BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_O02 (916 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 40 0.003 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 39 0.006 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 38 0.009 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 37 0.026 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 36 0.035 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 35 0.080 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 35 0.080 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 35 0.11 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 34 0.14 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 33 0.24 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 33 0.32 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 32 0.56 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 32 0.56 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 32 0.56 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 32 0.74 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 32 0.74 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 32 0.74 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.74 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.74 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.74 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 32 0.74 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 31 0.98 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 31 0.98 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 31 0.98 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 31 0.98 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 31 1.3 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 31 1.7 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 31 1.7 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 31 1.7 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 31 1.7 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 31 1.7 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 31 1.7 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 31 1.7 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 31 1.7 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 30 2.3 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 30 3.0 SB_58404| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 30 3.0 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 30 3.0 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 29 4.0 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 29 4.0 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 29 4.0 SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 29 4.0 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 29 4.0 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 29 5.2 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 29 5.2 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 29 5.2 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 29 5.2 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 29 6.9 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 29 6.9 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 29 6.9 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 29 6.9 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 29 6.9 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.9 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 29 6.9 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 28 9.2 SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 28 9.2 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/56 (39%), Positives = 23/56 (41%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXN 402 PPP +PPPP PPPPP T PP P P G PPP N Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNG-PPPPPPPTNGPPPPPPPTN 402 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXN 402 PPP PPPP PPPPP PP P P G PPP N Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTN 412 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 356 SPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPP 388 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPP 398 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 377 PPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPP 408 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PPP P Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPP 378 Score = 35.1 bits (77), Expect = 0.080 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 545 NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXN 402 NPPPP PP PP PP P P G PPP N Sbjct: 345 NPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTN 392 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPP 397 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 376 PPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPP 407 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXS 450 PPP PPPP PPPPP PP P S Sbjct: 377 PPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPS 416 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/55 (32%), Positives = 20/55 (36%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXP 414 G PPP PPPP PPPP G P K + G+N P Sbjct: 383 GPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPSEGKCGRKPAGARIINGQNAQP 437 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPP 514 P P PPPPP PPPP PP Sbjct: 387 PPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 32.3 bits (70), Expect = 0.56 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P P PPP PPPP PP P Sbjct: 345 NPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPP 377 Score = 32.3 bits (70), Expect = 0.56 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPPP PPPP PP Sbjct: 386 PPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 388 SPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPP 401 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPP 402 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 401 PPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 36.3 bits (80), Expect = 0.035 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P P PPP PPPP PPP P Sbjct: 377 SPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 36.3 bits (80), Expect = 0.035 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP PPPPP PP P + P Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 35.5 bits (78), Expect = 0.060 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 35.5 bits (78), Expect = 0.060 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPP P +PPPP PPP P Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 35.5 bits (78), Expect = 0.060 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PP PP PPPP PPP P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 35.5 bits (78), Expect = 0.060 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP 456 PPP PPPP PPPPP PP + P Sbjct: 411 PPPPPPPPAPPPPPPPPPPPPPALRLACAPPRLRFTSP 448 Score = 35.1 bits (77), Expect = 0.080 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPP 400 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PP P PPP P Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PPP P Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPP P PPPP PPP P Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P P PPP PPPP PPP P Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PP P PPP P Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP P PP PPP P Sbjct: 399 PPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 400 PPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 33.5 bits (73), Expect = 0.24 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PP P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPP 390 Score = 33.1 bits (72), Expect = 0.32 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPP P PPPP PP P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPP 396 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP PP PP PP P P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PP P PPPPP PP P P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PP PPPP PPPPP PP P P Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 31.5 bits (68), Expect = 0.98 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PP P PPPPP PP P P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 31.5 bits (68), Expect = 0.98 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPP PP P P PPP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 31.5 bits (68), Expect = 0.98 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PP PPPP PPPPP PP P P Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 31.5 bits (68), Expect = 0.98 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 389 PPPPPQP--PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP P PPP PP P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPP PP P P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -1 Query: 568 PPPXXXXKTPPPRXXXPPPXPL*RXXXGVPPXKKXFSP 455 PPP PPP PPP P PP + SP Sbjct: 411 PPPPPPPPAPPPPPPPPPPPPPALRLACAPPRLRFTSP 448 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -3 Query: 539 PPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPPP PP P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPP 396 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P P PPP PP P PP P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPP 398 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 38.7 bits (86), Expect = 0.006 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPF 502 PPPPP PPPP PPP PF Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPF 488 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 36.3 bits (80), Expect = 0.035 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPP 486 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 +P P PPPPP PPPP PPP Sbjct: 463 APPPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 35.1 bits (77), Expect = 0.080 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 G PPP PPPP PPPPP PP Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLT 498 PPP PPPP PPPPP T Sbjct: 472 PPPPPPPPPPPPPPPPFPPPPPPT 495 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPL 441 PPPP PPPPP PP P PL Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTPL 497 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPL 501 PPP PPPP PPP PL Sbjct: 475 PPPPPPPPPPPPPFPPPPPPTPL 497 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 38.7 bits (86), Expect = 0.006 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P + PPPP PPPP PPP P Sbjct: 214 NPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPP 246 Score = 32.3 bits (70), Expect = 0.56 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 P P PPPP PPPPP PP Sbjct: 216 PEPDYLEPTPPPPAAPAPPPPPAAAPPPPPP 246 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P