73), Expect = 7.7 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -2 Query: 600 PXXPXFXXXPPPPP--XXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 1462 PPPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPP 1495 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP T P Sbjct: 1474 PPPTLSMPPPPPPTLSMPPPPPPTLNVTSSP 1504 >UniRef50_Q4RLL2 Cluster: Chromosome 10 SCAF15019, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 10 SCAF15019, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1225 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PPPPP PPPP PPP P Sbjct: 739 TPPPPPKAVTPPPPPKAVTPPPPPKAVTPPPPP 771 Score = 39.1 bits (87), Expect = 0.15 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 713 PPPPPKAAPPPPPPPKAATPPPPKAVTPPPPP 744 Score = 37.1 bits (82), Expect = 0.62 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 +P P PPPPP PPPP PPP Sbjct: 748 TPPPPPKAVTPPPPPKAVTPPPPPKAVTPPP 778 Score = 35.9 bits (79), Expect = 1.4 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP PP K P P K PPP Sbjct: 723 PPPPPKAATPPPPKAVTPPPPPKAVTP--PPPPKAVTPPPPP-----KAVTPPP 769 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PPP P Sbjct: 722 PPPPPPKAATPPPPKAVTPPPPPKAVTPPPPP 753 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPP PP K P P Sbjct: 740 PPPPPKAVTPPPPPKAVTPPPPPKAVTPPPPPKAVTPPPPIP 781 >UniRef50_A3Q026 Cluster: Putative uncharacterized protein precursor; n=3; Mycobacterium|Rep: Putative uncharacterized protein precursor - Mycobacterium sp. (strain JLS) Length = 210 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP + PPPP PPP P Sbjct: 168 PPPPPGAPLPPPPPGAPLPPPPPGAPLPPPPP 199 Score = 37.1 bits (82), Expect = 0.62 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPPP + PPPP PPP Sbjct: 177 PPPPPGAPLPPPPPGAPLPPPPPGAPLPPP 206 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 169 PPPPGAPLPPPPPGAPLPPPPPGAPLPPPPP 199 >UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-dz1 protein precursor - Volvox carteri f. nagariensis Length = 1009 Score = 39.5 bits (88), Expect = 0.12 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 235 SPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 670 PPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPP 701 Score = 38.7 bits (86), Expect = 0.20 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 673 PPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHP 704 Score = 38.3 bits (85), Expect = 0.27 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 660 PPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPP 691 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 233 PPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPP 264 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 238 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 239 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 272 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 37.9 bits (84), Expect = 0.36 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP PP P P L + PPP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 676 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 661 PPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 671 PPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPP 702 Score = 37.1 bits (82), Expect = 0.62 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPPL PP P P Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPP 694 Score = 37.1 bits (82), Expect = 0.62 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPL 441 PPP +PPPP PPPPP PP P PL Sbjct: 670 PPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPPL 712 Score = 36.7 bits (81), Expect = 0.83 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 214 PPPPPPLPPSPPPPSPPPPPPSP 236 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PP PP PPPP PPP P Sbjct: 223 SPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPP 255 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PP P Sbjct: 678 SPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPP 710 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP + P PP PPP P Sbjct: 658 PPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPP 689 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PP PP PPPP PPP P Sbjct: 228 SPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPP 260 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPPP PPPP PPP Sbjct: 677 PSPPPPPPPPPPPPPPPPPPPPPPPPHPPP 706 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 650 PPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPP 691 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 651 PPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXS 450 PPP PPPP PPPPP PP P S Sbjct: 680 PPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVPALPPS 719 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PPP P Sbjct: 226 PPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPP 257 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 649 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPP 680 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP P P P Sbjct: 650 PPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPP 681 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 651 PPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPP 682 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 659 PPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPP 690 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP P P P Sbjct: 680 PPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPP 711 Score = 34.3 bits (75), Expect = 4.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PPP P Sbjct: 222 PSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPP 253 Score = 34.3 bits (75), Expect = 4.4 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 600 PXXPXFXXXP-PPPPXXXVKPPPPXXXXPPPXP 505 P P P PPPP PPPP PPP P Sbjct: 230 PPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPP 262 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPP 685 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPP 693 Score = 34.3 bits (75), Expect = 4.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PP P PPP P Sbjct: 657 PPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPP 688 Score = 34.3 bits (75), Expect = 4.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 674 PLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPP 705 Score = 34.3 bits (75), Expect = 4.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 676 PPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPP 707 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 221 PPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPP 252 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PPP P Sbjct: 227 PSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPP 258 Score = 33.9 bits (74), Expect = 5.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 232 PPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 33.9 bits (74), Expect = 5.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPP 684 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 648 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP P PP PPP P Sbjct: 655 PPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPP 686 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PPP P Sbjct: 662 PPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPP 693 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPP P PPPP PPP P Sbjct: 663 PPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPP 694 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PP PP PPPP PPP P Sbjct: 664 PPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPP 695 Score = 33.5 bits (73), Expect = 7.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 647 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPP 688 >UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 precursor; n=2; Chlamydomonas reinhardtii|Rep: Hydroxyproline-rich glycoprotein GAS31 precursor - Chlamydomonas reinhardtii Length = 647 Score = 39.5 bits (88), Expect = 0.12 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 238 SPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPP 270 Score = 39.5 bits (88), Expect = 0.12 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 241 PPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPP 272 Score = 38.3 bits (85), Expect = 0.27 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 247 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 278 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 232 PSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPP 263 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 242 PPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPP 273 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 248 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 279 Score = 36.3 bits (80), Expect = 1.1 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPL 441 PPP PPPP PPPPP + PP P PL Sbjct: 242 PPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPL 284 Score = 35.1 bits (77), Expect = 2.5 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PP P +PPPP PPP P Sbjct: 221 SPPPPPSASSPPSSPSPSPRPPPPPMPPPPPPP 253 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PP P PPP P Sbjct: 244 PPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 275 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP P PP PPP P Sbjct: 245 PMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 276 Score = 34.7 bits (76), Expect = 3.3 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P P PPP PPPP PP PF SP Sbjct: 255 PPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFPAKPPMSP 295 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP 456 PPP PPPP PPPPPL P K P Sbjct: 258 PPPPPPPSPPPPPPPPPPPPPPLLPPLPPFPAKPPMSP 295 Score = 33.9 bits (74), Expect = 5.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 241 PPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLP 282 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 251 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLP 282 >UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C3 protein precursor - Chlamydomonas reinhardtii Length = 443 Score = 39.5 bits (88), Expect = 0.12 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 224 SPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 256 Score = 38.3 bits (85), Expect = 0.27 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPPPP PPPP PPP P SP Sbjct: 227 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSP 267 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 226 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 257 Score = 37.5 bits (83), Expect = 0.47 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 SP P PPPPP PPPP PPP Sbjct: 242 SPPPPPPPPPPPPPPPPPPSPPPPSPNPPPP 272 Score = 37.1 bits (82), Expect = 0.62 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP PPPPP PP P P Sbjct: 234 PPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKGP 275 Score = 36.7 bits (81), Expect = 0.83 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P PPPPP PPPP PPP P Sbjct: 219 PVASPSPPPPPPPPPPPPPPPPPSPPPPP 247 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPP PPP P Sbjct: 222 SPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 254 Score = 35.9 bits (79), Expect = 1.4 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXN 402 PPP PPPP PPPPP PP P P K P P N Sbjct: 226 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKGPSPTPNN 281 Score = 35.1 bits (77), Expect = 2.5 Identities = 18/52 (34%), Positives = 21/52 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXP 414 PPP PPPP PPP P GP FP + G+N+ P Sbjct: 246 PPPPPPPPPPPPPPPSPPPPSPNPPPPKGPSPTPNNFPYCNCATY-GRNSFP 296 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP P P P Sbjct: 238 PPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNP 269 >UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox carteri|Rep: Pherophorin-S precursor - Volvox carteri Length = 599 Score = 39.5 bits (88), Expect = 0.12 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 252 SPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 284 Score = 38.7 bits (86), Expect = 0.20 Identities = 17/52 (32%), Positives = 21/52 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXP 414 PPP +PPPP PPPPP PP +P + + K P Sbjct: 268 PPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYPDQCSVCIVAKLQPP 319 Score = 38.7 bits (86), Expect = 0.20 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 271 PPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 38.3 bits (85), Expect = 0.27 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 258 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 289 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 244 PPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 246 PPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSP 277 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 250 PPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPP 281 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 251 PSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPP 282 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 259 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 290 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 260 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 291 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 261 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 292 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 262 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 293 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 268 PPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 269 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 270 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 36.7 bits (81), Expect = 0.83 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 243 PPPPPSPPPSPPPPPPPPPPPPP 265 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P P PPP PPPP PPP P Sbjct: 237 SPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPP 269 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -2 Query: 618 LXLFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 L L +P P PPPPP PPP PPP P Sbjct: 212 LPLPNAPPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSP 249 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP PPPPP PP P P Sbjct: 244 PPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 285 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLF 438 PPP PPPP PPPPP PP P P++ Sbjct: 261 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVY 304 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP P PP PPP P Sbjct: 232 PSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPP 263 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PPP P Sbjct: 243 PPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPP 274 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 247 PSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPP 278 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 249 PPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 290 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP + PP P P Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 294 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 229 PPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPP 260 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PP P PPP P Sbjct: 231 PPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPP 262 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PPP P Sbjct: 235 PPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPP 266 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPP P PPPP PPP P Sbjct: 236 PSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPP 267 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPP P PPPP PPP P Sbjct: 240 PPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPP 271 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PP PP PPPP PPP P Sbjct: 241 PPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPP 272 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P P PPP PPPP PPP P Sbjct: 242 PPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPP 273 Score = 34.7 bits (76), Expect = 3.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PP P PPP P Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 286 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP P PP PPP P Sbjct: 256 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 287 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 257 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 288 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PPP P Sbjct: 263 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 294 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPP P PPPP PPP P Sbjct: 264 PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PP PP PPPP PPP P Sbjct: 265 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 296 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P P PPP PPPP PPP P Sbjct: 266 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PPP P Sbjct: 267 PPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 245 PPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 286 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 260 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 34.3 bits (75), Expect = 4.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 274 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYP 305 Score = 33.5 bits (73), Expect = 7.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PP P Sbjct: 228 PPPPPSPPPSPPPPPPPPPPSPP 250 >UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas vaginalis G3|Rep: Diaphanous, putative - Trichomonas vaginalis G3 Length = 620 Score = 39.5 bits (88), Expect = 0.12 Identities = 20/54 (37%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP + PPP PPPPP T PP P P N+ PPP Sbjct: 98 PPPPPPKSDAPPPPPARPPPPPPTAPPATPPPPPPNHPPPPP---PKSNDIPPP 148 Score = 37.1 bits (82), Expect = 0.62 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PPPPP PPPP PPP P Sbjct: 126 TPPPPPPNHPPPPPPKSNDIPPPPPAAIPPPAP 158 Score = 36.7 bits (81), Expect = 0.83 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 +P P PPPPP PPPP PPP Sbjct: 89 APAAPPPARPPPPPPKSDAPPPPPARPPPPP 119 Score = 36.7 bits (81), Expect = 0.83 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PPPP PPPP PPP P Sbjct: 107 APPPPPARPPPPPPTAPPATPPPPPPNHPPPPP 139 Score = 35.9 bits (79), Expect = 1.4 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 98 PPPPPPKSDAPPPPPARPPPPPP 120 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPPP PPPP PPP Sbjct: 548 PPPPPKGGAPPPPPPPARAPPPPAGTPPPP 577 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P + P Sbjct: 118 PPPTAPPATPPPPPPNHPPPPPPKSNDIPPPPPAAIPPPAPP 159 Score = 34.7 bits (76), Expect = 3.3 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXX---VKPPPPXXXXPPPXPFDGXXXGSP 478 +P P PPPPP PPPP PPP P G+P Sbjct: 513 APPLPGAGVPPPPPPPGAGAPPPPPPPAGGAPPPPPPPPPKGGAP 557 Score = 34.3 bits (75), Expect = 4.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPP PPPPP PP P P Sbjct: 129 PPPPNHPPPPPPKSNDIPPPPPAAIPPPAPPATPPAAPPKKP 170 Score = 33.9 bits (74), Expect = 5.8 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP + PPPP PP P Sbjct: 128 PPPPPNHPPPPPPKSNDIPPPPPAAIPPPAPP 159 Score = 33.9 bits (74), Expect = 5.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PP P Sbjct: 548 PPPPPKGGAPPPPPPPARAPPPP 570 Score = 33.5 bits (73), Expect = 7.7 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 535 PPPPPAGGAPPPPP-----PPPPKGGAPPPPP 561 >UniRef50_Q0U6P9 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 349 Score = 39.5 bits (88), Expect = 0.12 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 55 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 37.5 bits (83), Expect = 0.47 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 585 FXXXPPPPPXXXVKPPPPXXXXPPPXP 505 F PPPPP PPPP PPP P Sbjct: 52 FMASPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 37.1 bits (82), Expect = 0.62 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 F + P PPPPP PPPP PPP P Sbjct: 52 FMASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 34.7 bits (76), Expect = 3.3 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLF 438 PPP PPPP PPPPP PP P S F Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSLLPPHSDAPF 99 >UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n=1; Owenia fusiformis|Rep: Uncharacterized proline-rich protein - Owenia fusiformis Length = 141 Score = 39.5 bits (88), Expect = 0.12 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLF 438 PPP PPPP PPPPP PP ++ + PLF Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRARIHHNIPLF 70 Score = 38.3 bits (85), Expect = 0.27 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PPPPP PPPP PPP P Sbjct: 8 TPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 37.1 bits (82), Expect = 0.62 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -2 Query: 618 LXLFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 + L S P PPPPP PPPP PPP P Sbjct: 1 IRLLHSLTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 >UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precursor; n=1; Volvox carteri|Rep: Sulfated surface glycoprotein 185 precursor - Volvox carteri Length = 485 Score = 39.5 bits (88), Expect = 0.12 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 252 SPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPP 284 Score = 39.5 bits (88), Expect = 0.12 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 259 SPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 291 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 251 PSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPP 282 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 261 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 292 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 262 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 293 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 263 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 294 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPP PPP P Sbjct: 257 SPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 289 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP PPPPP PP P P Sbjct: 244 PPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPP 285 Score = 35.9 bits (79), Expect = 1.4 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP 456 PPP +PPPP PPPPP P +K P Sbjct: 269 PPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSP 306 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P P PPP PPPP PPP P Sbjct: 242 PSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPP 273 Score = 35.1 bits (77), Expect = 2.