PPPPP PPPP PPP Sbjct: 227 PPAAPAPPPPPAAAPPPPPP----PPP 249 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 P PPP PPPP PPP P Sbjct: 231 PAPPPPPAAAPPPP----PPPPP 249 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP PPPP PPP P G P Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPP 318 Score = 37.1 bits (82), Expect = 0.020 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP PP + P PPP Sbjct: 288 PPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPP 341 Score = 36.7 bits (81), Expect = 0.026 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPP PPPPP GGPP P LG PPP Sbjct: 346 PPPPSMGMAPPPVGGAAPPPPP-PPPVGGPPPPPPPIEGRPP-SSLGNPPPPPP 397 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/54 (35%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPP + PP P P +G PPP Sbjct: 329 PPPSRSSQRPPPPSRGAPPPPSMGM---APPPVGGAAPPPPPPPPVGGPPPPPP 379 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP +PP PPP P Sbjct: 366 PPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPP 397 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP PP P Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPP 318 Score = 33.1 bits (72), Expect = 0.32 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 G PPP PPPP PPPP PP Sbjct: 294 GAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPP 327 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPP PPP P Sbjct: 288 PPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPP 319 Score = 31.9 bits (69), Expect = 0.74 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPP 511 PPPP +PPPP PPP Sbjct: 328 PPPPSRSSQRPPPPSRGAPPP 348 Score = 31.5 bits (68), Expect = 0.98 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXX-XXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPP 411 G PPP PPPP PPPP G PP P P G+ PP Sbjct: 352 GMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPP---PGRGAPPP 405 Score = 31.5 bits (68), Expect = 0.98 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPPPP PP PPP P G P Sbjct: 365 PPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPP 405 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPP--XXXXPPPXP 505 +P P PPPP PPPP PPP P Sbjct: 296 APPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPP 330 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXX---PPPPPLTXXXGGPPXKKXXFP 456 G PPP PPPP PPPPP + PP P Sbjct: 303 GAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAP 346 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXX---XXPPPXPFDGXXXGS 481 +P P PPP PPPP PPP P +G S Sbjct: 345 APPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSS 388 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPP PPP PPP Sbjct: 328 PPPPSRSSQRPPPPSRGAPPPPSMGMAPPP 357 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PP PPPP PPP P Sbjct: 376 PPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGP 407 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 36.7 bits (81), Expect = 0.026 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP PPPP PPP P DG P Sbjct: 305 PPPPPPGGAPPPPPPP--PPPPPGDGGAPPPP 334 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP G PP Sbjct: 305 PPPPPPGGAPPPPP---PPPPPPPGDGGAPP 332 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PPPP PPP PPP P Sbjct: 303 APPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PP PPP P Sbjct: 305 PPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPPP P PP GG P P P G PPP Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPP----GDGGAPPP 333 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 4/27 (14%) Frame = -2 Query: 573 PPPPPX----XXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPP 318 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 36.3 bits (80), Expect = 0.035 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 688 PPPPPPPPPPPPPPQPSTPPPPP 710 Score = 33.1 bits (72), Expect = 0.32 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PP P Sbjct: 687 PPPPPPPPPPPPPPPQPSTPPPP 709 Score = 33.1 bits (72), Expect = 0.32 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPP PPP P Sbjct: 689 PPPPPPPPPPPPPQPSTPPPPPP 711 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPP 514 P P PPPPP PPPP PP Sbjct: 687 PPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 683 PPPPPPPPPPPPPPPP--PPPQP 703 Score = 31.5 bits (68), Expect = 0.98 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPPPP PPP PP G GSP Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSG-APGSP 725 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXS 450 PPP PPP PPPPP T PP ++ P S Sbjct: 690 PPPPPPPPPPPPQPSTPPPPPPST-----PPVQQSGAPGS 724 Score = 28.3 bits (60), Expect = 9.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPP 504 P P PPPP PPPPP Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPP 696 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXP 414 PPPP PPPPP P P + P+ G P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 36.3 bits (80), Expect = 0.035 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 1164 PPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 34.3 bits (75), Expect = 0.14 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPP 511 PPPPP PPPP PPP Sbjct: 1163 PPPPPPSSPSPPPPPPPPPPP 1183 Score = 33.5 bits (73), Expect = 0.24 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP P PP PPP P Sbjct: 1161 PPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 33.1 bits (72), Expect = 0.32 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPP PPP P Sbjct: 1162 PPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 32.3 bits (70), Expect = 0.56 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 1157 PPPPPPPP--PPPPSSPSPPPPP 1177 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLT 498 PPP +P PP PPPPP T Sbjct: 1162 PPPPPPPSSPSPPPPPPPPPPPPT 1185 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLT 498 PPP +PPPP PPPP T Sbjct: 1164 PPPPPSSPSPPPPPPPPPPPPTPT 1187 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLT 498 PPP PPPP PPP P T Sbjct: 1165 PPPPSSPSPPPPPPPPPPPPTPTT 1188 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXP 505 PPPP PPP PPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPP 1178 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP P P PPP P Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPP 1182 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 36.3 bits (80), Expect = 0.035 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP+ PP Sbjct: 188 PPPPSGGPPPPPPPPPPPPPPPILELAAPPP 218 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/52 (36%), Positives = 22/52 (42%), Gaps = 7/52 (13%) Frame = -3 Query: 542 PPPPXXXX----PPPPPLTXXXGGPPXKKXXFPXS---XPLFFLGKNNXPPP 408 PPPP PPPPP+ GGPP P + P L + PPP Sbjct: 140 PPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPP 191 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 +P P PPPP PPPP PPP Sbjct: 178 APAVPLAAASPPPPSGGPPPPPPPPPPPPPP 208 Score = 32.7 bits (71), Expect = 0.43 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPP PP P Sbjct: 187 SPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/26 (50%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = -3 Query: 542 PPPPXXXX----PPPPPLTXXXGGPP 477 PPPP PPPPP+ GGPP Sbjct: 127 PPPPTSPATRAPPPPPPIAPATGGPP 152 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = -2 Query: 627 AXXLXLFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 A + L + P PPPPP PPPP P P Sbjct: 178 APAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPP 218 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P P P PPPP PPP P Sbjct: 169 PIAPAATVPAPAVPLAAASPPPPSGGPPPPPP 200 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 Query: 545 NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP 456 +PPPP PPPPP PP + P Sbjct: 187 SPPPPSGGPPPPPPPPPPPPPPPILELAAP 216 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -1 Query: 568 PPPXXXXKTPPPRXXXPPPXPL*RXXXGVPP 476 PPP PPP PPP P+ PP Sbjct: 189 PPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 35.1 bits (77), Expect = 0.080 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPP P KPPPP PP P GSP Sbjct: 456 PPPLPPDEEKPPPPPAPALPPLPLPPELPGSP 487 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 35.1 bits (77), Expect = 0.080 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P F PPPPP + PPPP PPP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPP---PPPP 670 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXX---XXPPPXPFDGXXXGSP 478 PP P + PPPP PPP P G G P Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPP 678 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 P P PPPP PPPP GG P Sbjct: 645 PNPFFGGIPPPPPGGGMFPPPPPPPPGGGVP 675 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXP-PPPPLTXXXGGPP 477 G PPP PPPP PPPP GGPP Sbjct: 567 GGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPP 601 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 2/59 (3%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXP--PPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 G PP PPP PPPP GGPP P G+ PPP Sbjct: 513 GPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPP 571 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PP PPPP GGPP P G+ PPP Sbjct: 494 PPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPP 538 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPPP PPPP PP P S P K PPP Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPP 250 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP P P P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSP 226 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PP P Sbjct: 209 PRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PP PPP P Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSP 237 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPP P PP PPP Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPP 234 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP +P PPP P Sbjct: 221 PPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIP 252 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P F PPPPP PP P PPP Sbjct: 1247 PKFMGLPPPPPGMRPMPPQPPFMPPPP 1273 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = -3 Query: 584 FXGXXPPPXXXX*NPPPPXXXXPPP---PPLTXXXGGPP 477 F G PPP PP P PPP PP GPP Sbjct: 1249 FMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPP 1287 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PP PPP P Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPP 1257 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PPPPP PPPP PPP P Sbjct: 92 APACPPACCAPPPPP----PPPPPPPPPPPPPP 120 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLT 498 PPP PPPP PPPPP+T Sbjct: 102 PPPPPP---PPPPPPPPPPPPPIT 122 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGG 574 G GGG GGGGF GGGGG Sbjct: 96 GGGGGFGGGGGGGFGGGGGGGGG 118 Score = 32.7 bits (71), Expect = 0.43 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXGXKKSXXKXA 628 G GGG GGGG GGGGG G G S + A Sbjct: 94 GGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFGSRARPA 134 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG GGGGG G G Sbjct: 86 GFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGG 117 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 455 GGKXFFXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGG 574 GG F G G G G GGGGF GGG G Sbjct: 89 GGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGG GGGGG G G Sbjct: 92 GFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGG 123 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.9 bits (74), Expect = 0.18 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP P P P Sbjct: 85 PPPPPPLPAPPPPPAQPAPQPPP 107 Score = 32.7 bits (71), Expect = 0.43 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = -3 Query: 569 PPPXXXX*NPPPPXX--XXPPPPPLTXXXGGPPXKKXXFPXSXPLFFL 432 PPP PPPP PPPPP PP + P P FL Sbjct: 66 PPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPHFL 113 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP 456 PP PPPP PPPPP PP P Sbjct: 77 PPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPHFLP 114 Score = 31.5 bits (68), Expect = 0.98 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXX--VKPPPPXXXXPPPXP 505 +P P PPPP PPPP PPP P Sbjct: 64 APPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPP 98 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPP---XXXXPPPXP 505 +P P PPPP PPPP PPP P Sbjct: 74 APPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAP 109 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 609 FXSPXXPXFXXXPP-PPPXXXVKPPPPXXXXPPP 511 + P P + PP PPP PPPP PPP Sbjct: 94 YPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPP 127 Score = 32.3 bits (70), Expect = 0.56 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 +P P P PPP PPPP PPP Sbjct: 184 NPPYPPPPNPPYPPPPNAPNPPPPNPPYPPP 214 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PP NPPPP PPPP PP P P Sbjct: 196 PPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPP 236 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 + P P P PPP PPPP PPP Sbjct: 174 YPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPP 206 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P P PPP PPPP PPP Sbjct: 106 PPYPPPPNPPYPPPPNAPYPPPPNPPYPPP 135 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = -2 Query: 603 SPXXPXFXXXPPP--PPXXXVKPPPPXXXXPPP 511 +P P PPP PP PPPP PPP Sbjct: 166 NPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPP 198 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPP-PPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXN 402 PPP NPP P PP PPP PP P + P PPP N Sbjct: 176 PPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAP-----NPPYPPPPN 227 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPP PPP P Sbjct: 178 PYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNP 209 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = -2 Query: 585 FXXXPP-PPPXXXVKPPPPXXXXPPPXPF 502 F PP PPP PPPP PP P+ Sbjct: 88 FSPNPPYPPPPYPPYPPPPPYPPPPNPPY 116 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P + P PPP PPPP PPP P Sbjct: 159 PLYPPPPNPPPPNAPYPPPPYP--PPPNP 185 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P P PPP PPPP PP P Sbjct: 192 NPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPP 224 Score = 29.9 bits (64), Expect = 3.0 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXN 402 PPPP PPPPP PP P + P PPP N Sbjct: 95 PPPPYPPYPPPPPYPP----PPNPPYPPPPNAPYPPPPNPPYPPPPN 137 Score = 29.9 bits (64), Expect = 3.0 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 569 PPPXXXX*NPP-PPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP NPP PP P PPP PP +P S + N P P Sbjct: 105 PPPYPPPPNPPYPPPPNAPYPPPPNPPY--PPPPNAPYPPSPNAPYPPPPNPPYP 157 Score = 29.1 bits (62), Expect = 5.2 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 4/59 (6%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPP----PPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXN 402 PP PPPP PP PPP PP P + P PPP N Sbjct: 95 PPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPN 153 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPP 514 +P P P PPP PPPP PP Sbjct: 113 NPPYPPPPNAPYPPPPNPPYPPPPNAPYPP 142 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPP PPP PPP Sbjct: 107 PYPPPPNPPYPPPPNAPYPPPPNPPYPPPP 136 Score = 28.3 bits (60), Expect = 9.2 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPP PPP P P P + N PPP Sbjct: 117 PPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPP 170 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 +P P P PP PPPP PPP Sbjct: 129 NPPYPPPPNAPYPPSPNAPYPPPPNPPYPPP 159 Score = 28.3 bits (60), Expect = 9.2 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXN 402 PP PPPP P PPPL PP +P P PPP N Sbjct: 141 PPSPNAPYPPPPNP--PYPPPLYPPPPNPPPPNAPYP-PPPYPPPPNPPYPPPPN 192 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 L+ P P P PPP PPP PPP P Sbjct: 160 LYPPPPNPPPPNAPYPPPPYP--PPPNPPYPPPPNP 193 Score = 28.3 bits (60), Expect = 9.2 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PP P PP PP PP P P + N PP Sbjct: 168 PPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPP 221 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPP PPP PPP Sbjct: 170 PNAPYPPPPYPPPPNPPYPPPPNPPYPPPP 