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PP PP PPPP PPP P Sbjct: 241 PPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPP 272 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP + PP P P Sbjct: 254 PPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 295 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 262 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKP 303 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 263 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPP 304 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P PP PP PPPP PPP P SP Sbjct: 266 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSP 306 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPP P PPPP PPP P Sbjct: 245 PPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPP 276 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 255 PPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPP 286 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PPP P Sbjct: 264 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 295 Score = 34.7 bits (76), Expect = 3.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP 456 PPP PPPP PPPPP PP P Sbjct: 274 PPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVP 311 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 253 PPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 294 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP PPPP PPPP PPP P Sbjct: 243 SPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPP 275 >UniRef50_Q8VAY0 Cluster: Wsv239; n=1; Shrimp white spot syndrome virus|Rep: Wsv239 - White spot syndrome virus (WSSV) Length = 127 Score = 34.7 bits (76), Expect(2) = 0.14 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -2 Query: 609 FXSPXXPXFXXXPP-PPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 F P P F PP PP PPPP P P PF SP Sbjct: 27 FPFPFPPPFPFPPPFVPPPPPSPPPPPPFVVPEPFPFVPPPPPSP 71 Score = 34.3 bits (75), Expect = 4.4 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 6/39 (15%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVK------PPPPXXXXPPPXPF 502 P P PPPPP V PPPP PPP PF Sbjct: 62 PFVPPPPPSPPPPPPFVVPVPFPFVPPPPPSPPPPPPPF 100 Score = 23.8 bits (49), Expect(2) = 0.14 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -2 Query: 360 PPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPFFXLXPPFXP 226 PPP P F PF P PP PF PP P Sbjct: 67 PPPSPPPPPPFVVPV--PFPFVPPPPPSPPPPPPPFVVPVPPSMP 109 >UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; n=2; Danio rerio|Rep: PREDICTED: similar to formin 2 - Danio rerio Length = 1465 Score = 39.1 bits (87), Expect = 0.15 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPP PPPPPL PP P F G PPP Sbjct: 936 PPPLPGFVPPPPVVGKAPPPPPLPGMVPPPPPPLPGMAPPPPPPFPGMTPPPPP 989 Score = 38.7 bits (86), Expect = 0.20 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -3 Query: 584 FXGXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 F G PPP PPPP PPPPPL G PP Sbjct: 980 FPGMTPPP------PPPPPGCGPPPPPLPPGIGPPP 1009 Score = 36.7 bits (81), Expect = 0.83 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP + PP P PPP P G P Sbjct: 916 PPPPPLSGMTPPKPTGVIPPPPPLPGFVPPPP 947 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 +P P PPPP V PPP PPP P G P Sbjct: 925 TPPKPTGVIPPPPPLPGFVPPPPVVGKAPPPPPLPGMVPPPP 966 Score = 34.7 bits (76), Expect = 3.3 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPP-XXXXPPPXPFDG 496 P P PPPPP PPPP PP PF G Sbjct: 978 PPFPGMTPPPPPPPPGCGPPPPPLPPGIGPPPPFMG 1013 Score = 33.5 bits (73), Expect = 7.7 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 G PP PPPP PPPP+ PP P P G PPP Sbjct: 923 GMTPPKPTGVIPPPPPLPGFVPPPPVVGKAPPPPPLPGMVPPPPPP-LPGMAPPPPP 978 >UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein cappuccino; n=1; Apis mellifera|Rep: PREDICTED: similar to Protein cappuccino - Apis mellifera Length = 1007 Score = 39.1 bits (87), Expect = 0.15 Identities = 21/57 (36%), Positives = 23/57 (40%), Gaps = 3/57 (5%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLT---XXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P PPPP PPPPP T GGPP P P+ + PPP Sbjct: 451 PSPLAASPPPPPPPPPPPPPPPPTQSSAAGGGPPPPPPPPPPPTPMIGVPPPPPPPP 507 Score = 33.5 bits (73), Expect = 7.7 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 6/51 (11%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVK------PPPPXXXXPPPXPFDGXXXGSP 478 L SP P PPPPP PPPP PPP P G P Sbjct: 454 LAASPPPPPPPPPPPPPPPPTQSSAAGGGPPPPPPPPPPPTPMIGVPPPPP 504 >UniRef50_UPI0000D55F3A Cluster: PREDICTED: similar to CG14622-PC, isoform C; n=1; Tribolium castaneum|Rep: PREDICTED: similar to CG14622-PC, isoform C - Tribolium castaneum Length = 1127 Score = 39.1 bits (87), Expect = 0.15 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPF 502 + SP P PPPPP PPP PPP PF Sbjct: 595 YKSPPPPPPLAPPPPPPAPGPPPPPNAPMAPPPEPF 630 Score = 35.1 bits (77), Expect = 2.5 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -3 Query: 545 NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXK 393 +PPPP PPPPP PP P K N P P N K Sbjct: 597 SPPPPPPLAPPPPPPAPGPPPPPNAPMAPPPEPFKVETVKKNIPQPANPLK 647 >UniRef50_UPI0000498B36 Cluster: hypothetical protein 114.t00013; n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical protein 114.t00013 - Entamoeba histolytica HM-1:IMSS Length = 483 Score = 39.1 bits (87), Expect = 0.15 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P PPPPP V PPPP PPP P Sbjct: 367 PPTSGNPPPPPNLNVPPPPPNLNVPPPPP 395 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXK 471 G PPP PPPP PPPPP T P K Sbjct: 371 GNPPPPPNLNVPPPPPNLNVPPPPPPTLNTTSPNPK 406 >UniRef50_Q4SUB2 Cluster: Chromosome 3 SCAF13974, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 3 SCAF13974, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 692 Score = 39.1 bits (87), Expect = 0.15 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPF 502 P P F PPPPP PP P PPP P+ Sbjct: 124 PPLPSFTLSPPPPPPPPPPPPLPPSPRPPPPPY 156 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P F PPPPP P P PPP P Sbjct: 106 PACPVFLPLPPPPPPPPPPPLPSFTLSPPPPP 137 >UniRef50_A3Q1Z8 Cluster: Molecular chaperone-like; n=4; Mycobacterium|Rep: Molecular chaperone-like - Mycobacterium sp. (strain JLS) Length = 568 Score = 39.1 bits (87), Expect = 0.15 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PPPPP PPPP PPP P Sbjct: 506 APPPPPAQEPPPPPPAEEPPPPPPAEEPPPPPP 538 Score = 36.7 bits (81), Expect = 0.83 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P PPPPP PPPP PPP P Sbjct: 501 PAATEAPPPPPAQEPPPPPPAEEPPPPPP 529 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPPP PPPP PPP Sbjct: 515 PPPPPPAEEPPPPPPAEEPPPPPPTTQPPP 544 Score = 35.1 bits (77), Expect = 2.5 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP 456 PPP PPPP PPPPP PP ++ P Sbjct: 499 PPPAATEAPPPPPAQEPPPPPPAEEPPPPPPAEEPPPP 536 Score = 35.1 bits (77), Expect = 2.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 516 PPPPPAEEPPPPPPAEEPPPPPPTTQPPPVIP 547 Score = 34.3 bits (75), Expect = 4.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 508 PPPPAQEPPPPPPAEEPPPPPPAEEPPPPPP 538 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 507 PPPPPAQEPPPPPPAEEPPPPPPAEEPPPPP 537 Score = 33.9 bits (74), Expect = 5.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLT 498 PPP PPPP PPPPP T Sbjct: 517 PPPPAEEPPPPPPAEEPPPPPPTT 540 >UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family; n=2; Ostreococcus tauri|Rep: Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family - Ostreococcus tauri Length = 872 Score = 39.1 bits (87), Expect = 0.15 Identities = 20/56 (35%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Frame = -3 Query: 569 PPPXXXX*NPPPPXX--XXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPPP PP P S P + PPP Sbjct: 570 PPPSPPPPSPPPPPSPPPSPPPPPSPPPPSPPPPPVVVVPSSPPPVLVNDMYPPPP 625 Score = 34.3 bits (75), Expect = 4.4 Identities = 18/54 (33%), Positives = 20/54 (37%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PP P P PPP PP P S P + PPP Sbjct: 524 PPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPP 577 Score = 33.5 bits (73), Expect = 7.7 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P P PPP PPPP PPP Sbjct: 509 PSPPPSPPPPSPPPSPPPSPPPPSPPSPPP 538 Score = 33.5 bits (73), Expect = 7.7 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = -2 Query: 603 SPXXPXFXXXPP-PPPXXXVKPP-PPXXXXPPPXP 505 SP P PP PPP +PP PP PPP P Sbjct: 540 SPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSP 574 Score = 33.5 bits (73), Expect = 7.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PP P Sbjct: 579 PPPPPSPPPSPPPPPSPPPPSPP 601 >UniRef50_Q4QBP0 Cluster: Putative uncharacterized protein; n=1; Leishmania major|Rep: Putative uncharacterized protein - Leishmania major Length = 762 Score = 39.1 bits (87), Expect = 0.15 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P PPPPP V PPPP PPP P Sbjct: 342 PPAASAPPPPPAASVPPPPPAASVPPPPP 370 Score = 39.1 bits (87), Expect = 0.15 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 +P P PPPPP V PPPP PPP Sbjct: 347 APPPPPAASVPPPPPAASVPPPPPAVSVPPP 377 Score = 37.1 bits (82), Expect = 0.62 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPP P V PPPP PPP P Sbjct: 384 PLPPPAASIPPPLPAVSVPPPPPAASVPPPLP 415 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 340 PPPPAASAPPPPPAASVPPPPPAASVPPPPP 370 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP V PPP P P P Sbjct: 357 PPPPPAASVPPPPPAVSVPPPPRAMSIPLPPP 388 >UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1; Coccidioides immitis|Rep: Putative uncharacterized protein - Coccidioides immitis Length = 1705 Score = 39.1 bits (87), Expect = 0.15 Identities = 23/54 (42%), Positives = 24/54 (44%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP + PPP PPPPPL GGPP P P F G PPP Sbjct: 984 PPPPLPGFSGPPP----PPPPPLPGFSGGPPPPP---PPPLPGFSGGAPPPPPP 1030 Score = 33.9 bits (74), Expect = 5.8 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP PPP PPP P G G P Sbjct: 983 PPPPPLPGFSGPPP----PPPPPLPGFSGGPP 1010 >UniRef50_A4R0U8 Cluster: Predicted protein; n=1; Magnaporthe grisea|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 198 Score = 39.1 bits (87), Expect = 0.15 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP V+ PPP PPP P Sbjct: 53 PPPPEICEPPPPPPPPVVEVPPPCIEVPPPPP 84 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPP V PPPP PPP P Sbjct: 62 PPPPPPPVVEVPPPCIEVPPPPPPPPPPPPCP 93 >UniRef50_UPI0001552F36 Cluster: PREDICTED: similar to SH3 domain binding protein; n=2; Mus musculus|Rep: PREDICTED: similar to SH3 domain binding protein - Mus musculus Length = 455 Score = 38.7 bits (86), Expect = 0.20 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 6 PPPPPPPPPPPPPPPLGAPPPPPLGAPPPPPP 37 Score = 37.9 bits (84), Expect = 0.36 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDG 496 P P PPPPP PPPP PPP P G Sbjct: 5 PPPPPPPPPPPPPPPPLGAPPPPPLGAPPPPPPPG 39 Score = 35.9 bits (79), Expect = 1.4 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPPL PP Sbjct: 7 PPPPPPPPPPPPPPLGAPPPPPLGAPPPPPP 37 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPPP PPPPP G PP P P Sbjct: 4 PPPPPPPPPPPPPPPPPLGAPPPPPLGAPPPPP 36 >UniRef50_Q8PPF4 Cluster: Putative uncharacterized protein XAC0732; n=2; Xanthomonas|Rep: Putative uncharacterized protein XAC0732 - Xanthomonas axonopodis pv. citri Length = 266 Score = 38.7 bits (86), Expect = 0.20 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPF 502 PPPPP PPPP PPP PF Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPF 262 Score = 37.5 bits (83), Expect = 0.47 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 585 FXXXPPPPPXXXVKPPPPXXXXPPPXP 505 F PPPPP PPPP PPP P Sbjct: 230 FAPPPPPPPPPPPPPPPPPPPPPPPPP 256 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPP 257 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPP 258 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPP 259 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPP 260 Score = 33.9 bits (74), Expect = 5.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPP 504 G PPP PPPP PPPPP Sbjct: 229 GFAPPPPPPPPPPPPPPPPPPPPPP 253 >UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherophorin - Volvox carteri f. nagariensis Length = 606 Score = 38.7 bits (86), Expect = 0.20 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 247 PPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPP 278 Score = 38.3 bits (85), Expect = 0.27 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 210 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 241 Score = 38.3 bits (85), Expect = 0.27 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 222 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 253 Score = 37.9 bits (84), Expect = 0.36 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP PP P S P + PPP Sbjct: 213 PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPP 266 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 214 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 245 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 226 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 257 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 238 PPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPP 269 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 246 PPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPP 277 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 255 PPPPPPSPSPPPPPPSPSPPPPPPPPSPPPAP 286 Score = 36.7 bits (81), Expect = 0.83 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 207 PPPPPPPPPSPPPPPPPPPPPSP 229 Score = 36.7 bits (81), Expect = 0.83 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPP-PXPF 502 P P PPPPP PPPP PP P PF Sbjct: 256 PPPPPSPSPPPPPPSPSPPPPPPPPSPPPAPPPF 289 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PP PP PPPP PPP P Sbjct: 216 SPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 248 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PP PP PPPP PPP P Sbjct: 228 SPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 260 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 236 PPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPP 277 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 211 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 242 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 223 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 254 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP P P P Sbjct: 235 PPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPP 266 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 212 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 253 Score = 35.1 bits (77), Expect = 2.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 245 PPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPP 276 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP + PP P P Sbjct: 247 PPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPPAPPP 288 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PPP P Sbjct: 203 PQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 234 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PP PP PPPP PPP P Sbjct: 205 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 236 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP P PP PPP P Sbjct: 208 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPP 239 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP P P P Sbjct: 212 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPP 243 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PPP P Sbjct: 215 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 246 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP P PP PPP P Sbjct: 220 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPP 251 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP P P P Sbjct: 224 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPP 255 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PPP P Sbjct: 227 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 258 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 236 PPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPP 267 Score = 34.7 bits (76), Expect = 3.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 237 PPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPP 278 Score = 33.9 bits (74), Expect = 5.8 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLG 429 PPP PPPP PPPP PP P + P F G Sbjct: 246 PPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPPAPPPFVPG 292 >UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-V1 protein precursor - Volvox carteri f. nagariensis Length = 590 Score = 38.7 bits (86), Expect = 0.20 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPL 441 PPP PPPP PPPPP PP P S PL Sbjct: 222 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPL 264 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 212 PPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPP 243 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 224 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 255 Score = 37.1 bits (82), Expect = 0.62 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PP PP PPPP PPP P Sbjct: 214 SPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPP 246 Score = 37.1 bits (82), Expect = 0.62 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PP P Sbjct: 220 SPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 252 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPPPP PPPP PP P SP Sbjct: 232 PPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPPSIPSP 272 Score = 35.1 bits (77), Expect = 2.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPP P PPPP PPP P Sbjct: 208 PPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSP 239 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPPPP PPPP P P P SP Sbjct: 222 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSP 262 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP P PP PPP P Sbjct: 218 PPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPP 249 Score = 33.9 bits (74), Expect = 5.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPP PPPPP PP P S P Sbjct: 211 PPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 252 Score = 33.9 bits (74), Expect = 5.8 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFF 435 PPP PPPP PPPP + PP P S P F Sbjct: 233 PPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPPSIP-SPPFAF 276 Score = 33.5 bits (73), Expect = 7.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP P PP PPP P Sbjct: 205 PPPPPPPPPSPSPPPSPPPPPSP 227 >UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; Chlamydomonadales|Rep: Pherophorin-C2 protein precursor - Chlamydomonas reinhardtii Length = 853 Score = 38.7 bits (86), Expect = 0.20 Identities = 20/54 (37%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP + PP P S P + PPP Sbjct: 428 PPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 481 Score = 37.9 bits (84), Expect = 0.36 Identities = 19/54 (35%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP + PP P P + PPP Sbjct: 488 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 541 Score = 37.1 bits (82), Expect = 0.62 Identities = 20/54 (37%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP + PP P S P + PPP Sbjct: 374 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPP 426 Score = 37.1 bits (82), Expect = 0.62 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 SP P PPPPP PPPP PPP Sbjct: 427 SPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 457 Score = 37.1 bits (82), Expect = 0.62 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 SP P PPPPP PPPP PPP Sbjct: 435 SPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 465 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPP P PPPP PPP P Sbjct: 236 SPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 268 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPP P PPPP PPP P Sbjct: 254 SPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 286 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPP PPPP PPP P Sbjct: 262 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 294 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP P P P Sbjct: 272 SPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 304 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP P PP PPP P Sbjct: 280 SPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 312 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPP P PPPP PPP P Sbjct: 288 SPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 320 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPP PPPP PPP P Sbjct: 319 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 351 Score = 36.3 bits (80), Expect = 1.1 Identities = 20/54 (37%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPPP PP P S P + PPP Sbjct: 321 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP--PPSPPPPSPPPPSPPPP 372 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP P P P Sbjct: 329 SPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 361 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP P PP PPP P Sbjct: 337 SPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 369 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPP PPPP PPP P Sbjct: 363 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 395 Score = 36.3 bits (80), Expect = 1.1 Identities = 20/54 (37%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPPP PP P S P + PPP Sbjct: 365 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP--PPSPPPPSPPPPSPPPP 416 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP P P P Sbjct: 373 SPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 405 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP P PP PPP P Sbjct: 381 SPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 413 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPP PPPP PPP P Sbjct: 417 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 449 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 428 PPPPPPPSPPPPPPPSPPPPPPP 450 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP P P P Sbjct: 443 SPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 475 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP + PP P P Sbjct: 444 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 485 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP P PP PPP P Sbjct: 451 SPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 483 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPP PPPP PPP P Sbjct: 477 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 509 Score = 36.3 bits (80), Expect = 1.1 Identities = 20/54 (37%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPPP PP P S P + PPP Sbjct: 479 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP--PPSPPPPSPPPPSPPPP 530 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP P P P Sbjct: 487 SPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 519 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP P PP PPP P Sbjct: 495 SPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 527 Score = 35.9 bits (79), Expect = 1.4 Identities = 19/54 (35%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPP PP P S P + PPP Sbjct: 223 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 276 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 274 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSP 315 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP PPPPP PP P P Sbjct: 419 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 460 Score = 35.5 bits (78), Expect = 1.9 Identities = 20/54 (37%), Positives = 23/54 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPPP + PP P S P + PPP Sbjct: 259 PPPSPPPPSPPPPSP--PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 310 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP P PPP + PP P S P Sbjct: 350 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 391 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP P PPP + PP P S P Sbjct: 404 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 445 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP P PPP + PP P S P Sbjct: 464 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 505 Score = 34.7 bits (76), Expect = 3.3 Identities = 18/54 (33%), Positives = 20/54 (37%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP P PPP PP P P + PPP Sbjct: 218 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 271 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPP P PPPP PPP P Sbjct: 219 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 250 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP P PP PPP P Sbjct: 229 PPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 260 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 230 PSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 261 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP P PP PPP P Sbjct: 247 PPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 278 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 248 PSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 279 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 266 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 297 Score = 34.7 bits (76), Expect = 3.3 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPP PP P S P + PPP Sbjct: 275 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 328 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP P PP PPP P Sbjct: 299 PPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 330 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPP P PPPP PPP P Sbjct: 312 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 343 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PP PP PPPP PPP P Sbjct: 313 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 344 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 323 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 354 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPP P PPPP PPP P Sbjct: 356 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 387 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PP PP PPPP PPP P Sbjct: 357 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 388 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 367 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 398 Score = 34.7 bits (76), Expect = 3.3 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP P PPP + PP P P Sbjct: 399 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 440 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPP P PPPP PPP P Sbjct: 410 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 441 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PP PP PPPP PPP P Sbjct: 411 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 442 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 421 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 452 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPP P PPPP PPP P Sbjct: 470 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 501 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PP PP PPPP PPP P Sbjct: 471 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 502 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 481 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 512 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPP P PPPP PPP P Sbjct: 519 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 550 Score = 34.3 bits (75), Expect = 4.4 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP P PPP + PP P P Sbjct: 193 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 234 Score = 34.3 bits (75), Expect = 4.4 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP P PPP + PP P P Sbjct: 198 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 239 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP PPPP PP P S P Sbjct: 241 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPP 282 Score = 34.3 bits (75), Expect = 4.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPP PPPP PPP P SP Sbjct: 265 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 302 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP PPPP PP P S P Sbjct: 298 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 339 Score = 34.3 bits (75), Expect = 4.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPP PPPP PPP P SP Sbjct: 322 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 359 Score = 34.3 bits (75), Expect = 4.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPP PPPP PPP P SP Sbjct: 366 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 403 Score = 34.3 bits (75), Expect = 4.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPP PPPP PPP P SP Sbjct: 480 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 517 Score = 33.9 bits (74), Expect = 5.8 Identities = 20/57 (35%), Positives = 23/57 (40%), Gaps = 3/57 (5%) Frame = -3 Query: 569 PPPXXXX*NPPPPXX---XXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPPP + PP P S P + PPP Sbjct: 311 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 367 Score = 33.9 bits (74), Expect = 5.8 Identities = 20/57 (35%), Positives = 23/57 (40%), Gaps = 3/57 (5%) Frame = -3 Query: 569 PPPXXXX*NPPPPXX---XXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPPP + PP P S P + PPP Sbjct: 355 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 411 Score = 33.9 bits (74), Expect = 5.8 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP PPPPP + PP P S P Sbjct: 414 PPPSPPPPSPPPPSP--PPPPPPSPPPPPPPSPPPPPPPSPP 453 Score = 33.9 bits (74), Expect = 5.8 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP + PP P S P Sbjct: 423 PPPPSP---PPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 461 Score = 33.9 bits (74), Expect = 5.8 Identities = 20/57 (35%), Positives = 23/57 (40%), Gaps = 3/57 (5%) Frame = -3 Query: 569 PPPXXXX*NPPPPXX---XXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPPP + PP P S P + PPP Sbjct: 469 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 525 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP PP P PPP P SP Sbjct: 237 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 268 Score = 33.5 bits (73), Expect = 7.7 Identities = 19/54 (35%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPPP + PP P P PPP Sbjct: 293 PPPSPPPPSPPPPSP--PPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 344 >UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|Rep: H0315A08.9 protein - Oryza sativa (Rice) Length = 168 Score = 38.7 bits (86), Expect = 0.20 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 35.1 bits (77), Expect = 2.5 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = -3 Query: 584 FXGXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPX 405 F PPP PPPP PPPPP PP P P PPP Sbjct: 11 FWRVDPPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP----PPPPPPPPP 66 Query: 404 N 402 N Sbjct: 67 N 67 >UniRef50_O23370 Cluster: Cell wall protein like; n=15; Magnoliophyta|Rep: Cell wall protein like - Arabidopsis thaliana (Mouse-ear cress) Length = 428 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 3/33 (9%) Frame = -2 Query: 591 PXFXXXPP---PPPXXXVKPPPPXXXXPPPXPF 502 P + PP PPP VKPPPP PPP P+ Sbjct: 78 PPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPY 110 Score = 37.9 bits (84), Expect = 0.36 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 5/37 (13%) Frame = -2 Query: 600 PXXPXFXXXPPPP-----PXXXVKPPPPXXXXPPPXP 505 P P + PPPP P VKPPPP PPP P Sbjct: 89 PPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPP 125 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPF 502 P P + PPPPP PPP PPP P+ Sbjct: 105 PPPPPYVK-PPPPPTVKPPPPPTPYTPPPPTPY 136 Score = 33.5 bits (73), Expect = 7.7 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 4/34 (11%) Frame = -2 Query: 600 PXXPXFXXXPPP----PPXXXVKPPPPXXXXPPP 511 P P PPP PP VKPPPP PPP Sbjct: 122 PPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPP 155 >UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein; n=2; Dictyostelium discoideum|Rep: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein - Dictyostelium discoideum (Slime mold) Length = 243 Score = 38.7 bits (86), Expect = 0.20 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 56 PPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 38.3 bits (85), Expect = 0.27 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PPPPP PPPP PPP P Sbjct: 61 APPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 57 PLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 60 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 103 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 107 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 108 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 107 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 55 PPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 103 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 105 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 108 Score = 33.9 bits (74), Expect = 5.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 104 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 106 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKK 468 PPP PPPP PPPPP PP ++ Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPSQE 111 >UniRef50_A7S7W0 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 575 Score = 38.7 bits (86), Expect = 0.20 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P + PPPP PPPP PPP P Sbjct: 534 NPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPP 566 >UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/Metazoa group|Rep: Cytokinesis protein sepA - Emericella nidulans (Aspergillus nidulans) Length = 1790 Score = 38.7 bits (86), Expect = 0.20 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP GGPP P P F G PPP Sbjct: 1042 PPPPGAGAAPPPPP---PPPPPPPGGLGGPPPPP---PPPPPGGFGGPPPPPPP 1089 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP PPPP PPP P G G P Sbjct: 1041 PPPPPGAGAAPPPPP---PPPPPPPGGLGGPP 1069 Score = 34.7 bits (76), Expect = 3.3 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 3/60 (5%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXX---XXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 G PPP PPP PPPPP GGPP P P F G PPP Sbjct: 1048 GAAPPPPPPPPPPPPGGLGGPPPPPPPPPPGGFGGPPP-----PPPPPGGFGGPPPPPPP 1102 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP + PPP PPP F G P Sbjct: 1057 PPPPPPGGLGGPPPPPPPPPPGGFGGPPPPPP 1088 >UniRef50_P13983 Cluster: Extensin precursor; n=1; Nicotiana tabacum|Rep: Extensin precursor - Nicotiana tabacum (Common tobacco) Length = 620 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P + PPPPP PPPP PPP P Sbjct: 456 SPPPPAYAQPPPPPPTY--SPPPPAYSPPPPSP 486 Score = 34.7 bits (76), Expect = 3.3 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPP 514 SP P + PPP P PPPP PP Sbjct: 299 SPPPPAYSPSPPPTPTPTFSPPPPAYSPPP 328 Score = 34.7 bits (76), Expect = 3.3 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -2 Query: 603 SPXXPXFXXXPPP--PPXXXVKPPPPXXXXPPPXP 505 SP P + PPP PP PPPP PP P Sbjct: 362 SPPPPTYLPPPPPSSPPPPSFSPPPPTYEQSPPPP 396 >UniRef50_Q6BSP4 Cluster: Branchpoint-bridging protein; n=2; Saccharomycetaceae|Rep: Branchpoint-bridging protein - Debaryomyces hansenii (Yeast) (Torulaspora hansenii) Length = 518 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPPPP + PPPP PP P G P Sbjct: 437 PPPPPSSLAPPPPPSSDIAPPPPSSDRAPPPPPSGIAPPPP 477 Score = 37.5 bits (83), Expect = 0.47 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 +P P PPPPP PPPP PPP Sbjct: 455 APPPPSSDRAPPPPPSGIAPPPPPSGIAPPP 485 Score = 37.1 bits (82), Expect = 0.62 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 G PPP PPPP PPPPP PP P + PPP Sbjct: 415 GLAPPPSSLAPPPPPPSSLAPPPPPPPSSLAPPPPPSSDIAPPPP----SSDRAPPP 467 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PPP P Sbjct: 447 PPPPSSDIAPPPPSSDRAPPPPPSGIAPPPPP 478 Score = 36.3 bits (80), Expect = 1.1 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPP + PP PL KN PPP Sbjct: 465 PPPPPSGIAPPPPPSGIAPPPPKSPNGVAPPPPPANDAPPAPL--STKNPPPPP 516 Score = 35.1 bits (77), Expect = 2.5 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPP + PP P P G PPP Sbjct: 428 PPPSSLAPPPPPPPSSLAPPPPPSSDIAPPPPSSDRAPPPPP---SGIAPPPPP 478 Score = 34.7 bits (76), Expect = 3.3 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPP--PXXXXPPPXP 505 +P P PPPPP PPP P PPP P Sbjct: 464 APPPPPSGIAPPPPPSGIAPPPPKSPNGVAPPPPP 498 Score = 33.5 bits (73), Expect = 7.7 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 +P P PPPP PPPP PP P G P Sbjct: 445 APPPPPSSDIAPPPPSSDRAPPPPPSGIAPPPPPSGIAPPPP 486 >UniRef50_Q9LI74 Cluster: Similarity to pherophorin; n=1; Arabidopsis thaliana|Rep: Similarity to pherophorin - Arabidopsis thaliana (Mouse-ear cress) Length = 1004 Score = 38.3 bits (85), Expect = 0.27 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDG 496 P P PPPPP PPPP PPP P G Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPPG 706 >UniRef50_A7QGU9 Cluster: Chromosome chr16 scaffold_94, whole genome shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome chr16 scaffold_94, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 341 Score = 38.3 bits (85), Expect = 0.27 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PPPPP PPPP PPP P Sbjct: 42 NPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 33.5 bits (73), Expect = 7.7 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLG 429 PPP PPPP PPPPP P P FF G Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPVKLIASIPFTWEEKPGKPLPFFSG 98 >UniRef50_A7RXK9 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 534 Score = 38.3 bits (85), Expect = 0.27 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP PPPP PPP P G P Sbjct: 307 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPP 338 Score = 37.1 bits (82), Expect = 0.62 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP PP + P PPP Sbjct: 308 PPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPP 361 Score = 36.7 bits (81), Expect = 0.83 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPP PPPPP GGPP P LG PPP Sbjct: 366 PPPPSMGMAPPPVGGAAPPPPP-PPPVGGPPPPPPPIEGRPP-SSLGNPPPPPP 417 Score = 33.9 bits (74), Expect = 5.8 Identities = 19/54 (35%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPP + PP P P +G PPP Sbjct: 349 PPPSRSSQRPPPPSRGAPPPPSMGM---APPPVGGAAPPPPPPPPVGGPPPPPP 399 Score = 33.5 bits (73), Expect = 7.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP +PP PPP P Sbjct: 386 PPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPP 417 >UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila melanogaster|Rep: Protein cappuccino - Drosophila melanogaster (Fruit fly) Length = 1059 Score = 38.3 bits (85), Expect = 0.27 Identities = 21/54 (38%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP G PP P P G + PPP Sbjct: 491 PPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPP----PPPPP----GSGSAPPP 536 Score = 35.5 bits (78), Expect = 1.9 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPPP PPPPPL PP P PL G PPP Sbjct: 485 PPPP----PPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPP 525 Score = 34.7 bits (76), Expect = 3.3 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPP V PPPP PPP P Sbjct: 490 PPPPLHAFVAPPPPPPPPPPPPP 512 Score = 34.7 bits (76), Expect = 3.3 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -2 Query: 618 LXLFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 L F +P P PPPPP PPP PPP P G P Sbjct: 494 LHAFVAPPPPPPPPPPPPPPLANYGAPPP---PPPPPPGSGSAPPPP 537 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP PPP PPP P G+P Sbjct: 489 PPPPPLHAFVAPPPPPPPPPPPPPPLANYGAP 520 >UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 394 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 273 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 277 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 278 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPP 279 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPP 280 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 256 PPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPP 287 Score = 37.5 bits (83), Expect = 0.47 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPL 441 PPP PPPP PPPPP PP P S PL Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPL 291 Score = 37.1 bits (82), Expect = 0.62 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P PPPPP PPPP PPP P Sbjct: 228 PQVQVVPPPPPPPPPPPPPPPPPPPPPPP 256 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 277 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPP 287 Score = 35.5 bits (78), Expect = 1.9 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPL 441 PPP PPPP PPPPP PP P PL Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPL 282 Score = 35.1 bits (77), Expect = 2.5 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP + PPPP PP P Sbjct: 255 PPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPP 286 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 226 PPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 275 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 278 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPP 279 Score = 33.9 bits (74), Expect = 5.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPP 280 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 276 Score = 33.9 bits (74), Expect = 5.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP 456 PPP PPPP PPPPP PP P Sbjct: 257 PPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLPLP 294 Score = 33.5 bits (73), Expect = 7.7 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PP PPPP PPPPP PP P P L PPP Sbjct: 227 PPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPP 280 Score = 33.5 bits (73), Expect = 7.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPP 285 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP P P P Sbjct: 254 PPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPP 285 >UniRef50_Q4RSI9 Cluster: Chromosome 13 SCAF15000, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 13 SCAF15000, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 307 Score = 37.9 bits (84), Expect = 0.36 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P F PPPPP PPPP PPP F SP Sbjct: 183 PLFPLFPPPPPPPPPPPFSPPPP--PSPPPSLFSPPPFFSP 221 Score = 37.5 bits (83), Expect = 0.47 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P F PPPPP PPPP PPP P Sbjct: 180 PPFPLFPLFPPPPPPP---PPPPFSPPPPPSP 208 Score = 34.7 bits (76), Expect = 3.3 Identities = 41/145 (28%), Positives = 46/145 (31%), Gaps = 5/145 (3%) Frame = -3 Query: 611 FFXPXFXXXFXGXXPPPXXXX*--NPP---PPXXXXPPPPPLTXXXGGPPXKKXXFPXSX 447 FF P F PPP +PP PP PPP PL PP P Sbjct: 143 FFPPLFFFFPFSFFPPPFPPSPPLSPPYFPPPPPLPPPPFPLFPLFPPPPP-----PPPP 197 Query: 446 PLFFLGKNNXPPPXNXXKXXXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXP 267 P F + PPP + P F L FF F P Sbjct: 198 PPF-----SPPPPPSPPPSLFSPPPFFSPPPSFPPLPPPPYFSPLPLPPFFLLPFLFPPP 252 Query: 266 PXXXFFXFXPPSPPFXXXSPPPXFF 192 P FF P+PP PPP F+ Sbjct: 253 P---FFFPPKPNPP---PPPPPGFY 271 Score = 34.3 bits (75), Expect = 4.4 Identities = 25/63 (39%), Positives = 25/63 (39%), Gaps = 3/63 (4%) Frame = -2 Query: 360 PPPF-PXXXXXFXXXFFXXNPFFXPX-FFXXXPPXXPFFXLX-PPFXPFLXXXPPPRXFF 190 PPPF P F PFF P F PP F L PPF PPP FF Sbjct: 197 PPPFSPPPPPSPPPSLFSPPPFFSPPPSFPPLPPPPYFSPLPLPPFFLLPFLFPPP-PFF 255 Query: 189 XPP 181 PP Sbjct: 256 FPP 258 Score = 33.5 bits (73), Expect = 7.7 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -2 Query: 600 PXXPXFXXXPPPP-PXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPPP P + PPPP PPP PF SP Sbjct: 169 PYFPPPPPLPPPPFPLFPLFPPPPPP--PPPPPFSPPPPPSP 208 >UniRef50_A2RV11 Cluster: FNBP4 protein; n=7; Danio rerio|Rep: FNBP4 protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 769 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 599 PLPPLPPEHPPPPPTEQPPPPPPPPESPPPPP 630 >UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 516 Score = 37.9 bits (84), Expect = 0.36 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPPP PP P L PPP Sbjct: 207 PPPSPPPPSPPPPPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPPPPPPP 260 Score = 36.3 bits (80), Expect = 1.1 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXF--PXSXPLFFLGKNNXPPP 408 PPP +PPPP P PPP + PP P S P + + PPP Sbjct: 95 PPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPP 150 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PPPP PPPP PPP P Sbjct: 196 TPPPPSASPSPPPPSPPPPSPPPPPPPPPPPPP 228 Score = 34.3 bits (75), Expect = 4.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPP PPPP P P P Sbjct: 186 SPSPPSSASPTPPPPSASPSPPPPSPPPPSPPP 218 Score = 33.5 bits (73), Expect = 7.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPP PPPP PPP P Sbjct: 72 PPPPSPPPPSPPPPSPPSPPPSP 94 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP 456 PPP +PPPP P PPP + PP P Sbjct: 90 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSP 127 >UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter litoralis HTCC2594|Rep: Autotransporter - Erythrobacter litoralis (strain HTCC2594) Length = 1819 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 1410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTP 1441 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 1414 PPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAP 1445 Score = 37.1 bits (82), Expect = 0.62 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXS 450 PPP PPPP PPPPP T PP P S Sbjct: 1417 PPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPPIS 1456 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 1409 PPPPPPPPPPPPPPPPPPPPPPP 1431 Score = 35.9 bits (79), Expect = 1.4 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 G PPP PPPP PPPPP PP P P Sbjct: 1406 GTAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPP 1450 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 +P P PPPPP PPPP PPP Sbjct: 1408 APPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1438 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PP P PPP P Sbjct: 1423 PPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPP 1454 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPL 441 PPP PPPP PPPPP PP P P+ Sbjct: 1413 PPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPPI 1455 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 1411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPP 1442 Score = 34.7 bits (76), Expect = 3.3 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXP 414 PPP PPPP PPPPP PP P P G P Sbjct: 1412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPPISSGTGLFP 1463 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP P P P Sbjct: 1412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPP 1443 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 1415 PPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPP 1446 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP P P P Sbjct: 1416 PPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPP 1447 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 1417 PPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPP 1448 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 1418 PPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPP 1449 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PP P PPP P Sbjct: 1419 PPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPP 1450 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP P PP PPP P Sbjct: 1420 PPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPP 1451 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 1421 PPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPP 1452 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 1422 PPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPP 1453 >UniRef50_Q0ANI5 Cluster: OmpA/MotB domain protein precursor; n=2; Hyphomonadaceae|Rep: OmpA/MotB domain protein precursor - Maricaulis maris (strain MCS10) Length = 359 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 F +P P PPPPP PPPP PPP Sbjct: 213 FAAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 245 Score = 37.5 bits (83), Expect = 0.47 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 585 FXXXPPPPPXXXVKPPPPXXXXPPPXP 505 F PPPPP PPPP PPP P Sbjct: 213 FAAPPPPPPPPPPPPPPPPPPPPPPPP 239 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 218 PPPPPPPPPPPPPPPPPPPPPPP 240 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 219 PPPPPPPPPPPPPPPPPPPPPPP 241 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 220 PPPPPPPPPPPPPPPPPPPPPPP 242 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 221 PPPPPPPPPPPPPPPPPPPPPPP 243 Score = 33.5 bits (73), Expect = 7.