199 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -2 Query: 573 PPPPPXXXV--KPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP +PPPP PPP P G P Sbjct: 933 PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPP 966 Score = 32.7 bits (71), Expect = 0.43 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 S P P PPP PPPP PPP P Sbjct: 962 SAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 31.5 bits (68), Expect = 0.98 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPPPP PPP P P P G P Sbjct: 945 PPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPP 985 Score = 30.7 bits (66), Expect = 1.7 Identities = 22/56 (39%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = -3 Query: 569 PPPXXXX*NPPPPXX--XXPPP----PPLTXXXGG--PPXKKXXFPXSXPLFFLGK 426 PPP PPPP PPP PPL GG PP P P+ LGK Sbjct: 945 PPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPPMRKLGK 1000 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPP PPPP PPP P Sbjct: 955 PPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPP 986 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 S P PPPPP PPP PP P G P Sbjct: 943 SQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPP 984 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKK 468 G PPP PPP PPPP PP +K Sbjct: 961 GSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPPMRK 997 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPP PPPP PPP F G P Sbjct: 459 PPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPP 490 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 479 GDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 GD G GGG GGGG GGGGG G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 697 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 479 GDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 GD G GGG GGGG GGGGG G G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG GGGGG G G Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG GGGGG G G Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG GGGGG G G Sbjct: 673 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG GGGGG G G Sbjct: 675 GGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 33.1 bits (72), Expect = 0.32 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXGXKKS 613 G GGG GGGG GGGGG G G K+ Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVIKN 880 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG GGGGG G G Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGG 801 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG GGGGG G G Sbjct: 777 GDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYG 808 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +2 Query: 470 FXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGG 574 + GD G GGG GGGG GGGGG Sbjct: 842 YADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGG+ GGGGG G G Sbjct: 794 GGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXGXKKS 613 G GGG GGGG GGGGG G ++S Sbjct: 848 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGVIKNEES 883 Score = 30.3 bits (65), Expect = 2.3 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +2 Query: 455 GGKXFFXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 GG GD G GGG GGGG GGG G G G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGG 817 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G G G GGG+ GGGGG G G Sbjct: 829 GYGDGGGFGDGGGYADGDGGGGGGGGGGGGGG 860 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 479 GDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGG 574 GD GGG GGGG GGGGG Sbjct: 837 GDGGGYADGDGGGGGGGGGGGGGGGGGGGGGG 868 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGG GGGGG G G Sbjct: 837 GDGGGYADGDGGGGGGGGGGGGGGGGGGGGGG 868 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GG G GGGGG G G Sbjct: 796 GGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDG 827 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 499 VKGGGGGXXXXGGGGFYXXXXGGG 570 V GGGGG GGGG GGG Sbjct: 768 VGGGGGGDGGDGGGGGDGGGGGGG 791 Score = 28.3 bits (60), Expect = 9.2 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 457 GKXFFFXGGPPXXXVKGGGGGXXXXGGGGFYXXXXGGG 570 G F GG GGGGG GGGG GGG Sbjct: 833 GGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGG 870 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 32.3 bits (70), Expect = 0.56 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPP 477 PPPP PPPPP GPP Sbjct: 30 PPPPPYEAPPPPPGPPGPDGPP 51 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP P P Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPP 51 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +2 Query: 467 FFXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGG 574 F+ D G GGG GGGG GGGGG Sbjct: 123 FYLVDDDDDGGGGGGGGGGGGGGGGGGGGGGGGGGG 158 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG GGGGG G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG GGGGG G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG GGGGG G G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG GGGGG G G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG GGGGG G G Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXG 592 G GGG GGGG GGG G G Sbjct: 146 GGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 32.3 bits (70), Expect = 0.56 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP + PPPP PPP P Sbjct: 425 PPPPPPAPLPPPPP----PPPQP 443 Score = 28.3 