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP 456 PPP PPPP PPPPP P FP Sbjct: 216 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPACDDVSFP 253 >UniRef50_Q41645 Cluster: Extensin; n=1; Volvox carteri|Rep: Extensin - Volvox carteri Length = 464 Score = 37.9 bits (84), Expect = 0.36 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP PPPPP PP + P P Sbjct: 273 PPPPRVPPSPPPPVASPPPPPPPRVSPSPPPPQPVSSPPPPP 314 Score = 37.5 bits (83), Expect = 0.47 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PP P Sbjct: 281 SPPPPVASPPPPPPPRVSPSPPPPQPVSSPPPP 313 Score = 37.1 bits (82), Expect = 0.62 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 L SP P PPPPP PPPP PPP P Sbjct: 261 LTASPPLPK--TSPPPPPRVPPSPPPPVASPPPPPP 294 Score = 37.1 bits (82), Expect = 0.62 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 SP P PPPPP PPPP PPP Sbjct: 356 SPSPPPPVVSPPPPPPRASPPPPPASSPPPP 386 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P P PPP PPPP PPP P Sbjct: 347 SPSPPPPRSSPSPPPPVVSPPPPPPRASPPPPP 379 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 303 PPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPP 334 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP +PPPP PPPPP PP Sbjct: 366 PPPPPPRASPPPPPASSPPPPPRPPPPSPPP 396 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPP-PXXXXPPPXP 505 SP P PPPPP PPP P PPP P Sbjct: 365 SPPPPPPRASPPPPPASSPPPPPRPPPPSPPPSP 398 Score = 34.3 bits (75), Expect = 4.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPP PPPP PP P Sbjct: 321 SPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPP 353 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP 456 PPP +PPPP PPPP PP + P Sbjct: 313 PPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSP 350 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP 456 PPP +PPPP P PPP PP + P Sbjct: 322 PPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSP 359 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P PPPPP PPPP PPP P Sbjct: 361 PPVVSPPPPPP--RASPPPPPASSPPPPP 387 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPP PPPP P P P Sbjct: 271 SPPPPPRVPPSPPPPVASPPPPPPPRVSPSPPP 303 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPP PPPP PP P Sbjct: 330 SPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPP 362 Score = 33.5 bits (73), Expect = 7.7 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP +PPPP PPPP+ PP Sbjct: 341 PPPPRPSPSPPPPRSSPSPPPPVVSPPPPPP 371 Score = 33.5 bits (73), Expect = 7.7 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PP PPPP PPPPP + P P S P N P P Sbjct: 359 PPPPVVSPPPPPPRASPPPPPASSPPPPPRPPPPSPPPSPPPPATAAANPPSP 411 >UniRef50_Q2QNA7 Cluster: Exostosin family protein, expressed; n=2; Oryza sativa|Rep: Exostosin family protein, expressed - Oryza sativa subsp. japonica (Rice) Length = 526 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDG 496 PPPPP PPPP PPP P G Sbjct: 64 PPPPPIIDASPPPPSTSPPPPPPRRG 89 >UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukaryota|Rep: Predicted membrane protein - Ostreococcus tauri Length = 1449 Score = 37.9 bits (84), Expect = 0.36 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 SP P PPPPP P PP PPP P SP Sbjct: 798 SPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSP 839 Score = 36.7 bits (81), Expect = 0.83 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPP P T PP P S P PPP Sbjct: 799 PPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPP 852 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 791 PPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSP 832 Score = 35.1 bits (77), Expect = 2.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P P PPP PPPP PPP P Sbjct: 863 PPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSP 894 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PPP P Sbjct: 789 PSPPPPLPPSPPPPPSPPPPPPPPSPPPPPNP 820 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 796 PPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPP 827 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP P PP PPP P Sbjct: 847 PPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSP 878 Score = 34.3 bits (75), Expect = 4.4 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 817 PPNPPTPPSPPPPP----SPPPPPSSPPPPSP 844 >UniRef50_A5BAX2 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 131 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP G PP Sbjct: 20 PPPHNPLVPPPPPDHPLPPPPPKCSSTGAPP 50 Score = 35.1 bits (77), Expect = 2.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPP V PPPP PPP P Sbjct: 19 PPPPHNPLVPPPPPDHPLPPPPP 41 >UniRef50_A3CIN4 Cluster: Putative uncharacterized protein; n=1; Oryza sativa (japonica cultivar-group)|Rep: Putative uncharacterized protein - Oryza sativa subsp. japonica (Rice) Length = 454 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDG 496 PPPPP PPPP PPP P G Sbjct: 64 PPPPPIIDASPPPPSTSPPPPPPRRG 89 >UniRef50_Q7YYP6 Cluster: Hydroxyproline-rich glycoprotein dz-hrgp, probable; n=4; Eukaryota|Rep: Hydroxyproline-rich glycoprotein dz-hrgp, probable - Cryptosporidium parvum Length = 832 Score = 37.9 bits (84), Expect = 0.36 Identities = 21/55 (38%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLT-XXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP + PP P P F G+ PPP Sbjct: 601 PPPSEELPPPPPPSEELPPPPPPSEELPPPPPPSSGELPPPLPPSF-GELPLPPP 654 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPP--XXXXPPPXPFDG 496 P P PPPPP + PPPP PPP P G Sbjct: 600 PPPPSEELPPPPPPSEELPPPPPPSEELPPPPPPSSG 636 Score = 35.1 bits (77), Expect = 2.5 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPL G P P PL PPP Sbjct: 620 PPPPSEELPPPPPPSSGELPPPLPPSFGELPLPPPPPPLEEPLSSPSDEPLPPP 673 Score = 34.3 bits (75), Expect = 4.4 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPP--XXXXPPPXP 505 P P PPPPP + PPPP PPP P Sbjct: 610 PPPPSEELPPPPPPSEELPPPPPPSSGELPPPLP 643 Score = 33.9 bits (74), Expect = 5.8 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P PPPP PPPPP + PP P P PPP Sbjct: 591 PLPLPEELPPPPPSEELPPPPPPSEELPPPPPPSEELPPPPP---PSSGELPPP 641 Score = 33.5 bits (73), Expect = 7.7 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP + PPPP PP P Sbjct: 599 PPPPPSEELPPPPPPSEELPPPP 621 >UniRef50_Q54WZ5 Cluster: Slob family protein kinase; n=1; Dictyostelium discoideum AX4|Rep: Slob family protein kinase - Dictyostelium discoideum AX4 Length = 574 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXG 484 PPPPP PPPP PP P DG G Sbjct: 516 PPPPPKSSGPPPPPPPKSSPPPPADGSRKG 545 >UniRef50_Q4QAM2 Cluster: Formin, putative; n=3; Leishmania|Rep: Formin, putative - Leishmania major Length = 1193 Score = 37.9 bits (84), Expect = 0.36 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 +P P PPPPP + PP P PPP P G P Sbjct: 631 APPPPGGLPPPPPPPGKLLPPPAPPSKLPPPRPPPAPPAGLP 672 >UniRef50_A2FMX2 Cluster: DnaK protein; n=2; Trichomonas vaginalis G3|Rep: DnaK protein - Trichomonas vaginalis G3 Length = 915 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 859 PPPPPHDDIPPPPPRPEDIPPPPPHDIPPPPP 890 Score = 37.5 bits (83), Expect = 0.47 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP + PPPP PPP P Sbjct: 878 PPPPPHDIPPPPPRPEDIPPPPPHEDVPPPPP 909 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/26 (53%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXX-XXPPPXPFD 499 PPPPP + PPPP PPP P D Sbjct: 859 PPPPPHDDIPPPPPRPEDIPPPPPHD 884 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP + P P Sbjct: 869 PPPPRPEDIPPPPPHDIPPPPPRPEDIPPPPPHEDVPPPPPP 910 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFD 499 P P PPPPP PPP PPP P + Sbjct: 869 PPPPRPEDIPPPPPHDIPPPPPRPEDIPPPPPHE 902 >UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.220; n=1; Neurospora crassa|Rep: Putative uncharacterized protein 15E6.220 - Neurospora crassa Length = 1992 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 44 PPPPPPPASPPPPPPPPPPPPPPPPPPPPPEP 75 Score = 37.5 bits (83), Expect = 0.47 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 43 PPPPPPPPASPPPPPPPPPPPPP 65 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP P P P Sbjct: 46 PPPPPASPPPPPPPPPPPPPPPPPPPPPEPEP 77 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP P P P Sbjct: 50 PASPPPPPPPPPPPPPPPPPPPPPEPEPQPAP 81 Score = 33.9 bits (74), Expect = 5.8 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PPPPP PPPP PPP P Sbjct: 1941 APPRPPTLAPPPPPP-----PPPPTEDPPPPPP 1968 Score = 33.5 bits (73), Expect = 7.7 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 5/37 (13%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVK-----PPPPXXXXPPPXP 505 P P PPPPP + PPPP PPP P Sbjct: 1943 PRPPTLAPPPPPPPPPPTEDPPPPPPPPPAEAPPPPP 1979 >UniRef50_Q2GNY9 Cluster: Putative uncharacterized protein; n=2; Sordariomycetes|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 813 Score = 37.9 bits (84), Expect = 0.36 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDG 496 PPPPP PPPP PPP P G Sbjct: 393 PPPPPSEAAPPPPPPSAAPPPPPPSG 418 Score = 36.7 bits (81), Expect = 0.83 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PPPPP PPPP PP P Sbjct: 382 APGAPGASASPPPPPPSEAAPPPPPPSAAPPPP 414 >UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Human herpesvirus 4|Rep: Epstein-Barr nuclear antigen 2 - Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) Length = 487 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPP 94 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPP 95 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 96 Score = 37.9 bits (84), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 97 Score = 37.5 bits (83), Expect = 0.47 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P PPPPP PPPP PPP P Sbjct: 60 PPLPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPPP PPPP PPP Sbjct: 71 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 100 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 60 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPP 91 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP P P P Sbjct: 61 PLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPP 92 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 98 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PP P PPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 99 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP P PP PPP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 100 Score = 34.3 bits (75), Expect = 4.4 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP + PP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 96 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 97 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPSPPPP 93 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPSPPPPP 94 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPSPPPPPP 95 >UniRef50_UPI0000F1F796 Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 1493 Score = 37.5 bits (83), Expect = 0.47 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P PPPPP V PPPP PPP Sbjct: 868 PPLQAVPPPPPPQAVPPPPPQAVPPPP 894 Score = 35.9 bits (79), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXP 505 PPPP V PPPP PPP P Sbjct: 866 PPPPLQAVPPPPPPQAVPPPPP 887 Score = 33.9 bits (74), Expect = 5.8 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPPP V PPPP PPP Sbjct: 874 PPPPPPQAVPPPPPQA-VPPPPPQAVPPPP 902 Score = 33.5 bits (73), Expect = 7.7 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPP 511 PPPP V PPPP PPP Sbjct: 850 PPPPPQAVPPPPPQAVPPPP 869 >UniRef50_UPI0000D56EFA Cluster: PREDICTED: similar to Protein cappuccino; n=1; Tribolium castaneum|Rep: PREDICTED: similar to Protein cappuccino - Tribolium castaneum Length = 1011 Score = 37.5 bits (83), Expect = 0.47 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP V PPPP P P P Sbjct: 519 PPMPGTGPPPPPPPMGGVPPPPPPMGGPVPLP 550 Score = 34.3 bits (75), Expect = 4.4 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXX---PPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP+ PP P G PPP Sbjct: 463 PPPMPGIGAPPPPPMPGIGAPPPPPMPGIGAHPPPPMPGIVGPPPPPMPGIGGPPPP 519 Score = 34.3 bits (75), Expect = 4.4 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPP---PXXXXPPPXPFDGXXXGSP 478 P P PPPP V PPP P PPP P G P Sbjct: 486 PPMPGIGAHPPPPMPGIVGPPPPPMPGIGGPPPPPMPGTGPPPP 529 >UniRef50_UPI000069F679 Cluster: Survival motor neuron protein (Component of gems 1) (Gemin-1).; n=1; Xenopus tropicalis|Rep: Survival motor neuron protein (Component of gems 1) (Gemin-1). - Xenopus tropicalis Length = 222 Score = 37.5 bits (83), Expect = 0.47 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFD 499 PPPPP PPPP PPP P D Sbjct: 173 PPPPPPPPPPPPPPPSLPPPPPPKD 197 >UniRef50_UPI0000F30E84 Cluster: UPI0000F30E84 related cluster; n=1; Bos taurus|Rep: UPI0000F30E84 UniRef100 entry - Bos Taurus Length = 921 Score = 37.5 bits (83), Expect = 0.47 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP + PPPP PPP P Sbjct: 777 PPPPPPLALPPPPPPPPPPPPPP 799 Score = 36.7 bits (81), Expect = 0.83 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 776 PPPPPPPLALPPPPPPPPPPPPP 798 Score = 34.3 bits (75), Expect = 4.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGP 480 PPP PPPP PPPPPL P Sbjct: 778 PPPPPLALPPPPPPPPPPPPPPLPPSHPNP 807 Score = 33.5 bits (73), Expect = 7.7 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP + PPP PPP P Sbjct: 775 PPPPPPPPLALPPPPPPPPPPPP 797 >UniRef50_Q9Q5L3 Cluster: EBNA-2; n=2; Cercopithecine herpesvirus 15|Rep: EBNA-2 - Cercopithecine herpesvirus 15 (Rhesus lymphocryptovirus) Length = 605 Score = 37.5 bits (83), Expect = 0.47 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP + PPPP PPP P Sbjct: 66 PPPPPPPPLPPPPPPPLPPPPPP 88 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 67 PPPPPPPLPPPPPPPLPPPPPPP 89 Score = 35.9 bits (79), Expect = 1.4 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 65 PPPPPPPPPLPPPPPPPLPPPPP 87 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPPP PPPP PPP Sbjct: 66 PPPPPPPPLPPPPPPPLPPPPPPPVQPPPP 95 Score = 34.3 bits (75), Expect = 4.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P PPPPP PPPP PPP Sbjct: 62 PGAPPPPPPPPPLPPPPPPPLPPPPPP 88 >UniRef50_Q91TI4 Cluster: T117; n=1; Tupaiid herpesvirus 1|Rep: T117 - Tupaiid herpesvirus 1 (strain 1) (TuHV-1) (Herpesvirus tupaia (strain1)) Length = 393 Score = 37.5 bits (83), Expect = 0.47 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXPFDG 496 P PP PPPP PPP PFDG Sbjct: 50 PIPPVCTTTPPPPPPPPPPPPPFDG 74 >UniRef50_Q4JY15 Cluster: Putative secreted protein precursor; n=1; Corynebacterium jeikeium K411|Rep: Putative secreted protein precursor - Corynebacterium jeikeium (strain K411) Length = 255 Score = 37.5 bits (83), Expect = 0.47 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP + PPPP P P P Sbjct: 44 PPPPPLPDLPPPPPLPDLPPPPPLPDLPAPPP 75 Score = 37.1 bits (82), Expect = 0.62 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPPL PP Sbjct: 45 PPPPLPDLPPPPPLPDLPPPPPLPDLPAPPP 75 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPPP PPPPPL PP P P Sbjct: 45 PPPPLPDLPPPPPLPDLPPPPPLPDLPAPPPPP 77 >UniRef50_A6APN4 Cluster: Insecticidal toxin, SepC/Tcc class; n=2; Vibrio harveyi|Rep: Insecticidal toxin, SepC/Tcc class - Vibrio harveyi HY01 Length = 378 Score = 37.5 bits (83), Expect = 0.47 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP G PP Sbjct: 86 PPPRMAPPPPPPPAGGMPPPPPPPMGGGAPP 116 Score = 35.9 bits (79), Expect = 1.4 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPP---XXXXPPPXPFDGXXXGSP 478 P P PPPPP + PPPP PPP P G P Sbjct: 85 PPPPRMAPPPPPPPAGGMPPPPPPPMGGGAPPPPPGPGAPPPPP 128 Score = 34.3 bits (75), Expect = 4.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP PPPP PP P G+P Sbjct: 84 PPPPPRMAPPPPPPPAGGMPPPPPPPMGGGAP 115 >UniRef50_A0R2X6 Cluster: Putative uncharacterized protein; n=2; Mycobacterium|Rep: Putative uncharacterized protein - Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) Length = 377 Score = 37.5 bits (83), Expect = 0.47 Identities = 21/57 (36%), Positives = 23/57 (40%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 G PPP PPPP PPPPP PP + +P P G PPP Sbjct: 51 GGYPPPPPPGGYPPPPQGGFPPPPP-GGYPPPPPPQGGSYPPPPP---PGAAGYPPP 103 Score = 36.7 bits (81), Expect = 0.83 Identities = 18/48 (37%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = -3 Query: 545 NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFF--LGKNNXPPP 408 NPPPP PPPPP PP +P + P F + PPP Sbjct: 9 NPPPPDGGYPPPPPPDGGYPPPPPPDGGYPPAQPGGFGPPPQGGYPPP 56 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDG 496 PPPP PPPP PPP P DG Sbjct: 10 PPPPDGGYPPPPPPDGGYPPPPPPDG 35 Score = 34.7 bits (76), Expect = 3.3 Identities = 21/57 (36%), Positives = 22/57 (38%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 G PP PPP PPPPP G PP + FP P G PPP Sbjct: 35 GGYPPAQPGGFGPPPQGGYPPPPPP----GGYPPPPQGGFPPPPP----GGYPPPPP 83 >UniRef50_Q9LQZ8 Cluster: F10A5.23; n=1; Arabidopsis thaliana|Rep: F10A5.23 - Arabidopsis thaliana (Mouse-ear cress) Length = 167 Score = 37.5 bits (83), Expect = 0.47 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXGXKK 610 G GGG GGGG+ GGGGG K G G K Sbjct: 80 GGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGK 114 >UniRef50_Q6H7U3 Cluster: Putative formin I2I isoform; n=2; Oryza sativa|Rep: Putative formin I2I isoform - Oryza sativa subsp. japonica (Rice) Length = 881 Score = 37.5 bits (83), Expect = 0.47 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P PPPPP PPPP PPP P Sbjct: 349 PKLMPPPPPPPPPPPPPPPPPPPRPPPPP 377 Score = 37.5 bits (83), Expect = 0.47 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP G PP Sbjct: 356 PPPPPPPPPPPPPPPPRPPPPPPPIKKGAPP 386 Score = 36.3 bits (80), Expect = 1.1 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP KK P + P Sbjct: 353 PPPPP----PPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAPP 390 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 356 PPPPPPPPPPPPPPPPRPPPPPP 378 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 357 PPPPPPPPPPPPPPPRPPPPPPP 379 Score = 34.3 bits (75), Expect = 4.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP PPPP PP P G+P Sbjct: 354 PPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAP 385 Score = 34.3 bits (75), Expect = 4.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP PPPP PPP G +P Sbjct: 358 PPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAP 389 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 358 PPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAP 389 >UniRef50_Q10R38 Cluster: Transposon protein, putative, CACTA, En/Spm sub-class; n=2; Oryza sativa|Rep: Transposon protein, putative, CACTA, En/Spm sub-class - Oryza sativa subsp. japonica (Rice) Length = 209 Score = 37.5 bits (83), Expect = 0.47 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 89 PPPPPPPAASPPPPPPSPPPPSP 111 Score = 37.1 bits (82), Expect = 0.62 Identities = 20/54 (37%), Positives = 24/54 (44%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPPP PP P P+ K++ PPP Sbjct: 74 PPPPSVTSSPPPPPLPPPPPPP----AASPPPPPPSPPPPSPV----KSSPPPP 119 Score = 36.7 bits (81), Expect = 0.83 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 73 PPPPPSVTSSPPPPPLPPPPPPP 95 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 L P P PPPP PPPP PPP P Sbjct: 69 LMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPP 104 >UniRef50_A7Q9D7 Cluster: Chromosome chr19 scaffold_66, whole genome shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome chr19 scaffold_66, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 937 Score = 37.5 bits (83), Expect = 0.47 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 F P P PPPPP + PPPP PP P Sbjct: 563 FTIPPPPGEEWIPPPPPDNEIIPPPPPPPDEPPEP 597 >UniRef50_A7DWG3 Cluster: Cell wall glycoprotein GP2; n=4; Chlamydomonas reinhardtii|Rep: Cell wall glycoprotein GP2 - Chlamydomonas reinhardtii Length = 1226 Score = 37.5 bits (83), Expect = 0.47 Identities = 18/54 (33%), Positives = 20/54 (37%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP P PPP PP P P + PPP Sbjct: 974 PPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSPPPPSPPPAAASPPPSPPPP 1027 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P P PPP P PP PPP P Sbjct: 966 SPPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVP 998 >UniRef50_Q7Z152 Cluster: Collagen protein 51; n=4; Caenorhabditis|Rep: Collagen protein 51 - Caenorhabditis elegans Length = 435 Score = 37.5 bits (83), Expect = 0.47 Identities = 17/39 (43%), Positives = 19/39 (48%) Frame = +2 Query: 485 PXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 P P+ G GGG +GGGG GGGGG G G Sbjct: 314 PPRTPAGGGGGGDFPAGGGGGGYSTGGGGGRADSGGAAG 352 >UniRef50_Q57ZF9 Cluster: Putative uncharacterized protein; n=1; Trypanosoma brucei|Rep: Putative uncharacterized protein - Trypanosoma brucei Length = 708 Score = 37.5 bits (83), Expect = 0.47 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P F PPPPP + PP PPP P Sbjct: 186 PKPPEFGAVPPPPPAAAIPKPPEFGAVPPPPP 217 Score = 37.5 bits (83), Expect = 0.47 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P F PPPPP + PP PPP P Sbjct: 204 PKPPEFGAVPPPPPAASIPKPPEFGAVPPPPP 235 Score = 37.5 bits (83), Expect = 0.47 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P F PPPPP + PP PPP P Sbjct: 222 PKPPEFGAVPPPPPAASIPKPPEFGAVPPPPP 253 Score = 37.5 bits (83), Expect = 0.47 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P F PPPPP + PP PPP P Sbjct: 240 PKPPEFGAVPPPPPAAAIPKPPEFGAVPPPPP 271 Score = 37.5 bits (83), Expect = 0.47 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P F PPPPP + PP PPP P Sbjct: 258 PKPPEFGAVPPPPPVAAIPKPPEFGAVPPPPP 289 Score = 37.5 bits (83), Expect = 0.47 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P F PPPPP + PP PPP P Sbjct: 276 PKPPEFGAVPPPPPAASIPKPPEFGAVPPPPP 307 Score = 37.5 bits (83), Expect = 0.47 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P F PPPPP + PP PPP P Sbjct: 294 PKPPEFGAVPPPPPAAAIPKPPEFGAVPPPPP 325 >UniRef50_Q03173 Cluster: Protein enabled homolog; n=18; Euteleostomi|Rep: Protein enabled homolog - Mus musculus (Mouse) Length = 802 Score = 37.5 bits (83), Expect = 0.47 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGS 481 PPPPP PPPP PP P G GS Sbjct: 583 PPPPPLPNQAPPPPPPPPAPPLPASGIFSGS 613 Score = 34.3 bits (75), Expect = 4.4 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNN 420 G PPP PPPP PPPPPL PP P F G + Sbjct: 566 GPPPPPPLPSTGPPPPP---PPPPPLPNQAPPPPPPPPAPPLPASGIFSGSTS 615 Score = 33.5 bits (73), Expect = 7.