bits (60), Expect = 9.2 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDG 496 PPP P PPPP P P G Sbjct: 428 PPPAPLPPPPPPPPQPTTALPDPLQG 453 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 31.9 bits (69), Expect = 0.74 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 2/59 (3%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPP--LTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 G PP PP PPPPP GGPP P P GK N PPP Sbjct: 337 GQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPP---PGRRPP--SGKINPPPP 390 Score = 31.5 bits (68), Expect = 0.98 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP NPPPP PP T GPP P L PPP Sbjct: 271 PPPKRGSSNPPPPPTRGPPSNSFTTQ--GPPLPPSRDQAPAPPPPLNATPPPPP 322 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -3 Query: 539 PPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP GG P P P G +N PPP Sbjct: 243 PPPGENRPPPPMRGPTSGGEPPPPKNAP---PPPKRGSSNPPPP 283 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = -2 Query: 600 PXXPXFXXXPPPP---PXXXVKPPPPXXXXPPP 511 P P PPPP P +PPPP PPP Sbjct: 241 PAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPP 273 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPF 502 PPPP PPPP PP F Sbjct: 270 PPPPKRGSSNPPPPPTRGPPSNSF 293 Score = 29.1 bits (62), Expect = 5.2 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -3 Query: 569 PPPXXXX*NPPPPXX-XXP-PPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP P PPPPL PP P S P PPP Sbjct: 311 PPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPP-----PISKPPTSTRSAPPPPP 361 Score = 29.1 bits (62), Expect = 5.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPP 514 PPPP + PPPP PP Sbjct: 331 PPPPLRGQIAPPPPPISKPP 350 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 500 SKGXGGGXXXSGGGGFTXXXGGGGG 574 S GGG SGGGG + GG GG Sbjct: 72 SSSTGGGGGFSGGGGGSMGGGGLGG 96 Score = 28.7 bits (61), Expect = 6.9 Identities = 21/63 (33%), Positives = 23/63 (36%), Gaps = 6/63 (9%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXX--XPPPPPLTXXXG----GPPXKKXXFPXSXPLFFLGKNNX 417 G PPP + PPP PPPPP PP P P G+N Sbjct: 193 GPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPP--PGENRP 250 Query: 416 PPP 408 PPP Sbjct: 251 PPP 253 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PP PPPPL PP + P P G+ PPP Sbjct: 301 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPP-LRGQIAPPPP 344 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 31.9 bits (69), Expect = 0.74 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 4/38 (10%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPP----PXXXXPPPXPFD 499 P P PP PP KPPP P PPP P D Sbjct: 556 PPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPPGD 593 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP + PP P P P P Sbjct: 555 PPPPPGVDIPPPLPPSEDPKPPP 577 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 31.9 bits (69), Expect = 0.74 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 2/59 (3%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPP--LTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 G PP PP PPPPP GGPP P P GK N PPP Sbjct: 249 GQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPP---PGRRPP--SGKINPPPP 302 Score = 31.5 bits (68), Expect = 0.98 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP NPPPP PP T GPP P L PPP Sbjct: 183 PPPKRGSSNPPPPPTRGPPSNSFTTQ--GPPLPPSRDQAPAPPPPLNATPPPPP 234 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -3 Query: 539 PPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP GG P P P G +N PPP Sbjct: 155 PPPGENRPPPPMRGPTSGGEPPPPKNAP---PPPKRGSSNPPPP 195 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = -2 Query: 600 PXXPXFXXXPPPP---PXXXVKPPPPXXXXPPP 511 P P PPPP P +PPPP PPP Sbjct: 153 PAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPP 185 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPF 502 PPPP PPPP PP F Sbjct: 182 PPPPKRGSSNPPPPPTRGPPSNSF 205 Score = 29.1 bits (62), Expect = 5.2 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -3 Query: 569 PPPXXXX*NPPPPXX-XXP-PPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP P PPPPL PP P S P PPP Sbjct: 223 PPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPP-----PISKPPTSTRSAPPPPP 273 Score = 29.1 bits (62), Expect = 5.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPP 514 PPPP + PPPP PP Sbjct: 243 PPPPLRGQIAPPPPPISKPP 262 Score = 28.7 bits (61), Expect = 6.9 Identities = 21/63 (33%), Positives = 23/63 (36%), Gaps = 6/63 (9%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXX--XPPPPPLTXXXG----GPPXKKXXFPXSXPLFFLGKNNX 417 G PPP + PPP PPPPP PP P P G+N Sbjct: 105 GPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPP--PGENRP 162 Query: 416 PPP 408 PPP Sbjct: 163 PPP 165 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PP PPPPL PP + P P G+ PPP Sbjct: 213 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPP-LRGQIAPPPP 256 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 31.9 bits (69), Expect = 0.74 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPP 504 PPP PPPP PPPPP Sbjct: 959 PPPIPATQVPPPPLPPLPPPPP 980 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 P PPP + P PP PPP P Sbjct: 906 PAPPPPLPLAPEPPPPLPPPPPP 928 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 +P P PPPP PPP PPP Sbjct: 897 TPTTPKPTTPAPPPPLPLAPEPPPPLPPPPP 927 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPL 501 PPP