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXP 505 PPPP PPPP PPP P Sbjct: 442 PPPPPPPPPPPPPPPLPPPPLP 463 >UniRef50_O60610 Cluster: Protein diaphanous homolog 1; n=43; Euteleostomi|Rep: Protein diaphanous homolog 1 - Homo sapiens (Human) Length = 1248 Score = 37.5 bits (83), Expect = 0.47 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPP P PPPP PPP P G SP Sbjct: 589 PPPAPGDSTTPPPPPPPPPPPPPLPGGTAISP 620 Score = 37.1 bits (82), Expect = 0.62 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXX---VKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPPPP + PPPP PPP PF +P Sbjct: 697 PPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAP 740 >UniRef50_UPI00015B5B2E Cluster: PREDICTED: similar to ENSANGP00000010144; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to ENSANGP00000010144 - Nasonia vitripennis Length = 483 Score = 37.1 bits (82), Expect = 0.62 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 183 PPPPPPAAAAPPPPSHAPPPPPP 205 Score = 33.9 bits (74), Expect = 5.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPP PPP P Sbjct: 184 PPPPPAAAAPPPPSHAPPPPPPP 206 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 184 PPPPPAAAAPPPPSHAPPPPPPPPASAPPPP 214 >UniRef50_UPI0000DB6FB3 Cluster: PREDICTED: similar to plexus CG4444-PA; n=1; Apis mellifera|Rep: PREDICTED: similar to plexus CG4444-PA - Apis mellifera Length = 2310 Score = 37.1 bits (82), Expect = 0.62 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 1230 PPPPPPTVAPPPPPPPPPPPPPP 1252 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 1231 PPPPPTVAPPPPPPPPPPPPPPP 1253 >UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 2873 Score = 37.1 bits (82), Expect = 0.62 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 F SP P PPPPP PPPP PPP P Sbjct: 202 FPSPPPP-----PPPPPLPPPPPPPPPPSPPPPSP 231 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPP P PPPP PPP P Sbjct: 225 SPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPP 257 Score = 36.3 bits (80), Expect = 1.1 Identities = 20/54 (37%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP P PPP T PP P S P + PPP Sbjct: 2258 PPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTP-PPSPPPPSPPPPSPPPP 2310 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPPP PPPP PPP Sbjct: 207 PPPPPPPLPPPPPPPPPPSPPPPSPPPPPP 236 Score = 35.1 bits (77), Expect = 2.5 Identities = 19/54 (35%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP P PPP + PP P S P + PPP Sbjct: 2708 PPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPP 2760 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 206 PPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPP 237 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 208 PPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSP 239 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPP P PPPP PPP P Sbjct: 213 PLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSP 244 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P P PPP PPPP PPP P Sbjct: 228 PPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPP 259 Score = 34.7 bits (76), Expect = 3.3 Identities = 19/54 (35%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP P PPP + PP P S P + PPP Sbjct: 2689 PPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPP--PPSPPPPSPPPPSPPPP 2740 Score = 34.3 bits (75), Expect = 4.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PPP P Sbjct: 1183 PPSPPPPPSPPPPSPPPPLPPPPSPPPPPPLP 1214 Score = 34.3 bits (75), Expect = 4.4 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP P PPP PP P P Sbjct: 2546 PPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSPPPYP 2587 Score = 34.3 bits (75), Expect = 4.4 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP P PPP + PP P P Sbjct: 2728 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPP 2769 Score = 33.9 bits (74), Expect = 5.8 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = -3 Query: 584 FXGXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 F PPP PPPP P PPP + PP P P Sbjct: 202 FPSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPP 248 Score = 33.9 bits (74), Expect = 5.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 SP P PPPP PPPP PP P SP Sbjct: 2266 SPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSP 2307 Score = 33.5 bits (73), Expect = 7.7 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP PPPPP + PP P P Sbjct: 217 PPPPPPPPSPPPPSP--PPPPPPSPPPPSPPPPPPPSPPPPP 256 Score = 33.5 bits (73), Expect = 7.7 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P P PPP PPPP PPP Sbjct: 220 PPPPPSPPPPSPPPPPPPSPPPPSPPPPPP 249 Score = 33.5 bits (73), Expect = 7.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 SP P PPPP PPP PPP P SP Sbjct: 2261 SPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSP 2302 Score = 33.5 bits (73), Expect = 7.7 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPP-PPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP PP PPP + PP P P Sbjct: 2277 PPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPPPSQPP 2319 Score = 33.5 bits (73), Expect = 7.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP P P P Sbjct: 2287 PPPPPTPPPSPPPPSPPPPSPPP 2309 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPP PPPP P P P Sbjct: 2697 SPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPP 2729 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPP PPPP P P P Sbjct: 2707 SPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPP 2739 >UniRef50_Q5XHX3 Cluster: Enabled homolog; n=5; Tetrapoda|Rep: Enabled homolog - Rattus norvegicus (Rat) Length = 526 Score = 37.1 bits (82), Expect = 0.62 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGS 481 PPPPP PPPP PP P G GS Sbjct: 307 PPPPPLPNQVPPPPPPPPAPPLPASGIFSGS 337 Score = 33.9 bits (74), Expect = 5.8 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 G PPP PPPP PPPPPL PP Sbjct: 290 GPPPPPPLPSAGPPPPP---PPPPPLPNQVPPPP 320 >UniRef50_Q0M671 Cluster: Glycoside hydrolase, family 16:Hemolysin-type calcium-binding region; n=1; Caulobacter sp. K31|Rep: Glycoside hydrolase, family 16:Hemolysin-type calcium-binding region - Caulobacter sp. K31 Length = 608 Score = 37.1 bits (82), Expect = 0.62 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 SP P PPPPP PPPP PPP Sbjct: 467 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 >UniRef50_Q0C0P5 Cluster: OmpA family protein; n=1; Hyphomonas neptunium ATCC 15444|Rep: OmpA family protein - Hyphomonas neptunium (strain ATCC 15444) Length = 387 Score = 37.1 bits (82), Expect = 0.62 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -2 Query: 618 LXLFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 L L S P PPPPP PPPP PPP P Sbjct: 222 LGLRYSFAAPPAPPPPPPPPPPPPPPPPPPPPPPPPPP 259 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPEETTPP 265 >UniRef50_A4T9C9 Cluster: Integral membrane protein-like protein; n=1; Mycobacterium gilvum PYR-GCK|Rep: Integral membrane protein-like protein - Mycobacterium gilvum PYR-GCK Length = 335 Score = 37.1 bits (82), Expect = 0.62 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPPP PPPP PPP P G P Sbjct: 11 PPPPQGGYPPPPPSEGGYPPPPPEGGYPPPPPAGGYQQPPP 51 Score = 33.9 bits (74), Expect = 5.8 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPPP + PPP PPP Sbjct: 29 PPPPPEGGYPPPPPAGGYQQPPPGGAYPPP 58 >UniRef50_A3PW04 Cluster: U5 snRNP spliceosome subunit-like protein precursor; n=5; Mycobacterium|Rep: U5 snRNP spliceosome subunit-like protein precursor - Mycobacterium sp. (strain JLS) Length = 137 Score = 37.1 bits (82), Expect = 0.62 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 88 PPPPPPPGAPPPPPPPPPPPPPP 110 Score = 35.9 bits (79), Expect = 1.4 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 87 PPPPPPPPGAPPPPPPPPPPPPP 109 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPPP PPPP PPP Sbjct: 88 PPPPPPPGAPPPPPPPPPPPPPPVYVPPPP 117 >UniRef50_A5B045 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 410 Score = 37.1 bits (82), Expect = 0.62 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 +P P + PPPP PPP PPP + G P Sbjct: 319 APPPPTYGAAPPPPTYGAAPPPPTYGAAPPPPSYGAYAYGEP 360 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 F P F PPPP PPPP PP P G P Sbjct: 298 FYGAAPPPFHGVAPPPPTYGAAPPPPTYGAAPPPPTYGAAPPPP 341 Score = 33.5 bits (73), Expect = 7.7 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPF 502 +P P + PPPP PPP PPP + Sbjct: 310 APPPPTYGAAPPPPTYGAAPPPPTYGAAPPPPTY 343 >UniRef50_Q4R8N9 Cluster: Testis cDNA clone: QtsA-11950, similar to human diaphanous homolog 1 (Drosophila) (DIAPH1),; n=4; Eutheria|Rep: Testis cDNA clone: QtsA-11950, similar to human diaphanous homolog 1 (Drosophila) (DIAPH1), - Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey) Length = 504 Score = 37.1 bits (82), Expect = 0.62 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXX---VKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPPPP + PPPP PPP PF +P Sbjct: 6 PPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGASAAP 49 >UniRef50_Q61UQ5 Cluster: Putative uncharacterized protein CBG05197; n=1; Caenorhabditis briggsae|Rep: Putative uncharacterized protein CBG05197 - Caenorhabditis briggsae Length = 219 Score = 37.1 bits (82), Expect = 0.62 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP +PPPP PPP P Sbjct: 137 PPPPPPPQRRPPPPPHHRPPPPP 159 Score = 33.5 bits (73), Expect = 7.7 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP +PPPP PPP P Sbjct: 155 PPPPPGY--RPPPPSYYPPPPLP 175 >UniRef50_Q5C200 Cluster: SJCHGC08716 protein; n=1; Schistosoma japonicum|Rep: SJCHGC08716 protein - Schistosoma japonicum (Blood fluke) Length = 192 Score = 37.1 bits (82), Expect = 0.62 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP + PPPP PP P Sbjct: 78 PPPPLMGVVPPPPPMMGLPPPPPLMKGVPPPP 109 Score = 36.7 bits (81), Expect = 0.83 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -3 Query: 602 PXFXXXFXGXXPPPXXXX*NPPPPXX-XXPPPPPLTXXXGGPPXKKXXFP 456 P F G PPP PPPP PPPPP+ PP K P Sbjct: 58 PPFPTSSIGIPPPPMGSGIPPPPPLMGVVPPPPPMMGLPPPPPLMKGVPP 107 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP V PPPP PP P Sbjct: 68 PPPPMGSGIPPPPPLMGVVPPPPPMMGLPPPP 99 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPPL PP Sbjct: 79 PPPLMGVVPPPPPMMGLPPPPPLMKGVPPPP 109 >UniRef50_A2E6V2 Cluster: WH2 motif family protein; n=3; Trichomonas vaginalis G3|Rep: WH2 motif family protein - Trichomonas vaginalis G3 Length = 422 Score = 37.1 bits (82), Expect = 0.62 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 F SP PPPPP PPPP PPP DG +P Sbjct: 277 FASPGAAPAAAAPPPPPPPP--PPPPPGGLPPPPKTDGPGSKAP 318 >UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_53, whole genome shotgun sequence - Paramecium tetraurelia Length = 1117 Score = 37.1 bits (82), Expect = 0.62 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPP P + PPP PPP P G G P Sbjct: 541 PPPPPPPPPPPPLPGQHKQTPPPPPPPPPPPPLPGQKTGPP 581 Score = 33.9 bits (74), Expect = 5.8 Identities = 23/60 (38%), Positives = 25/60 (41%), Gaps = 6/60 (10%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGP------PXKKXXFPXSXPLFFLGKNNXPPP 408 P P PPPP PPPPPL GP P +K P PL G+ PPP Sbjct: 552 PLPGQHKQTPPPPPP-PPPPPPLPGQKTGPPPPPPLPGQKAGPPPPPPL--PGQKTGPPP 608 Score = 33.5 bits (73), Expect = 7.7 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP K PP PPP P G G+P Sbjct: 594 PPPPPLPGQKTGPPP---PPPPPLPGQKAGAP 622 >UniRef50_A0D550 Cluster: Chromosome undetermined scaffold_38, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_38, whole genome shotgun sequence - Paramecium tetraurelia Length = 493 Score = 37.1 bits (82), Expect = 0.62 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 370 PPPPPPKGAPPPPPPPPPPPPPP 392 Score = 35.9 bits (79), Expect = 1.4 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 369 PPPPPPPKGAPPPPPPPPPPPPP 391 Score = 33.5 bits (73), Expect = 7.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPP 511 PPPPP PPPP PPP Sbjct: 384 PPPPPPPPPGPPPPGQLPPPP 404 >UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 37.1 bits (82), Expect = 0.62 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 285 PPPPPPPPPPPPPPPPKGVPPPPRGPPPPPPP 316 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPPPP PPP PPP P G P Sbjct: 284 PPPPPPPPPPPPPPPPPKGVPPPPRGPPPPPPPKAPISGQP 324 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPPP PPPPP G PP + P P Sbjct: 284 PPPPPPPPPPPPPPPPPKGVPPPPRGPPPPPPP 316 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PPPPP K PP PPP P Sbjct: 282 APPPPPPPPPPPPPPPPPPKGVPPPPRGPPPPP 314 >UniRef50_A5DZ99 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 1279 Score = 37.1 bits (82), Expect = 0.62 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDG 496 PPPPP + PPPP PP P +G Sbjct: 341 PPPPPFLTLPPPPPPQQLPPRTPLEG 366 >UniRef50_A3LVW7 Cluster: Predicted protein; n=1; Pichia stipitis|Rep: Predicted protein - Pichia stipitis (Yeast) Length = 795 Score = 37.1 bits (82), Expect = 0.62 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 414 PPPPPAPPAPPPPPINSGPPPPP 436 Score = 36.3 bits (80), Expect = 1.1 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -2 Query: 603 SPXXPXFXXXPPPP-PXXXVKPPPPXXXXPPPXPFDGXXXGS 481 +P P PPPP P PPPP PPP P GS Sbjct: 292 APPIPGHSAPPPPPGPPPPPGPPPPPGPPPPPGPAPSLSAGS 333 >UniRef50_P41484 Cluster: Proline-rich antigen; n=21; Mycobacterium|Rep: Proline-rich antigen - Mycobacterium leprae Length = 249 Score = 37.1 bits (82), Expect = 0.62 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP T PP Sbjct: 54 PPPGGSYPPPPPPGGSYPPPPPSTGAYAPPP 84 >UniRef50_Q8NIW7 Cluster: Branchpoint-bridging protein; n=20; Eukaryota|Rep: Branchpoint-bridging protein - Neurospora crassa Length = 607 Score = 37.1 bits (82), Expect = 0.62 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 583 PPPPPAAEAPPPPPMDLPPPPPP 605 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 582 PPPPPPAAEAPPPPPMDLPPPPP 604 >UniRef50_UPI0000E4A382 Cluster: PREDICTED: similar to DNA-dependent protein kinase catalytic subunit; n=5; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to DNA-dependent protein kinase catalytic subunit - Strongylocentrotus purpuratus Length = 1729 Score = 36.7 bits (81), Expect = 0.83 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P F PPPPP PPPP PPP P Sbjct: 1650 PPPPPFGAAPPPPPPPCGAPPPP---PPPPPP 1678 >UniRef50_UPI0000E463CE Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 1012 Score = 36.7 bits (81), Expect = 0.83 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PPPPP + PPPP PP P Sbjct: 476 TPEPPKEPTPPPPPPPKELTPPPPKEPTPPSPP 508 >UniRef50_UPI0000588CC7 Cluster: PREDICTED: similar to MGC68480 protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to MGC68480 protein - Strongylocentrotus purpuratus Length = 307 Score = 36.7 bits (81), Expect = 0.83 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +2 Query: 470 FXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGG 574 F GD G GGG GGGG+ GGGGG Sbjct: 4 FYDGDNRRGGYSGGGGGGYGGGGGGYNDRRGGGGG 38 >UniRef50_UPI00006A2591 Cluster: Wiskott-Aldrich syndrome protein (WASp).; n=1; Xenopus tropicalis|Rep: Wiskott-Aldrich syndrome protein (WASp). - Xenopus tropicalis Length = 451 Score = 36.7 bits (81), Expect = 0.83 Identities = 23/60 (38%), Positives = 24/60 (40%), Gaps = 3/60 (5%) Frame = -3 Query: 578 GXXPPPXXXX*N---PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 G PPP + PPPP PP PP T GGPP P S P PPP Sbjct: 323 GPLPPPPVRGSSAPPPPPPSRSTPPIPPPTARSGGPPPPPPP-PPSIPAPPPTSGPAPPP 381 >UniRef50_UPI00004D7E7F Cluster: CDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV.; n=4; Xenopus tropicalis|Rep: CDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV. - Xenopus tropicalis Length = 1182 Score = 36.7 bits (81), Expect = 0.83 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 6/41 (14%) Frame = -2 Query: 600 PXXPXFXXXPPPPP---XXXVKPPPP---XXXXPPPXPFDG 496 P P F PPPPP V PPPP PPP PF G Sbjct: 670 PPLPGFSSVPPPPPLPDLSSVPPPPPFPGGGPPPPPPPFPG 710 Score = 34.7 bits (76), Expect = 3.3 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 6/47 (12%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXX---VKPPPP---XXXXPPPXPFDGXXXGSP 478 P P PPPPP V PPPP PPP PF G P Sbjct: 658 PPLPGISSAPPPPPLPGFSSVPPPPPLPDLSSVPPPPPFPGGGPPPP 704 Score = 34.3 bits (75), Expect = 4.4 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 6/41 (14%) Frame = -2 Query: 600 PXXPXFXXXPPPPP---XXXVKPPPP---XXXXPPPXPFDG 496 P P F PPPPP V PPPP PPP P G Sbjct: 634 PLLPGFPSVPPPPPLPGSSSVPPPPPLPGISSAPPPPPLPG 674 >UniRef50_Q7T318 Cluster: Wiskott-Aldrich syndrome; n=7; Euteleostomi|Rep: Wiskott-Aldrich syndrome - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 479 Score = 36.7 bits (81), Expect = 0.83 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPPPP PPPP PPP G SP Sbjct: 350 PPPPSQSHKPPPPPMGACAPPPPPPPPPPPSS-SGNFSSSP 389 >UniRef50_Q0LCI7 Cluster: Putative uncharacterized protein; n=1; Herpetosiphon aurantiacus ATCC 23779|Rep: Putative uncharacterized protein - Herpetosiphon aurantiacus ATCC 23779 Length = 456 Score = 36.7 bits (81), Expect = 0.83 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 500 SKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXGXKKS 613 S G GGG SGGGG GGGGG G G S Sbjct: 151 SSGGGGGGSSSGGGGGGSSSGGGGGGSSSGGGGGGGSS 188 Score = 35.5 bits (78), Expect = 1.9 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = +2 Query: 455 GGKXFFXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 GG G S G GGG GGGG + GGGGG G G Sbjct: 146 GGGGSSSGGGGGGSSSGGGGGGSSSGGGGGGSSSGGGGGGGSSTAGAGG 194 Score = 33.9 bits (74), Expect = 5.8 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 512 GGGXXXSGGGGFTXXXGGGGGXXXKXGXXGXKKS 613 GGG SGGGG GGGGG G G S Sbjct: 146 GGGGSSSGGGGGGSSSGGGGGGSSSGGGGGGSSS 179 >UniRef50_Q07PB7 Cluster: Peptidase C14, caspase catalytic subunit p20 precursor; n=3; Bradyrhizobiaceae|Rep: Peptidase C14, caspase catalytic subunit p20 precursor - Rhodopseudomonas palustris (strain BisA53) Length = 1067 Score = 36.7 bits (81), Expect = 0.83 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPP V+PPPP PPP Sbjct: 1015 PPPPPAARPAPPPPPPVVRPPPPPPPPPPP 1044 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PPPPP PPPP P P P Sbjct: 953 APPPPVVRPAPPPPPVVRQAPPPPPAARPAPPP 985 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXX-VKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 964 PPPPVVRQAPPPPPAARPAPPPPPPVVRPPPPP 996 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXX-VKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 985 PPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPP 1017 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 1006 PPPPVVRPPPPPPPAARPAPPPPPPVVRPPPP 1037 Score = 35.1 bits (77), Expect = 2.5 Identities = 19/54 (35%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP PP P P + + PPP Sbjct: 925 PPPAARPAPPPPPVVRPPPPPPPPAAHPAPPPPVVR-PAPPPPPVVRQAPPPPP 977 Score = 35.1 bits (77), Expect = 2.5 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP PP P + PPP Sbjct: 975 PPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPP 1028 Score = 34.7 bits (76), Expect = 3.3 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -2 Query: 600 PXXPXFXXXPPPPP--XXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 1005 PPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPP 1038 Score = 34.3 bits (75), Expect = 4.4 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXX--PPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP+ PP P P PPP Sbjct: 986 PPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPP 1041 Score = 33.9 bits (74), Expect = 5.8 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPP PP P P PPP Sbjct: 955 PPPVVRPAPPPPPVVRQAPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPP 1008 Score = 33.5 bits (73), Expect = 7.7 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPP PPPPP+ PP P P Sbjct: 946 PPPAAHPAPPPPVVRPAPPPPPVVRQAPPPPPAARPAPPPPP 987 >UniRef50_A5FYS1 Cluster: Putative uncharacterized protein precursor; n=1; Acidiphilium cryptum JF-5|Rep: Putative uncharacterized protein precursor - Acidiphilium cryptum (strain JF-5) Length = 101 Score = 36.7 bits (81), Expect = 0.83 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPF 502 + +P P + PPPPP PPPP PPP + Sbjct: 44 YYAPPPPVYYA-PPPPPRYYAPPPPPRYYAPPPPAY 78 >UniRef50_Q9MAV4 Cluster: F24O1.6; n=10; cellular organisms|Rep: F24O1.6 - Arabidopsis thaliana (Mouse-ear cress) Length = 70 Score = 36.7 bits (81), Expect = 0.83 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDG 496 P P PPPPP PPPP PP P G Sbjct: 19 PRPPPPEPRPPPPPPGPQPPPPPPPRPDPPPPLPG 53 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = -2 Query: 591 PXFXXXPPP-PPXXXVKPPPPXXXXPPPXP 505 P F PPP PP +PPPP PP P Sbjct: 11 PPFHHPPPPRPPPPEPRPPPPPPGPQPPPP 40 >UniRef50_Q8RUS0 Cluster: Putative uncharacterized protein At2g18115; n=1; Arabidopsis thaliana|Rep: Putative uncharacterized protein At2g18115 - Arabidopsis thaliana (Mouse-ear cress) Length = 296 Score = 36.7 bits (81), Expect = 0.83 Identities = 18/41 (43%), Positives = 20/41 (48%) Frame = +2 Query: 479 GDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G+P P G GGG GGGG + GGGGG G G Sbjct: 200 GEPS--PGSGGGGGGGGGGGGGGSGPGGGGGGGGGGGGGGG 238 >UniRef50_Q41805 Cluster: Extensin-like protein precursor; n=15; Magnoliophyta|Rep: Extensin-like protein precursor - Zea mays (Maize) Length = 1188 Score = 36.7 bits (81), Expect = 0.83 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPP V PPPP PPP P Sbjct: 524 SPPAP-IGSPSPPPPVSVVSPPPPVKSPPPPAP 555 Score = 35.5 bits (78), Expect = 1.9 Identities = 19/54 (35%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPP PP K P P + PPP Sbjct: 633 PPPMK---SPPPPTPVSSPPPPEKSPPPPPPAKSTPPPEEYPTPPTSVKSSPPP 683 Score = 34.7 bits (76), Expect = 3.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXP 505 PPPP PPPP PPP P Sbjct: 582 PPPPTLVASPPPPVKSPPPPAP 603 Score = 34.7 bits (76), Expect = 3.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXP 505 PPPP PPPP PPP P Sbjct: 598 PPPPAPVASPPPPVKSPPPPTP 619 Score = 33.9 bits (74), Expect = 5.8 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPP P PPPP PPP P Sbjct: 1003 SPPPPEVKSPPPPAPVS--SPPPPVKSPPPPAP 1033 Score = 33.9 bits (74), Expect = 5.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXP 505 PPPP PPPP PPP P Sbjct: 1028 PPPPAPVSSPPPPVKSPPPPAP 1049 Score = 33.9 bits (74), Expect = 5.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXP 505 PPPP PPPP PPP P Sbjct: 1044 PPPPAPVSSPPPPVKSPPPPAP 1065 Score = 33.9 bits (74), Expect = 5.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXP 505 PPPP PPPP PPP P Sbjct: 1060 PPPPAPISSPPPPVKSPPPPAP 1081 Score = 33.9 bits (74), Expect = 5.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXP 505 PPPP PPPP PPP P Sbjct: 1076 PPPPAPVSSPPPPVKSPPPPAP 1097 Score = 33.9 bits (74), Expect = 5.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXP 505 PPPP PPPP PPP P Sbjct: 1092 PPPPAPVSSPPPPIKSPPPPAP 1113 Score = 33.5 bits (73), Expect = 7.7 Identities = 17/54 (31%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PP P PPPP++ PP K P + + PPP Sbjct: 516 PPPPVKTTSPPAPIGSPSPPPPVSVVSPPPPVKSPPPPAPVGSPPPPEKSPPPP 569 Score = 33.5 bits (73), Expect = 7.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXP 505 PPPP PPPP PPP P Sbjct: 550 PPPPAPVGSPPPPEKSPPPPAP 571 >UniRef50_Q41192 Cluster: NaPRP3; n=1; Nicotiana alata|Rep: NaPRP3 - Nicotiana alata (Winged tobacco) (Persian tobacco) Length = 151 Score = 36.7 bits (81), Expect = 0.83 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PP PP PPPP PPP P Sbjct: 81 SPPPPSPSPPPPSPPPPSPSPPPPSPSPPPPSP 113 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PP P PPPP PPP P Sbjct: 74 SPPPPVKSPPPPSPSPPPPSPPPPSPSPPPPSP 106 Score = 33.5 bits (73), Expect = 7.7 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXS 450 PPP +PPPP PPP P PP P S Sbjct: 66 PPPKREQPSPPPPVKSPPPPSPSPPPPSPPPPSPSPPPPS 105 >UniRef50_O23374 Cluster: P140mDia like protein; n=2; Arabidopsis thaliana|Rep: P140mDia like protein - Arabidopsis thaliana (Mouse-ear cress) Length = 645 Score = 36.7 bits (81), Expect = 0.83 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDG 496 PPPPP PPPP PPP P G Sbjct: 323 PPPPPPKPQPPPPPKIARPPPAPPKG 348 >UniRef50_Q54PM6 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 1224 Score = 36.7 bits (81), Expect = 0.83 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFD 499 PPPPP PPPP PPP P + Sbjct: 726 PPPPPPQQPPPPPPQQPPPPPPPIN 750 >UniRef50_Q3Y407 Cluster: Groundhog (Hedgehog-like family) protein 7; n=3; Caenorhabditis|Rep: Groundhog (Hedgehog-like family) protein 7 - Caenorhabditis elegans Length = 401 Score = 36.7 bits (81), Expect = 0.83 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 133 PPPPPPPHYPPPPPHYPPPPPAP 155 Score = 34.3 bits (75), Expect = 4.4 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P + PPPPP PPPP PPP Sbjct: 123 PAPAPYQQQPPPPPPPPHYPPPPPHYPPPP 152 >UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_104, whole genome shotgun sequence - Paramecium tetraurelia Length = 1152 Score = 36.7 bits (81), Expect = 0.83 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPPPP P PP PPP P G G P Sbjct: 633 PPPPPMKAGPPPPPPPPGVPRPPGGPPPPPPP-PGSKAGGP 672 Score = 36.3 bits (80), Expect = 1.1 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP P PP PPPPP GGPP P G + PPP Sbjct: 643 PPPPPPPGVPRPPGGPPPPPPPPGSKAGGPPPPPPPGAPQPP----GGSAPPPP 692 Score = 33.9 bits (74), Expect = 5.8 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPPP PPPPP GPP P P G PPP Sbjct: 622 PPPPKIAAPPPPPPPPMKAGPPPPPP--PPGVPRPPGGPPPPPPP 664 >UniRef50_Q504V9 Cluster: ZNF341 protein; n=10; Euteleostomi|Rep: ZNF341 protein - Homo sapiens (Human) Length = 795 Score = 36.7 bits (81), Expect = 0.83 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP PPPP PPP P G P Sbjct: 120 PPPPPPPPPLPPPPPPQPPPPPPQSLGPPGRP 151 >UniRef50_Q9BYN7 Cluster: Zinc finger protein 341; n=86; Eumetazoa|Rep: Zinc finger protein 341 - Homo sapiens (Human) Length = 854 Score = 36.7 bits (81), Expect = 0.83 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP PPPP PPP P G P Sbjct: 179 PPPPPPPPPLPPPPPPQPPPPPPQSLGPPGRP 210 >UniRef50_P50552 Cluster: Vasodilator-stimulated phosphoprotein; n=21; Euteleostomi|Rep: Vasodilator-stimulated phosphoprotein - Homo sapiens (Human) Length = 380 Score = 36.7 bits (81), Expect = 0.83 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PP P PPPPP GPP P P G PPP Sbjct: 162 PPAPPAGGPPPPPGPPPPPGPPPPPGLPPSGVPAAAHGAGGGPPP 206 >UniRef50_UPI00015BDD6A Cluster: UPI00015BDD6A related cluster; n=1; unknown|Rep: UPI00015BDD6A UniRef100 entry - unknown Length = 231 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 71 PPPPPPPPPPPPPPPPETPPPPP 93 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 72 PPPPPPPPPPPPPPPETPPPPPP 94 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 73 PPPPPPPPPPPPPPETPPPPPPP 95 Score = 34.7 bits (76), Expect = 3.3 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKK 468 PPP PPPP PPPPP T PP K Sbjct: 67 PPPPPPP--PPPPPPPPPPPPPETPPPPPPPVSK 98 >UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2/cappuccino; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to formin 1,2/cappuccino - Nasonia vitripennis Length = 1271 Score = 36.3 bits (80), Expect = 1.1 Identities = 20/54 (37%), Positives = 23/54 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP + PPP PPPPP+ GPP P P G + PPP Sbjct: 587 PPPMPEMMSGPPP----PPPPPMPGMMSGPPPP----PPPIPGMMTGPPSPPPP 632 >UniRef50_UPI00015B4CAB Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 972 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP +PPPP PPP P Sbjct: 840 PPQPPVTRPPPPPP---TRPPPPPPTRPPPPP 868 Score = 34.3 bits (75), Expect = 4.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXK 471 PP PPPP PPPPP T PP + Sbjct: 840 PPQPPVTRPPPPPPTRPPPPPPTRPPPPPPTR 871 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXK 471 PPP PP P PPPPP T PP + Sbjct: 753 PPPTRPPTRPPQPPVTRPPPPPPTRPPPPPPTR 785 Score = 33.9 bits (74), Expect = 5.8 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PP P PPPPP T PP + P + P PPP Sbjct: 840 PPQPPVTRPPPPPPTRPPPPPPTRPPPPPPTRPPVTQKPYTRPPP 884 Score = 33.5 bits (73), Expect = 7.7 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPP P +PPPP PPP Sbjct: 204 PTPPPQTRPPPPRPQTTPRPPPPIQTRPPP 233 Score = 33.5 bits (73), Expect = 7.7 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PP PPPP PPPPP P + P + P PPP Sbjct: 762 PPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPVTQTPYTRPPP 815 >UniRef50_UPI0000F2C6D3 Cluster: PREDICTED: hypothetical protein; n=2; Theria|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 149 Score = 36.3 bits (80), Expect = 1.1 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +2 Query: 449 RTGGKXFFXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 R GG F G G GGG GGGG GGGGG G G Sbjct: 14 RAGGYWFCGGGRGRERGRGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 64 >UniRef50_UPI0000E7FD76 Cluster: PREDICTED: similar to SH3 domain binding protein; n=1; Gallus gallus|Rep: PREDICTED: similar to SH3 domain binding protein - Gallus gallus Length = 254 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 4 PPPPPPPPPPPPPPSGGPPPPPP 26 >UniRef50_UPI0000E47360 Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 1032 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PP PPL GPP Sbjct: 945 PPPAPDAALPPPPPAPPPPGPPLPFDVAGPP 975 >UniRef50_UPI0000E4615C Cluster: PREDICTED: similar to TamA; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to TamA - Strongylocentrotus purpuratus Length = 1526 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFD 499 PPPPP PPPP PPP P + Sbjct: 1132 PPPPPEEEELPPPPKPELPPPKPVE 1156 >UniRef50_UPI0000E23AD6 Cluster: PREDICTED: Enah/Vasp-like; n=1; Pan troglodytes|Rep: PREDICTED: Enah/Vasp-like - Pan troglodytes Length = 726 Score = 36.3 bits (80), Expect = 1.1 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXPFD-GXXXGS 481 P PPPPP V PPP PPP P G GS Sbjct: 346 PVSCSGPPPPPPPPVPPPPTGATPPPPPPLPAGGAQGS 383 >UniRef50_UPI0000ECCC14 Cluster: WAS/WASL interacting protein family, member 3; n=1; Gallus gallus|Rep: WAS/WASL interacting protein family, member 3 - Gallus gallus Length = 407 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 4 PPPPPPPPPPPPPPSGGPPPPPP 26 >UniRef50_P42859-2 Cluster: Isoform Short of P42859 ; n=7; Deuterostomia|Rep: Isoform Short of P42859 - Mus musculus (Mouse) Length = 2639 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDG 496 P PPPPP +PPP PPP P G Sbjct: 27 PQAPPPPPPPPPQPPQPPPQGQPPPPPPPLPG 58 >UniRef50_Q4TB69 Cluster: Chromosome 11 SCAF7190, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 11 SCAF7190, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 452 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 352 PPPPPPLPPPPPPPPPPPPPPRP 374 >UniRef50_Q4RHV8 Cluster: Chromosome 8 SCAF15044, whole genome shotgun sequence; n=2; Tetraodon nigroviridis|Rep: Chromosome 8 SCAF15044, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1314 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPP--XXXXPPPXPF 502 P P PPPPP PPPP PPP PF Sbjct: 672 PPPPCSTALPPPPPLFGCPPPPPALGKMMPPPPPF 706 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P F PPPP + PPPP P P P Sbjct: 682 PPPPLFGCPPPPPALGKMMPPPPPFMAPFPPP 713 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPP + PPPP PPP P G P Sbjct: 672 PPPPCSTALPPPPPLFGCPPPPPALGKMMPPP 703 >UniRef50_Q4RE14 Cluster: Chromosome undetermined SCAF15155, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome undetermined SCAF15155, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 334 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 2 PPPPPPPPPPPPPPLAPAPPPPP 24 >UniRef50_Q91GJ2 Cluster: Putative uncharacterized protein; n=1; Epiphyas postvittana NPV|Rep: Putative uncharacterized protein - Epiphyas postvittana nucleopolyhedrovirus (EppoMNPV) Length = 881 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP +PPP PPP P Sbjct: 165 PPPPPQPPYPPPPPQAPYQPPPSHPPYPPPPP 196 >UniRef50_Q2NNS2 Cluster: 1629capsid; n=1; Hyphantria cunea nucleopolyhedrovirus|Rep: 1629capsid - Hyphantria cunea nuclear polyhedrosis virus (HcNPV) Length = 539 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 245 PPPPPPNMPPPPPPPPNMPPPPP 267 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 246 PPPPPNMPPPPPPPPNMPPPPPP 268 Score = 34.7 bits (76), Expect = 3.3 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PPPPP + PPPP PPP P Sbjct: 244 TPPPPPPNMPPPPPPPPNMPPPPP---PPPPPP 273 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 248 PPPNMPPPPPPPPNMPPPPPPPPPPPLSLPP 278 >UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burkholderia|Rep: Hemagglutinin domain protein - Burkholderia mallei (Pseudomonas mallei) Length = 373 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 92 PPPPPPPPPPPPPPPPSPPPPSP 114 Score = 35.1 bits (77), Expect = 2.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP P P P Sbjct: 90 PPPPPPPPPPPPPPPPPPSPPPPSPPPPSPPP 121 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP P PP PPP P Sbjct: 93 PPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSP 124 Score = 33.9 bits (74), Expect = 5.8 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP P PPP + PP P + P Sbjct: 95 PPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPTTTP 136 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP PPPP PP P SP Sbjct: 93 PPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSP 124 >UniRef50_Q2RTE8 Cluster: Putative uncharacterized protein; n=1; Rhodospirillum rubrum ATCC 11170|Rep: Putative uncharacterized protein - Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255) Length = 208 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 93 PPPPPPPPPPPPPPPPPPPPPEP 115 Score = 35.5 bits (78), Expect = 1.9 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPF 502 PPPPP PPPP P P PF Sbjct: 95 PPPPPPPPPPPPPPPPPPPEPPPF 118 >UniRef50_Q2JMC8 Cluster: TonB family protein; n=2; Synechococcus|Rep: TonB family protein - Synechococcus sp. (strain JA-2-3B'a(2-13)) (Cyanobacteria bacteriumYellowstone B-Prime) Length = 379 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 105 PPPPPPRPQPPPPPAPVPPPPAP 127 >UniRef50_Q56B20 Cluster: Cell surface antigen Sca2-6; n=4; Rickettsia bellii|Rep: Cell surface antigen Sca2-6 - Rickettsia bellii Length = 909 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPTP 67 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 49 PPPPPPPPPPPPPPPPPTPPPPP 71 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 51 PPPPPPPPPPPPPPPTPPPPPLP 73 Score = 35.1 bits (77), Expect = 2.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 49 PPPPPPPPPPPPPPPPPTPPPPPLPKTPPVDP 80 Score = 33.9 bits (74), Expect = 5.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPP 511 PPPPP PPPP PPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPP 64 Score = 33.9 bits (74), Expect = 5.8 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPL 501 PPP PPPP PPPPPL Sbjct: 50 PPPPPPPPPPPPPPPPTPPPPPL 72 Score = 33.5 bits (73), Expect = 7.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXP 505 PPPP PPPP PPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPP 65 >UniRef50_Q0M4S1 Cluster: TonB-like; n=1; Caulobacter sp. K31|Rep: TonB-like - Caulobacter sp. K31 Length = 245 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 72 PPPPPPPPPPPPPPPTNAPPPPP 94 >UniRef50_A6Q902 Cluster: Putative uncharacterized protein; n=1; Sulfurovum sp. NBC37-1|Rep: Putative uncharacterized protein - Sulfurovum sp. (strain NBC37-1) Length = 623 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +2 Query: 500 SKGXGGGXXXSGGGGFTXXXGGGGG 574 S G GG SGGGGF+ GGGGG Sbjct: 595 SSGMSGGGGFSGGGGFSGGGGGGGG 619 >UniRef50_A6G312 Cluster: Serine/threonine protein kinase; n=1; Plesiocystis pacifica SIR-1|Rep: Serine/threonine protein kinase - Plesiocystis pacifica SIR-1 Length = 424 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPP 511 PPPPP KPPPP PPP Sbjct: 341 PPPPPGGKKKPPPPPGKRPPP 361 >UniRef50_A5V8M1 Cluster: OmpA/MotB domain protein precursor; n=3; Sphingomonadales|Rep: OmpA/MotB domain protein precursor - Sphingomonas wittichii RW1 Length = 373 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPP 258 Score = 34.3 bits (75), Expect = 4.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGP 480 PPP PPPP PPPPP GP Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPVVETPGP 265 >UniRef50_A1UGS6 Cluster: Fibronectin-attachment family protein precursor; n=3; Mycobacterium|Rep: Fibronectin-attachment family protein precursor - Mycobacterium sp. (strain KMS) Length = 333 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFD 499 +P P PPPPP PPP PPP P D Sbjct: 56 APPPPGPGPVPPPPPADPNAAPPPAGQLPPPPPAD 90 >UniRef50_A0J0A0 Cluster: Putative lipoprotein precursor; n=2; Alteromonadales|Rep: Putative lipoprotein precursor - Shewanella woodyi ATCC 51908 Length = 508 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPP 60 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPP 61 Score = 34.3 bits (75), Expect = 4.4 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGG 483 PPP PPPP PPPPP T G Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPETVGMSG 68 >UniRef50_Q9LMQ1 Cluster: F7H2.17 protein; n=2; Arabidopsis thaliana|Rep: F7H2.17 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 1006 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P F P PPP V PPP PPP P Sbjct: 164 PSPPPFFFFPSPPPPVIVFPPPLVPSPPPPLP 195 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPPP PPPP PPP Sbjct: 386 PPTPVPCSPPPPPPIPVPCPPPPSPPPPPP 415 Score = 34.7 bits (76), Expect = 3.3 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP V PPP PPP P Sbjct: 394 PPPPPPIPVPCPPPPSPPPPPPP 416 >UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thaliana|Rep: Gb|AAD23008.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 1289 Score = 36.3 bits (80), Expect = 1.1 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 SP P + PPPP PPPP PPP P GSP Sbjct: 934 SPPPPSYGSPPPPP------PPPPSYGSPPPPPPPPPSYGSP 969 Score = 36.3 bits (80), Expect = 1.1 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPPPP PPPP PPP P GSP Sbjct: 947 PPPPPSYGSPPPPP-----PPPPSYGSPPPPPPPPPGYGSP 982 Score = 36.3 bits (80), Expect = 1.1 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPPPP PPPP PPP P GSP Sbjct: 960 PPPPPSYGSPPPPP-----PPPPGYGSPPPPPPPPPSYGSP 995 Score = 35.9 bits (79), Expect = 1.4 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 G PPP PPP PPPPP GG P P P F G PPP Sbjct: 1033 GGAPPPPP----PPPMHGGAPPPPPPPPMHGGAP------PPPPPPMFGGAQPPPPP 1079 Score = 34.7 bits (76), Expect = 3.3 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXX----VKPPPPXXXXPPPXPFDGXXXGSP 478 SP PPPPP + PPPP PPP P GSP Sbjct: 911 SPPVKTAPPPPPPPPFSNAHSVLSPPPPSYGSPPPPPPPPPSYGSP 956 Score = 33.5 bits (73), Expect = 7.7 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 G PPP PPP PPPPP G PP P P + PPP Sbjct: 967 GSPPPPPP----PPPGYGSPPPPPPPPPSYGSPPP-----PPPPPFSHVSSIPPPPP 1014 >UniRef50_Q948Y7 Cluster: VMP3 protein; n=1; Volvox carteri f. nagariensis|Rep: VMP3 protein - Volvox carteri f. nagariensis Length = 687 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP NPPPP P PPP + PP P P Sbjct: 608 PPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRP 649 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP NPPPP P PPP + PP P P Sbjct: 598 PPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPP 639 Score = 35.1 bits (77), Expect = 2.5 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP P PPP PP P P N PPP Sbjct: 593 PPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPP------PNPPPP 640 Score = 34.7 bits (76), Expect = 3.3 Identities = 19/54 (35%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP P PPP + PP P S P PPP Sbjct: 603 PPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPP-PPSPPPPSPRPPTPPPP 655 Score = 33.9 bits (74), Expect = 5.8 Identities = 17/53 (32%), Positives = 21/53 (39%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPP 411 PPP +PPPP P PPP + PP P P + + PP Sbjct: 623 PPPSPPPPSPPPPNPPPPSPPPPSPRPPTPPPPSPPPPRPPPRPPPTRRSPPP 675 >UniRef50_Q948Y6 Cluster: VMP4 protein; n=1; Volvox carteri f. nagariensis|Rep: VMP4 protein - Volvox carteri f. nagariensis Length = 1143 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP P PP PPP P Sbjct: 521 SPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP 553 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP P PP PPP P Sbjct: 528 PPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP 559 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP P PP PPP P Sbjct: 534 PPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP 565 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP P PP PPP P Sbjct: 540 PPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP 571 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP P PP PPP P Sbjct: 546 PPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP 577 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP P PP PPP P Sbjct: 552 PPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP 583 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PP PP PPPP PP P Sbjct: 524 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPP 556 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PP PP PPPP PP P Sbjct: 530 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPP 562 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PP PP PPPP PP P Sbjct: 536 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPP 568 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PP PP PPPP PP P Sbjct: 542 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPP 574 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PP PP PPPP PP P Sbjct: 548 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPP 580 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PP PP PPPP PP P Sbjct: 560 SPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPP 592 >UniRef50_Q8LJ87 Cluster: Putative leucine-rich repeat/extensin 1; n=4; Oryza sativa|Rep: Putative leucine-rich repeat/extensin 1 - Oryza sativa subsp. japonica (Rice) Length = 503 Score = 36.3 bits (80), Expect = 1.1 Identities = 20/53 (37%), Positives = 23/53 (43%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PP +PPPP PPPPP T PP ++ P P K PPP Sbjct: 449 PPPPPKTSPPPPVSSPPPPPPPTMSP-PPPIQE---PVILPPILSAKYQSPPP 497 Score = 34.7 bits (76), Expect = 3.3 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = -2 Query: 603 SPXXPXFXXXP---PPPPXXXVKPPPPXXXXPPPXP 505 SP P F P PPPP PPPP PPP P Sbjct: 435 SPPSPVFSPPPAFSPPPPPK-TSPPPPVSSPPPPPP 469 Score = 33.5 bits (73), Expect = 7.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PP P Sbjct: 417 PPPPPAPVQSPPPPAPVVSPPSP 439 >UniRef50_Q8H9E1 Cluster: Extensin; n=6; Eukaryota|Rep: Extensin - Solanum tuberosum (Potato) Length = 152 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P + PPPPP PPPP P P Sbjct: 58 SPPPPYYYKSPPPPPPVYKSPPPPVYKYKSPPP 90 Score = 35.1 bits (77), Expect = 2.5 Identities = 18/55 (32%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXX--PPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPP 411 PPP +PPPP PPPPP PP + P + K+ PP Sbjct: 79 PPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP 133 Score = 34.7 bits (76), Expect = 3.3 Identities = 18/53 (33%), Positives = 20/53 (37%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPP 411 PP PPPP PPPP PP K P P + K+ PP Sbjct: 61 PPYYYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPP 113 Score = 34.3 bits (75), Expect = 4.4 Identities = 19/60 (31%), Positives = 23/60 (38%), Gaps = 6/60 (10%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPP------PPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PP PPP PP + P + K+ PPP Sbjct: 43 PPPPYYYKSPPPPSPSPPPPYYYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPP 102 Score = 34.3 bits (75), Expect = 4.4 Identities = 17/54 (31%), Positives = 20/54 (37%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPP PP + P + K PPP Sbjct: 69 PPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPP 122 Score = 33.5 bits (73), Expect = 7.7 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 ++ SP P PPPP PPPP PPP + SP Sbjct: 16 VYKSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSP 57 Score = 30.3 bits (65), Expect(2) = 3.3 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -2 Query: 567 PPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPP PPPP PPP + SP Sbjct: 12 PPPYVYKSPPPPSPSPPPPYYYKSPPPPSP 41 Score = 23.4 bits (48), Expect(2) = 3.3 Identities = 14/54 (25%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = -2 Query: 360 PPPFPXXXXXFXXXFFXX-NPFFXPXFFXXXPPXXPFFXLXPPFXPFLXXXPPP 202 PPP P + +P P ++ PP P PP + PPP Sbjct: 37 PPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPPPVYKSPPPPVYKYKSPPP 90 >UniRef50_Q7XAL2 Cluster: Extensin-like protein; n=1; Oryza sativa (japonica cultivar-group)|Rep: Extensin-like protein - Oryza sativa subsp. japonica (Rice) Length = 161 Score = 36.3 bits (80), Expect = 1.1 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPP--XXXVKPPPPXXXXPPPXP 505 F SP P PPPPP V PPP PPP P Sbjct: 117 FASPPPPDALVPPPPPPAAPALVTPPPALPSAPPPAP 153 >UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C5 protein precursor - Chlamydomonas reinhardtii Length = 541 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP P PP PPP P Sbjct: 174 SPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 206 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPP P PPPP PPP P Sbjct: 182 SPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 214 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPP PPPP PPP P Sbjct: 190 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSP 222 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP P PP PPP P Sbjct: 200 SPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 232 Score = 35.5 bits (78), Expect = 1.9 Identities = 19/54 (35%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP P PPP + PP P S P + PPP Sbjct: 177 PPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 230 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP P P P Sbjct: 193 PPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 224 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPP P PPPP PPP P Sbjct: 219 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 250 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP PPPPP P P S P Sbjct: 192 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 233 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP PPPP PP P SP Sbjct: 201 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 232 >UniRef50_Q1EP07 Cluster: Putative uncharacterized protein; n=1; Musa acuminata|Rep: Putative uncharacterized protein - Musa acuminata (Banana) Length = 390 Score = 36.3 bits (80), Expect = 1.1 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP 456 G PPP PPPP PPPPP PP K P Sbjct: 185 GPEPPPPPGP-EPPPPPAPEPPPPPAPEPPPPPPPKPDPTP 224 Score = 35.1 bits (77), Expect = 2.5 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 G PPP PPPP PPPPP PP Sbjct: 193 GPEPPPPPAPEPPPPPAPEPPPPPPPKPDPTPPP 226 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PPP P Sbjct: 186 PEPPPPPGPEPPPPPAPEPPPPPAPEPPPPPP 217 Score = 33.9 bits (74), Expect = 5.8 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 P PPP +PPPP PPP P Sbjct: 178 PEPPPPPGPEPPPPPGPEPPPPP 200 >UniRef50_O49946 Cluster: Extensin-like protein; n=5; Solanaceae|Rep: Extensin-like protein - Solanum tuberosum (Potato) Length = 221 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 53 PPPPPPRSPPPPPPSPPPPPPTP 75 >UniRef50_A7R244 Cluster: Chromosome undetermined scaffold_398, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome undetermined scaffold_398, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 822 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 335 PPPPPPPRPPPPPPPPPPPPPPP 357 Score = 34.3 bits (75), Expect = 4.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P PPPPP PPPP PPP Sbjct: 331 PVSAPPPPPPPRPPPPPPPPPPPPPPP 357 >UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 2146 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PP P PPP P Sbjct: 924 SPPSPSPPSPPPPPPVPSPPPPSPPPPSPPPLP 956 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPP PPPP P P P Sbjct: 888 SPPPPSPLPSPPPPSPPSPSPPPPSPLPPSPSP 920 >UniRef50_Q94273 Cluster: Ground-like (Grd related) protein 6; n=2; Caenorhabditis|Rep: Ground-like (Grd related) protein 6 - Caenorhabditis elegans Length = 240 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP 456 PPP PPPP PPPPP+ PP + P Sbjct: 57 PPPCPAQFCPPPPICPPPPPPPMPCPPPPPPMPRPSCP 94 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PPP P Sbjct: 56 PPPPCPAQFCPPPPICPPPPPPPMPCPPPPPP 87 >UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyostelium discoideum|Rep: Formin homology protein A - Dictyostelium discoideum (Slime mold) Length = 1218 Score = 36.3 bits (80), Expect = 1.1 Identities = 25/63 (39%), Positives = 25/63 (39%), Gaps = 6/63 (9%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGG------PPXKKXXFPXSXPLFFLGKNNX 417 G PPP PPPP PPPP GG PP K P P F GK Sbjct: 689 GGGPPPPP----PPPPMTGGGPPPPPPPPGGGPPPPPPPPGAKAGGPPPPPPPF-GKGPP 743 Query: 416 PPP 408 PPP Sbjct: 744 PPP 746 Score = 35.1 bits (77), Expect = 2.5 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPPP PPPP PPP P G G P Sbjct: 696 PPPPPMTGGGPPPP-----PPPPGGGPPPPPPPPGAKAGGP 731 >UniRef50_Q86BM9 Cluster: CG33003-PA; n=1; Drosophila melanogaster|Rep: CG33003-PA - Drosophila melanogaster (Fruit fly) Length = 579 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 464 PPPPPPPPPPPPPPPPTEPPPPP 486 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 465 PPPPPPPPPPPPPPPTEPPPPPP 487 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 466 PPPPPPPPPPPPPPTEPPPPPPP 488 Score = 35.1 bits (77), Expect = 2.5 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP +PPPP PPP P Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPP--PPPPPEP 492 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGK 426 PPPP PPPPP T PP F++G+ Sbjct: 466 PPPPPPPPPPPPPPTEPPPPPPPPPEPRVKKYSYFYIGR 504 >UniRef50_Q5CS67 Cluster: Signal peptide containing large protein with proline stretches; n=2; Cryptosporidium|Rep: Signal peptide containing large protein with proline stretches - Cryptosporidium parvum Iowa II Length = 1884 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 1547 PPPPPPPPPPPPPPPPPSPPPSP 1569 Score = 35.5 bits (78), Expect = 1.9 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPF 502 PPPPP PPP PPP PF Sbjct: 1551 PPPPPPPPPPPPPSPPPSPPPSPF 1574 Score = 34.7 bits (76), Expect = 3.3 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P F PPPPP PPPP PPP + G P Sbjct: 1173 PSSGSFTPPPPPPPPP---PPPPPPPPPPPPSYTSPSNGIP 1210 Score = 34.7 bits (76), Expect = 3.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP 456 PPP PPPP PPPPP PP P Sbjct: 1536 PPPSSGSSAPPPPPPPPPPPPPPPPPPPSPPPSPPPSP 1573 >UniRef50_Q54PI9 Cluster: Formin homology domain-containing protein; n=1; Dictyostelium discoideum AX4|Rep: Formin homology domain-containing protein - Dictyostelium discoideum AX4 Length = 935 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 458 PPPPPVGAPPPPPPPPPPPPPPP 480 Score = 33.5 bits (73), Expect = 7.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLT 498 PPP PPPP PPPPP T Sbjct: 460 PPPVGAPPPPPPPPPPPPPPPPST 483 >UniRef50_A2D765 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 450 Score = 36.3 bits (80), Expect = 1.1 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPP PP P P PPP Sbjct: 311 PPPPAAKPTPPPPAAKPAPPPPRAAAPPPPPPPAAAAPPPPPPPMAAPPPPPPP 364 Score = 34.7 bits (76), Expect = 3.3 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXV--KPPPPXXXXPPPXP 505 +P P PPPPP PPPP PPP P Sbjct: 328 APPPPRAAAPPPPPPPAAAAPPPPPPPMAAPPPPP 362 Score = 33.9 bits (74), Expect = 5.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPPP PPPP PP Sbjct: 269 PPPPVAAAAPPPPPAPGAAPPPPKPAAAPP 298 >UniRef50_A0E1N2 Cluster: Chromosome undetermined scaffold_73, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_73, whole genome shotgun sequence - Paramecium tetraurelia Length = 442 Score = 36.3 bits (80), Expect = 1.1 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPP PP PP PP P S P +N PPP Sbjct: 80 PPPPPPPKGAPPPPPPRPPGPPAAKPTSNPPNPPPPKPASQPPPPPVQNLPPPP 133 Score = 33.5 bits (73), Expect = 7.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXP 505 PPPP PPPP PPP P Sbjct: 74 PPPPPPPPPPPPPKGAPPPPPP 95 Score = 33.5 bits (73), Expect = 7.7 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKK 468 PPP PPPP PPPPP PP K Sbjct: 113 PPPKPASQPPPPPVQNLPPPPPPPQQNVLPPPPK 146 >UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_31, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP + PPP PPP P G P Sbjct: 315 PPPPPLPNSQAPPPPPPPPPPPPIPGQQNPPP 346 Score = 35.5 bits (78), Expect = 1.9 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPPP PPPPPL PP P P G+ N PPP Sbjct: 309 PPPPPP--PPPPPLPNSQAPPPPPPPPPPPPIP----GQQNPPPP 347 Score = 35.1 bits (77), Expect = 2.5 Identities = 20/54 (37%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPP PPPPP+ PP P PL G+ PPP Sbjct: 316 PPPPLPNSQAPPPPPPPPPPPPIPGQQNPPP------PPPPPL--PGQQAPPPP 361 >UniRef50_Q9C0F0 Cluster: Protein KIAA1713; n=33; Deuterostomia|Rep: Protein KIAA1713 - Homo sapiens (Human) Length = 1652 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 1428 PPPPPLALPPPPPPPPPLPPPLP 1450 >UniRef50_Q5T8W7 Cluster: Espin; n=51; Euteleostomi|Rep: Espin - Homo sapiens (Human) Length = 854 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 431 PPPPPSFPPPPPPPGTQLPPPPP 453 Score = 34.3 bits (75), Expect = 4.4 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPPP + PPPP P P Sbjct: 431 PPPPPSFPPPPPPPGTQLPPPPPGYPAPKP 460 >UniRef50_Q0V5Y9 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 305 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXV--KPPPPXXXXPPPXP 505 P P + PPPPP PPPP PPP P Sbjct: 86 PPPPGYGEQPPPPPPGYAAEPPPPPPGMQPPPPP 119 Score = 35.1 bits (77), Expect = 2.5 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDG 496 PPPPP +PPPP PP P G Sbjct: 96 PPPPPGYAAEPPPPPPGMQPPPPPPG 121 Score = 34.3 bits (75), Expect = 4.4 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP PP + P G PPP Sbjct: 70 PPPRP----PPPPGYGEPPPPPPPGYGEQPPPPPPGYAAEPPPPPPGMQPPPPP 119 >UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus terreus NIH2624|Rep: Predicted protein - Aspergillus terreus (strain NIH 2624) Length = 313 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 144 PPPPPPPPPPPPPPPMAGPPPPP 166 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPPP PPPP PPP Sbjct: 136 PVGPPPPPPPPPPPPPPPPPPPPMAGPPPP 165 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP + PPP PPP P Sbjct: 142 PPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHP 173 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDG 496 P P PPPPP PPPP PPP P G Sbjct: 130 PVLPGPPVGPPPPPPP---PPPPPPPPPPPPPMAG 161 Score = 34.7 bits (76), Expect = 3.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 P P PPPP PPPPP GPP P P Sbjct: 133 PGPPVGPPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPP 174 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 143 PPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPP 174 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PP PPPP PPPPP G PP P P Sbjct: 135 PPVGPPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPP 175 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP P P P Sbjct: 144 PPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPP 175 Score = 33.5 bits (73), Expect = 7.7 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPP--PPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PP PPPP PPP PP GPP P + P+ + PPP Sbjct: 208 PPAPPPVEGPPPPKGPPPPPHSPPGPPPAEGPPPPAKVPPPAPPVEGPPPPHSPPP 263 >UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomyces capsulatus NAm1|Rep: Cytokinesis protein sepA - Ajellomyces capsulatus NAm1 Length = 1670 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP GGPP Sbjct: 953 PPPPP----PPPPGVGGPPPPPPPPGMGGPP 979 Score = 35.9 bits (79), Expect = 1.4 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPP-----XXXXPPPXPFDGXXXGSP 478 P F PPPPP PPPP PPP P G G P Sbjct: 950 PLFPPPPPPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGP 992 >UniRef50_Q9Y6X0 Cluster: SET-binding protein; n=26; Tetrapoda|Rep: SET-binding protein - Homo sapiens (Human) Length = 1542 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 1469 PPPPPPPLPPPPPPPLPPPPPLP 1491 Score = 33.5 bits (73), Expect = 7.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPP GG K P P Sbjct: 1469 PPPPPPPLPPPPPPPLPPPPPLPKTPRGGKRKHKPQAPAQPP 1510 >UniRef50_Q1DMX8 Cluster: Pre-mRNA-splicing ATP-dependent RNA helicase PRP28; n=16; Pezizomycotina|Rep: Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 - Coccidioides immitis Length = 817 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFD 499 P P PPPP PPPP PPP P D Sbjct: 27 PLPPDESALPPPPTDPAPPPPPPDSLAPPPPPED 60 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PP PP PPPP PPP P D P Sbjct: 26 PPLPPDESALPPPPTDPAPPPPPPDSLAPPPP 57 >UniRef50_Q9QYX7 Cluster: Protein piccolo; n=22; cellular organisms|Rep: Protein piccolo - Mus musculus (Mouse) Length = 5038 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 2306 PPPPPPPPPPPPPPPPPPPPPLP 2328 Score = 33.9 bits (74), Expect = 5.8 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPL 501 PPP PPPP PPPPPL Sbjct: 2305 PPPPPPPPPPPPPPPPPPPPPPL 2327 Score = 33.9 bits (74), Expect = 5.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPP 511 PPPPP PPPP PPP Sbjct: 2305 PPPPPPPPPPPPPPPPPPPPP 2325 >UniRef50_Q9Y6V0 Cluster: Protein piccolo; n=17; Amniota|Rep: Protein piccolo - Homo sapiens (Human) Length = 5183 Score = 36.3 bits (80), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 2337 PPPPPPPPPPPPPPPPPPPPPLP 2359 Score = 33.9 bits (74), Expect = 5.8 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPL 501 PPP PPPP PPPPPL Sbjct: 2336 PPPPPPPPPPPPPPPPPPPPPPL 2358 Score = 33.9 bits (74), Expect = 5.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPP 511 PPPPP PPPP PPP Sbjct: 2336 PPPPPPPPPPPPPPPPPPPPP 2356 Score = 33.9 bits (74), Expect = 5.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPP 511 PPPPP PPPP PPP Sbjct: 2341 PPPPPPPPPPPPPPPPPLPPP 2361 >UniRef50_Q9UI08 Cluster: Ena/VASP-like protein; n=24; Tetrapoda|Rep: Ena/VASP-like protein - Homo sapiens (Human) Length = 416 Score = 36.3 bits (80), Expect = 1.1 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXPFD-GXXXGS 481 P PPPPP V PPP PPP P G GS Sbjct: 176 PVSCSGPPPPPPPPVPPPPTGATPPPPPPLPAGGAQGS 213 >UniRef50_Q9NSV4 Cluster: Protein diaphanous homolog 3; n=66; Deuterostomia|Rep: Protein diaphanous homolog 3 - Homo sapiens (Human) Length = 1193 Score = 36.3 bits (80), Expect = 1.1 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPP 411 PPP PPP PPPPP G P PL FLG N PP Sbjct: 578 PPPLPSGGGVPPP----PPPPPPPPLPGMRMPFSGPVPPPPPLGFLGGQNSPP 626 >UniRef50_UPI0000E482F8 Cluster: PREDICTED: similar to dishevelled associated activator of morphogenesis 1 like; n=3; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to dishevelled associated activator of morphogenesis 1 like - Strongylocentrotus purpuratus Length = 801 Score = 35.9 bits (79), Expect = 1.4 Identities = 22/65 (33%), Positives = 24/65 (36%), Gaps = 6/65 (9%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXX------PPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP GGPP P + K + P P Sbjct: 259 PPPMMGGAPPPPPPPPGPGGAPPPPPPPGMFGGGGPPPPPGAPPFGGMSAPIKKRDLPKP 318 Query: 407 XNXXK 393 N K Sbjct: 319 SNPLK 323 >UniRef50_UPI0000DA3CD5 Cluster: PREDICTED: hypothetical protein; n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 311 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +2 Query: 497 PSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 P +G GGG GGGG GGGGG G G Sbjct: 176 PGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 210 Score = 34.3 bits (75), Expect = 4.4 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXGXK 607 G GGG GGGG GGGGG + G G + Sbjct: 206 GGGGGGGGGGGGGGGGGGGGGGGGGGRSGGGGGR 239 Score = 33.5 bits (73), Expect = 7.7 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXGXKKS 613 G GGG GGGG GGGGG G G +S Sbjct: 198 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRS 233 >UniRef50_Q4A373 Cluster: Putative lectin protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative lectin protein precursor - Emiliania huxleyi virus 86 Length = 1994 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 845 SPPSPPPPLPPPPPPPN--SPPPPYDPPPPPSP 875 Score = 35.5 bits (78), Expect = 1.9 Identities = 19/54 (35%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPPL+ PP P P + PPP Sbjct: 1229 PPPPSPPPSPPPPSPPPTPPPPLSPPPSLPPPSSPP-PSPNPPPAPPPPSPPPP 1281 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPF 502 SP P PPP P PPPP PP P+ Sbjct: 696 SPPPPSPPSPPPPSPPPPPSPPPPSLPPSPPPPY 729 Score = 33.5 bits (73), Expect = 7.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PP P Sbjct: 1228 PPPPPSPPPSPPPPSPPPTPPPP 1250 Score = 33.5 bits (73), Expect = 7.7 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 3/55 (5%) Frame = -3 Query: 596 FXXXFXGXXPPPXXXX*NPPPPXXXXP---PPPPLTXXXGGPPXKKXXFPXSXPL 441 F F PPP PP P P PPPPL PP P PL Sbjct: 1436 FSSQFPSPSPPPSPPPSPPPSPPPLQPPPSPPPPLLPPPFPPPPNSPPLPSFPPL 1490 >UniRef50_Q5YPL1 Cluster: Putative stress protein; n=1; Nocardia farcinica|Rep: Putative stress protein - Nocardia farcinica Length = 505 Score = 35.9 bits (79), Expect = 1.4 Identities = 19/55 (34%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Frame = -3 Query: 569 PPPXXXX*NPPPP--XXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPP 411 PPP PPPP PPPPP PP ++ P F G+ PP Sbjct: 198 PPPPQQQFTPPPPPQQQFTPPPPPQQQFTPPPPPQQQFTPPPTQQFPQGQQPYPP 252 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPP--XXXXPPPXP 505 F P P PPPPP PPPP PPP P Sbjct: 195 FTPPPPPQQQFTPPPPPQQQFTPPPPPQQQFTPPPPP 231 >UniRef50_Q1GRM3 Cluster: OmpA/MotB precursor; n=7; Sphingomonadales|Rep: OmpA/MotB precursor - Sphingopyxis alaskensis (Sphingomonas alaskensis) Length = 373 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGP 480 PPP PPPP PPPPP+ GP Sbjct: 232 PPPPPPPPPPPPPPPPPPPPPPVVECAPGP 261 Score = 33.9 bits (74), Expect = 5.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPP 511 PPPPP PPPP PPP Sbjct: 232 PPPPPPPPPPPPPPPPPPPPP 252 Score = 33.9 bits (74), Expect = 5.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPP 511 PPPPP PPPP PPP Sbjct: 233 PPPPPPPPPPPPPPPPPPPPP 253 >UniRef50_A3WE37 Cluster: Putative uncharacterized protein; n=2; Erythrobacter sp. NAP1|Rep: Putative uncharacterized protein - Erythrobacter sp. NAP1 Length = 371 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGS 481 P P P PPP KPP PPP P G GS Sbjct: 328 PKKPPMKPPPKPPPKPPPKPPKTGPPKPPPPPVMGGSGGS 367 Score = 33.5 bits (73), Expect = 7.7 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPP +KPPP PPP P Sbjct: 325 PPPPKKPPMKPPPKPPPKPPPKP 347 >UniRef50_A3Q834 Cluster: Putative uncharacterized protein precursor; n=3; Mycobacterium|Rep: Putative uncharacterized protein precursor - Mycobacterium sp. (strain JLS) Length = 314 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPPP PPPP PPP Sbjct: 183 PPPPVEAPPPPPPPVEAPPPPPPPVEAPPP 212 Score = 34.7 bits (76), Expect = 3.3 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP 456 PPP PPPP PPPPP PP + P Sbjct: 183 PPPPVEAPPPPPPPVEAPPPPPPPVEAPPPPAVEAPLP 220 Score = 34.7 bits (76), Expect = 3.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P PPPPP PPPP PP P Sbjct: 185 PPVEAPPPPPPPVEAPPPPPPPVEAPPPP 213 Score = 33.9 bits (74), Expect = 5.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP P P P Sbjct: 191 PPPPPPVEAPPPPPPPVEAPPPPAVEAPLPPP 222 >UniRef50_A1FZ88 Cluster: Outer membrane autotransporter barrel domain precursor; n=1; Stenotrophomonas maltophilia R551-3|Rep: Outer membrane autotransporter barrel domain precursor - Stenotrophomonas maltophilia R551-3 Length = 1009 Score = 35.9 bits (79), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXP 505 PPPP V PPPP PPP P Sbjct: 605 PPPPTPPVAPPPPITPAPPPPP 626 >UniRef50_A0LQ52 Cluster: Putative uncharacterized protein; n=1; Syntrophobacter fumaroxidans MPOB|Rep: Putative uncharacterized protein - Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) Length = 335 Score = 35.9 bits (79), Expect = 1.4 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +2 Query: 455 GGKXFFXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 GG G P G GGG GGGG GGGGG G G Sbjct: 284 GGPSGAGHGGPGGSAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 332 >UniRef50_Q9XIB6 Cluster: F13F21.7 protein; n=5; core eudicotyledons|Rep: F13F21.7 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 847 Score = 35.9 bits (79), Expect = 1.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPF 502 SP P PP PP PPPP PPP F Sbjct: 574 SPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVF 607 Score = 34.3 bits (75), Expect = 4.4 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 585 PSPPPPVHSPPPPPVF--SPPPPVFSPPPPSP 614 Score = 33.9 bits (74), Expect = 5.8 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 SP P F PPPP PPPP PPP Sbjct: 601 SPPPPVFS---PPPPSPVYSPPPPSHSPPPP 628 >UniRef50_Q8S9B6 Cluster: PR-1 like protein; n=1; Volvox carteri f. nagariensis|Rep: PR-1 like protein - Volvox carteri f. nagariensis Length = 415 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP PPPPP PP + P P Sbjct: 207 PPPPSL--SPPPPKSPPPPPPPSPPPPAPPPPRSSPSPRPSP 246 >UniRef50_Q4U2V9 Cluster: Hydroxyproline-rich glycoprotein GAS30 precursor; n=3; Chlamydomonas reinhardtii|Rep: Hydroxyproline-rich glycoprotein GAS30 precursor - Chlamydomonas reinhardtii Length = 451 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP PPPP L P +K P + P Sbjct: 250 PPPSPLPPSPPPPPRPSPPPPELPPAQPVTPARKRPPPPAPP 291 >UniRef50_Q08194 Cluster: Cysteine-rich extensin-like protein-1; n=4; Nicotiana tabacum|Rep: Cysteine-rich extensin-like protein-1 - Nicotiana tabacum (Common tobacco) Length = 209 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP +P PP PPP P Sbjct: 97 PPRPRPCPSPPPPPQPRPRPSPPPPSPPPPAP 128 >UniRef50_A5BL77 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 276 Score = 35.9 bits (79), Expect = 1.4 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPF 502 + P P PPPPP + PPPP PPP P+ Sbjct: 222 YPPPPPPPPGYYPPPPP---LHPPPPLFPPPPPLPY 254 Score = 33.9 bits (74), Expect = 5.8 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P + PPPPP PPPP PP P Sbjct: 216 PPHQPYYPPPPPPPPGYYPPPPPLHPPPPLFP 247 >UniRef50_A4S5W2 Cluster: Predicted protein; n=2; Eukaryota|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 722 Score = 35.9 bits (79), Expect = 1.4 Identities = 36/140 (25%), Positives = 37/140 (26%) Frame = +2 Query: 182 GGXKKXRGGGXXXKKGXKGGXXKKXGXXGGXXXKKXGKKXGLXXKXXXXNXXXXXGKGGG 361 GG GGG G GG G GG G G G GGG Sbjct: 62 GGGHGGHGGGQGGGHGGHGGGHGGDGGTGGGHGGDGGTGGGTGGNGGGGGGGGGGGGGGG 121 Query: 362 XXXXXXXXXFXXXXXXXXXXCFFLKKKXXRTGGKXFFXXGDPXXXPSKGXGGGXXXSGGG 541 TGG G G GGG +GGG Sbjct: 122 GGGGGTGGGGTGGNGGGGGG----------TGGGTGGNGGGGNGGGGGGTGGGTGGNGGG 171 Query: 542 GFTXXXGGGGGXXXKXGXXG 601 G GGGGG G G Sbjct: 172 GGGGGGGGGGGTGGNGGDGG 191 >UniRef50_A4S0Z6 Cluster: Predicted protein; n=2; Ostreococcus|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 1360 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP PPPP P P P +G P Sbjct: 887 PPPPPTPPSPPPPPPWTHPSPPPPEGALQAPP 918 >UniRef50_Q9VY31 Cluster: CG9411-PA; n=2; Sophophora|Rep: CG9411-PA - Drosophila melanogaster (Fruit fly) Length = 993 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLF 438 PPP PPPP PPPP + G PP + P F Sbjct: 460 PPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPQF 503 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 G PPP PPPP PPPP + G PP Sbjct: 467 GPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPP 500 Score = 33.9 bits (74), Expect = 5.8 Identities = 20/59 (33%), Positives = 22/59 (37%), Gaps = 2/59 (3%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXX--XXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 G PPP PPPP PPPP + G PP + P G PPP Sbjct: 445 GPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPP--SGNYGPPPP 501 >UniRef50_Q22715 Cluster: Putative uncharacterized protein; n=3; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 866 Score = 35.9 bits (79), Expect = 1.4 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXG--GPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPP G PP P P+F G PPP Sbjct: 66 PPPVPNGFIPPPPGPGGIPPPPPMFAGGIPPPPPMMGGIPPPPPMF--GAPPPPPP 119 Score = 35.5 bits (78), Expect = 1.9 Identities = 19/51 (37%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXG-GPPXKKXXFPXSXPLFFLGKNN 420 PPP PPPP PPPPP G P + P + L LG N Sbjct: 97 PPPMMGGIPPPPPMFGAPPPPPPPSGLGVAPQPPRPKTPVNPALAKLGGKN 147 Score = 35.1 bits (77), Expect = 2.5 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -2 Query: 600 PXXPXFXXX--PPPPPXXXVKPPPPXXXXPPPXP 505 P P F PPPP + PPPP PPP P Sbjct: 85 PPPPMFAGGIPPPPPMMGGIPPPPPMFGAPPPPP 118 Score = 34.3 bits (75), Expect = 4.4 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXX---PPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPP 411 G PPP PPPP PPPPP+ PP P P LG PP Sbjct: 72 GFIPPPPGPGGIPPPPPMFAGGIPPPPPMMGGIPPPPPMFGAPPPPPPPSGLGVAPQPP 130 >UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 620 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P PPPPP PPPP PPP P Sbjct: 413 PYTPPSPPPPPCPVPCPPPPPPPPPPPCP 441 Score = 33.5 bits (73), Expect = 7.7 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 600 PXXPXFXXXPPPP-PXXXVKPPPPXXXXPPPXP 505 P P PPPP P PPPP PPP P Sbjct: 427 PCPPPPPPPPPPPCPVPCPPPPPPPPPSPPPPP 459 Score = 33.5 bits (73), Expect = 7.7 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPF 502 PPPPP PPPP P P P+ Sbjct: 448 PPPPPPSPPPPPPPPCPIPCPEPY 471 >UniRef50_A7RNZ0 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 370 Score = 35.9 bits (79), Expect = 1.4 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 309 PPPPPYPEQVPPPPPPPPPPPPP 331 Score = 35.1 bits (77), Expect = 2.5 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP + PPP PPP P Sbjct: 299 PPYPAPTPYPPPPPPYPEQVPPPPPPPPPPPP 330 Score = 34.7 bits (76), Expect = 3.3 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPF 502 P + PPP P PPPP PPP P+ Sbjct: 302 PAPTPYPPPPPPYPEQVPPPPPPPPPPPPPPPY 334 Score = 34.3 bits (75), Expect = 4.4 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 + P P PPPPP PPPP P P P Sbjct: 307 YPPPPPPYPEQVPPPPPPPPPPPPPPPYPYPYPYP 341 >UniRef50_A2F7T1 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 659 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 + P P PP PP PPPP PPP P Sbjct: 144 YVPPPPPPSYAPPPQPPSYQQPPPPPQYQQPPPPP 178 Score = 34.3 bits (75), Expect = 4.4 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 L +P P + PPPPP P PP PPP P Sbjct: 135 LSHAPPPPAYVP-PPPPPSYAPPPQPPSYQQPPPPP 169 >UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_115, whole genome shotgun sequence - Paramecium tetraurelia Length = 1084 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP + PPP PPP P G P Sbjct: 555 PPPPPGGLLTAPPPPPPPPPPPPPGGSLTAPP 586 Score = 34.7 bits (76), Expect = 3.3 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXX--XXPPPXPFDGXXXGSP 478 PPPPP + PPPP PPP P G P Sbjct: 590 PPPPPGGRLPPPPPPPPGGMPPPPPMPGRAPPPP 623 Score = 34.3 bits (75), Expect = 4.4 Identities = 20/54 (37%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP PP P P+ G+ PPP Sbjct: 576 PPPGGSLTAPPPPP---PPPPPGGRLPPPPPPPPGGMPPPPPM--PGRAPPPPP 624 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 557 PPPGGLLTAPPPPPPPPPPPPPGGSLTAPPP 587 >UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU01431.1; n=2; Sordariomycetes|Rep: Putative uncharacterized protein NCU01431.1 - Neurospora crassa Length = 1817 Score = 35.9 bits (79), Expect = 1.4 Identities = 20/56 (35%), Positives = 22/56 (39%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXN 402 PPP PPP PPPPP+ G PP P FL +N P N Sbjct: 1099 PPPMPGMAGMPPPP---PPPPPMPGMPGMPPPPPPPMPGPASGRFLAQNAGLPTTN 1151 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXG 484 P P PPPPP P P PPP P G G Sbjct: 1100 PPMPGMAGMPPPPPPPPPMPGMPGMPPPPPPPMPGPASG 1138 Score = 34.3 bits (75), Expect = 4.4 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 G PPP PPPP P P GGPP P G PPP Sbjct: 1058 GGPPPPPPPPPPPPPPPGGLPGAAPPMPGAGGPPPPPPPPPPPPMPGMAGMPPPPPP 1114 Score = 33.5 bits (73), Expect = 7.7 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXP-PPXPFDGXXXGSP 478 P P PPPPP PPPP P P P G P Sbjct: 1021 PSAPAAASGPPPPPPPPPPPPPPPGFLPGAPAPIPGAGGPPP 1062 >UniRef50_Q6C9I8 Cluster: Similar to sp|P41832 Saccharomyces cerevisiae YNL271c BNI1 regulator of budding; n=1; Yarrowia lipolytica|Rep: Similar to sp|P41832 Saccharomyces cerevisiae YNL271c BNI1 regulator of budding - Yarrowia lipolytica (Candida lipolytica) Length = 1851 Score = 35.9 bits (79), Expect = 1.4 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPP GGPP P P F G PPP Sbjct: 1073 PPPPGFTGGPPPPGFTGGPPPP--GFTGGPPPPPP--PPPLPPGFTG--GPPPP 1120 Score = 35.1 bits (77), Expect = 2.5 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPL---TXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPP PPPPP GGPP P F G PPP Sbjct: 1050 PPPPMFTGGPPPMFTGGPPPPPPPPPPGFTGGPPPPGFTGGPPPPGFTGGPPPPPPP 1106 Score = 34.3 bits (75), Expect = 4.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P F PPPP PPP PPP P Sbjct: 1073 PPPPGFTGGPPPPGFTGGPPPPGFTGGPPPPP 1104 Score = 34.3 bits (75), Expect = 4.4 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P F PPPP PPPP PPP P G G P Sbjct: 1082 PPPPGFTGGPPPPGFTGGPPPPP---PPPPLP-PGFTGGPP 1118 Score = 33.9 bits (74), Expect = 5.8 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDG 496 +F P F PPPPP PPP PPP F G Sbjct: 1054 MFTGGPPPMFTGGPPPPPP---PPPPGFTGGPPPPGFTG 1089 Score = 33.5 bits (73), Expect = 7.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P F PPPPP PP PPP P Sbjct: 1091 PPPPGFTGGPPPPPPPPPLPPGFTGGPPPPAP 1122 >UniRef50_Q5AL62 Cluster: Putative uncharacterized protein; n=1; Candida albicans|Rep: Putative uncharacterized protein - Candida albicans (Yeast) Length = 115 Score = 35.9 bits (79), Expect = 1.4 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 F P P PPPPP PPP PPP P Sbjct: 13 FQIPPPPPPPPQPPPPPPQPPPPPPSLLPQPPPPP 47 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 16 PPPPPPPPQPPPPPPQPPPPPPSLLPQPPPP 46 >UniRef50_A7F1V6 Cluster: Putative uncharacterized protein; n=2; Sclerotiniaceae|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 644 Score = 35.9 bits (79), Expect = 1.4 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 449 RTGGKXFFXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGG 574 R GG F G G GGG GGGG GGGGG Sbjct: 214 RKGGMDGFAIGSTRGGGGGGGGGGFGGGGGGGGGGGGGGGGG 255 >UniRef50_Q96S59 Cluster: Ran-binding protein 9; n=51; Euteleostomi|Rep: Ran-binding protein 9 - Homo sapiens (Human) Length = 729 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP PPPP PPP G P Sbjct: 72 PPPPPPATAAPPPPPPPPPPPASAAAPASGPP 103 >UniRef50_P17816 Cluster: Glycine-rich cell wall structural protein precursor; n=14; Magnoliophyta|Rep: Glycine-rich cell wall structural protein precursor - Hordeum vulgare (Barley) Length = 200 Score = 35.9 bits (79), Expect = 1.4 Identities = 20/56 (35%), Positives = 24/56 (42%) Frame = +2 Query: 434 KKKXXRTGGKXFFXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 KK+ G + FF G +G GG GGGG+ GGGGG G G Sbjct: 31 KKEENEAGVENFFHGGGGHHGHGRGGHGGGGYGGGGGY---GGGGGGYPGGGGGYG 83 >UniRef50_UPI00015B541C Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 661 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPPP PPPP PPP Sbjct: 482 PSSPSPPPPPPPPPPPRPPPPPPPPSQPPP 511 Score = 35.5 bits (78), Expect = 1.9 Identities = 20/54 (37%), Positives = 25/54 (46%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PP +PPPP PPPPP+T PP P S P+ + + PPP Sbjct: 516 PPVTYSYPSPPPPPP--PPPPPVTYNYPSPPP-----PPSLPVTYNYPSPPPPP 562 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/53 (30%), Positives = 22/53 (41%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PP +P PP PPPPP PP + + P+ + + PPP Sbjct: 477 PPSRPPSSPSPPPPPPPPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPSPPPPP 529 Score = 34.7 bits (76), Expect = 3.3 Identities = 20/58 (34%), Positives = 24/58 (41%), Gaps = 4/58 (6%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPP----PPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPP PP+T PP P P+ + + PPP Sbjct: 492 PPPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPSPPPPPP--PPPPPVTYNYPSPPPPP 547 Score = 34.3 bits (75), Expect = 4.4 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 478 PSRPPSSPSPPPPPP---PPPPPRPPPPPPPP 506 >UniRef50_UPI00015B52EC Cluster: PREDICTED: similar to ENSANGP00000014755; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to ENSANGP00000014755 - Nasonia vitripennis Length = 333 Score = 35.5 bits (78), Expect = 1.9 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = +2 Query: 455 GGKXFFXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 GG+ G P G GGG GGGG GGGGG G G Sbjct: 121 GGRPGGGGGGFGARPGGGGGGGFGGPGGGGGFGGAGGGGGFGGPGGSAG 169 >UniRef50_UPI0000F1EC5C Cluster: PREDICTED: similar to Ras association (RalGDS/AF-6) and pleckstrin homology domains 1,; n=1; Danio rerio|Rep: PREDICTED: similar to Ras association (RalGDS/AF-6) and pleckstrin homology domains 1, - Danio rerio Length = 1387 Score = 35.5 bits (78), Expect = 1.9 Identities = 17/41 (41%), Positives = 19/41 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P F PPPPP ++ PPP PPP GSP Sbjct: 1044 PQSPEF---PPPPPESTLEFPPPPAPSPPPASQPSGKSGSP 1081 >UniRef50_UPI0000E4A67F Cluster: PREDICTED: similar to rhamnospondin 2; n=2; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to rhamnospondin 2 - Strongylocentrotus purpuratus Length = 1199 Score = 35.5 bits (78), Expect = 1.9 Identities = 20/54 (37%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PP P PPPP PP + P PL L +N PPP Sbjct: 904 PPPGQPISPPPQPPPTFSPPPPPLHHAPLPPPIQENSPFPSPLPVL-QNTPPPP 956 Score = 33.5 bits (73), Expect = 7.7 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = -2 Query: 573 PPPPPXXXVKPP--PPXXXXPPPXP 505 PPPPP + PP PP PPP P Sbjct: 902 PPPPPGQPISPPPQPPPTFSPPPPP 926 >UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to CG33556-PA - Strongylocentrotus purpuratus Length = 1472 Score = 35.5 bits (78), Expect = 1.9 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 2/59 (3%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXS--XPLFFLGKNNXPPP 408 G PPP PPPP PPPP PP FP P F G PPP Sbjct: 463 GGAPPPP-----PPPPFPGGVPPPPPLPGGAPPPPPPPPFPGGGVPPPPFPGGGPPPPP 516 Score = 33.5 bits (73), Expect = 7.7 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPPP PPPPPL G PP P P G + PPP Sbjct: 420 PPPP----PPPPPLPPGVGAPPPPPPPPPPPLP----GGSCIPPP 456 Score = 33.5 bits (73), Expect = 7.7 Identities = 21/59 (35%), Positives = 23/59 (38%), Gaps = 5/59 (8%) Frame = -3 Query: 569 PPPXXXX*NPPPPXX-XXPPPPPLTXXXGG----PPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP GG PP P P+ +G P P Sbjct: 471 PPPFPGGVPPPPPLPGGAPPPPPPPPFPGGGVPPPPFPGGGPPPPPPIGGMGVPRLPGP 529 >UniRef50_UPI0000DC1448 Cluster: UPI0000DC1448 related cluster; n=2; Rattus norvegicus|Rep: UPI0000DC1448 UniRef100 entry - Rattus norvegicus Length = 319 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 F SP P PPPP PP P PPP P Sbjct: 108 FSSPPSPPSPPPPPPPLPPSPSPPSPPPPSPPPLP 142 >UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 3 SCAF14700, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1204 Score = 35.5 bits (78), Expect = 1.9 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 G PPP PPP PPPPP GPP P PL G PPP Sbjct: 624 GAPPPPPP----PPPSAAGLPPPPPPPLPGAGPPP-----PPPPPLPGAGPPPPPPP 671 >UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome shotgun sequence; n=5; Euteleostomi|Rep: Chromosome 3 SCAF14978, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1449 Score = 35.5 bits (78), Expect = 1.9 Identities = 18/44 (40%), Positives = 21/44 (47%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 F SP P PPPPP + PPPP PPP + G+P Sbjct: 1234 FPSPP-PECACFPPPPPASELFPPPP-PPPPPPAGSEAHNRGAP 1275 Score = 33.9 bits (74), Expect = 5.8 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPP---XXXXPPPXPFDGXXXGSP 478 P P PPPPP PPPP PP P GSP Sbjct: 1085 PPAPVTGPTPPPPPPPPPPPPPPAPVTGPTPPAPPLPPGSLGSP 1128 Score = 33.5 bits (73), Expect = 7.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP P PP PPP P Sbjct: 1082 PPPPPAPVTGPTPPPPPPPPPPP 1104 Score = 33.5 bits (73), Expect = 7.7 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 3/57 (5%) Frame = -3 Query: 569 PPPXXXX*NPPPPXX---XXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PP PPL G P KK P S L GK P P Sbjct: 1095 PPPPPPPPPPPPPAPVTGPTPPAPPLPPGSLGSPTKK---PPSSSLNAGGKRPPPTP 1148 >UniRef50_Q4RR29 Cluster: Chromosome 14 SCAF15003, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 14 SCAF15003, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1140 Score = 35.5 bits (78), Expect = 1.9 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 7/71 (9%) Frame = -3 Query: 584 FXGXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGG------PPXKKXXFPXSXPLF-FLGK 426 F G PPP PP P PPPPP GG PP P P+ L K Sbjct: 552 FAGLAPPP------PPLPGAMMPPPPPPPPPPGGPPPPGRPPVSGVPPPPGAPIGPSLKK 605 Query: 425 NNXPPPXNXXK 393 N P P N K Sbjct: 606 KNIPQPSNALK 616 >UniRef50_Q4A2U2 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 858 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 603 SPXXPXFXXXPP-PPPXXXVKPPPPXXXXPPPXP 505 SP P PP PPP PPPP PPP P Sbjct: 736 SPLPPQPSSPPPRPPPTPLFPPPPPPTSPPPPTP 769 >UniRef50_Q06KR7 Cluster: Viral capsid associated protein; n=3; Nucleopolyhedrovirus|Rep: Viral capsid associated protein - Anticarsia gemmatalis nuclear polyhedrosis virus (AgMNPV) Length = 643 Score = 35.5 bits (78), Expect = 1.9 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFD 499 PPPPP PPP PPP P D Sbjct: 366 PPPPPPPPPNMPPPNMPPPPPPPLD 390 >UniRef50_Q39G14 Cluster: TonB-like protein; n=15; Burkholderia|Rep: TonB-like protein - Burkholderia sp. (strain 383) (Burkholderia cepacia (strain ATCC 17760/ NCIB 9086 / R18194)) Length = 232 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPF 502 PPPPP VK PPP PPP PF Sbjct: 78 PPPPPMPVVKLPPP-KFAPPPPPF 100 >UniRef50_Q2W2A9 Cluster: Periplasmic protein TonB, links inner and outer membranes; n=3; Magnetospirillum|Rep: Periplasmic protein TonB, links inner and outer membranes - Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) Length = 313 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PPP P Sbjct: 80 PEPPKPEPPKPPPPPTPAPPPPPTPAPPPPKP 111 >UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding protein; n=1; Magnetospirillum magneticum AMB-1|Rep: RTX toxins and related Ca2+-binding protein - Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) Length = 1274 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 278 PPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPP 309 Score = 35.1 bits (77), Expect = 2.5 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PPPPP P PP PPP P Sbjct: 271 APPPPPPPPPPPPPPPPPPPPSPPAPAPPPPPP 303 Score = 35.1 bits (77), Expect = 2.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PP P PPP P Sbjct: 274 PPPPPPPPPPPPPPPPPPSPPAPAPPPPPPAP 305 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PPP P Sbjct: 279 PPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPP 310 Score = 34.7 bits (76), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PP PP PPPP PPP P Sbjct: 281 PPPPPPPPPPPSPPAPAPPPPPPAPPPPPPAP 312 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGS 481 P P PPPPP PPPP PPP P + S Sbjct: 290 PPSPPAPAPPPPPPA----PPPPPPAPPPPAPVNNDPTSS 325 >UniRef50_Q09084 Cluster: Extensin (Class II) precursor; n=3; Solanum lycopersicum|Rep: Extensin (Class II) precursor - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) Length = 322 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P + PPPP PPPP PPP P Sbjct: 265 SPPPPTYYYSSPPPPSP--SPPPPTYSSPPPPP 295 >UniRef50_Q01A68 Cluster: Chromosome 04 contig 1, DNA sequence; n=1; Ostreococcus tauri|Rep: Chromosome 04 contig 1, DNA sequence - Ostreococcus tauri Length = 538 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 206 PPSPPAPSPPPPPPLVASPPPPSPPPSPPPTP 237 >UniRef50_Q7KW17 Cluster: CG14622-PC, isoform C; n=10; Coelomata|Rep: CG14622-PC, isoform C - Drosophila melanogaster (Fruit fly) Length = 1455 Score = 35.5 bits (78), Expect = 1.9 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 3/62 (4%) Frame = -3 Query: 569 PPPXXXX*NPPPPXX---XXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNX 399 PP PPPP PPPPP PP + P L K N P P N Sbjct: 892 PPMLKAIPPPPPPMAPSMMPPPPPPCPGAPPPPPSMAQTMAPAPPKVDLPKKNVPQPTNP 951 Query: 398 XK 393 K Sbjct: 952 LK 953 >UniRef50_Q5CLH8 Cluster: Protease; n=3; Cryptosporidium|Rep: Protease - Cryptosporidium hominis Length = 1569 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXV-KPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 1531 SPSPPPPPPPPPPPPSSSSPSPPPPPPPLPPPPP 1564 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP PPPPP + PP P P Sbjct: 1525 PPPSSSSPSPPPPPP--PPPPPPSSSSPSPPPPPPPLPPPPP 1564 >UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1126 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 G PPP PPP PPPPP GGPP Sbjct: 559 GGGPPPPPPP--PPPSSGGGPPPPPPPPSSGGPP 590 >UniRef50_Q54H12 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1220 Score = 35.5 bits (78), Expect = 1.9 Identities = 22/56 (39%), Positives = 23/56 (41%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPP 411 G PPP PPP PPPPP GGPP P F L +N PP Sbjct: 605 GGGPPPPP----PPPMMGGGPPPPPPMGGKGGPPP-----PPGGGGFGLFNSNKPP 651 Score = 33.9 bits (74), Expect = 5.8 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 7/61 (11%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGG-------PPXKKXXFPXSXPLFFLGKNNXPP 411 PPP PPP PPPPP GG PP P P GK PP Sbjct: 577 PPPAPPAPPPPPMMGGGPPPPPPPPMMGGGGPPPPPPPPMMGGGPPPPPPMG-GKGGPPP 635 Query: 410 P 408 P Sbjct: 636 P 636 >UniRef50_O02049 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 259 Score = 35.5 bits (78), Expect = 1.9 Identities = 20/51 (39%), Positives = 22/51 (43%) Frame = +2 Query: 455 GGKXFFXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXGXK 607 GG + GD PS G GGG GGG+ GGGGG G K Sbjct: 211 GGGGYGGGGDGGYGPSGGYGGGY--GPGGGYGMGGGGGGGGCPNGECRGKK 259 >UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1027 Score = 35.5 bits (78), Expect = 1.9 Identities = 23/63 (36%), Positives = 24/63 (38%) Frame = -3 Query: 596 FXXXFXGXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNX 417 F F G PPP PPP PPPPP GG P P P +G Sbjct: 409 FLFYFSGPPPPP-------PPPGGVPPPPPPPPPGMGGAPP-----PPPPPPPGMGGGPP 456 Query: 416 PPP 408 PPP Sbjct: 457 PPP 459 Score = 35.5 bits (78), Expect = 1.9 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPP 411 G PPP PPPP PPPP GGPP P P F K P Sbjct: 452 GGGPPPPP----PPPPGPGGGPPPPPPPPGGGPPGPPPP-PAQLPPGFAPKKKYKP 502 Score = 33.5 bits (73), Expect = 7.7 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 7/39 (17%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXX-------PPPXPFDGXXXGSP 478 PPPPP V PPPP PPP P G G P Sbjct: 418 PPPPPPGGVPPPPPPPPPGMGGAPPPPPPPPPGMGGGPP 456 >UniRef50_Q2GRR5 Cluster: Putative uncharacterized protein; n=1; Chaetomium globosum|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 1026 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P F PPP P V PP P PPP P Sbjct: 923 PLFTFPPPPAPPLIVPPPVPLRPVPPPPP 951 >UniRef50_Q0U760 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 580 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP PPPP PP P G P Sbjct: 512 PPPPPPPGTPPPPPPPGSPPDTPGPGPPHPGP 543 >UniRef50_A4RAI7 Cluster: Predicted protein; n=1; Magnaporthe grisea|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 645 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -3 Query: 608 FXPXFXXXFXGXXPPPXXXX*NPPPPXXXXPPPPPL 501 F F + G PPP PPPP PPPP L Sbjct: 319 FPKDFHFLYRGPTPPPPPPPPPPPPPPRPRPPPPKL 354 >UniRef50_A4QSC9 Cluster: Predicted protein; n=2; Fungi/Metazoa group|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 309 Score = 35.5 bits (78), Expect = 1.9 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP KPPP PPP P Sbjct: 177 PPPPPSHTPKPPPSHSPKPPPPP 199 Score = 33.5 bits (73), Expect = 7.7 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 251 PPPPPSSSLPPPPP-----PPPPSSTRPPPPP 277 >UniRef50_Q86UP3 Cluster: Zinc finger homeobox protein 4; n=18; Eukaryota|Rep: Zinc finger homeobox protein 4 - Homo sapiens (Human) Length = 3567 Score = 35.5 bits (78), Expect = 1.9 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLF 438 PPP PPPP PPPPP PP + PLF Sbjct: 1993 PPPTPP---PPPPPPPPPPPPPPPPPPSAPPQVQLPVSLDLPLF 2033 >UniRef50_Q9S8M0 Cluster: Chitin-binding lectin 1 precursor; n=1; Solanum tuberosum|Rep: Chitin-binding lectin 1 precursor - Solanum tuberosum (Potato) Length = 323 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 603 SPXXPXFXXXPPP-PPXXXVKPPPPXXXXPPPXP 505 SP P PPP PP PPPP PPP P Sbjct: 173 SPPPPPPPSPPPPSPPPPSPSPPPPPASPPPPPP 206 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKP-PPPXXXXPPPXP 505 SP P PPPPP P PPP PPP P Sbjct: 165 SPPSPPPPSPPPPPPPSPPPPSPPPPSPSPPPPP 198 Score = 34.3 bits (75), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 SP P PPP P P PP PPP P SP Sbjct: 160 SPPPPSPPSPPPPSPPPPPPPSPPPPSPPPPSPSPPPPPASP 201 >UniRef50_UPI0000DA1F29 Cluster: PREDICTED: hypothetical protein; n=3; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 170 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 497 PSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 P G GGG GGGG GGGGG G G Sbjct: 32 PESGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 66 Score = 33.5 bits (73), Expect = 7.7 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXGXKK 610 G GGG GGGG GGGGG G G ++ Sbjct: 67 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRR 101 >UniRef50_UPI0000DA1F1A Cluster: PREDICTED: hypothetical protein; n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 432 Score = 35.1 bits (77), Expect = 2.5 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFD 499 +P P PPPPP PPPP PPP P D Sbjct: 286 APGGPFGGEAPPPPPP----PPPPPPPPPPPAPRD 316 >UniRef50_UPI0000D56B71 Cluster: PREDICTED: similar to CG8266-PA, isoform A; n=1; Tribolium castaneum|Rep: PREDICTED: similar to CG8266-PA, isoform A - Tribolium castaneum Length = 1148 Score = 35.1 bits (77), Expect = 2.5 Identities = 20/48 (41%), Positives = 23/48 (47%) Frame = -3 Query: 545 NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXN 402 NP P PPPP+T G P +K FP S P + N PPP N Sbjct: 903 NPTPLVPNIQPPPPMTSEMGQPATEK-YFPSSAPGW-----NDPPPLN 944 >UniRef50_UPI0000F30AB8 Cluster: UPI0000F30AB8 related cluster; n=1; Bos taurus|Rep: UPI0000F30AB8 UniRef100 entry - Bos Taurus Length = 617 Score = 35.1 bits (77), Expect = 2.5 Identities = 18/46 (39%), Positives = 20/46 (43%) Frame = -3 Query: 545 NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 +PPPP PPPPPL PP P + P G PPP Sbjct: 22 SPPPPPSTAPPPPPLLESPPPPP------PSTAPALPPGMGALPPP 61 Score = 34.3 bits (75), Expect = 4.4 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP + PP Sbjct: 23 PPPPPSTAPPPPPLLESPPPPPPSTAPALPP 53 >UniRef50_Q9DEH3 Cluster: Diaphanous homologue; n=13; Eumetazoa|Rep: Diaphanous homologue - Gallus gallus (Chicken) Length = 1253 Score = 35.1 bits (77), Expect = 2.5 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXX---PPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPPL GPP P P Sbjct: 716 PPPLPGGTIPPPPPLFGGAVPPPPPLPGGGAGPPPPPPGGPPMAP 760 Score = 34.7 bits (76), Expect = 3.3 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -2 Query: 573 PPPPPXXXVKPPPP--XXXXPPPXPFDGXXXGSP 478 PPP P + PPPP PPP P G G P Sbjct: 716 PPPLPGGTIPPPPPLFGGAVPPPPPLPGGGAGPP 749 >UniRef50_A2A654 Cluster: Fetal Alzheimer antigen; n=8; Mammalia|Rep: Fetal Alzheimer antigen - Mus musculus (Mouse) Length = 3036 Score = 35.1 bits (77), Expect = 2.5 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXG 484 P P P PP PPPP PPP P G G Sbjct: 12 PAAPAAERCAPAPPPPPPPPPPPPPPPPPPPPASGPIGG 50 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.317 0.151 0.481 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 480,291,008 Number of Sequences: 1657284 Number of extensions: 10541120 Number of successful extensions: 192423 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 26369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 99863 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 83621356644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -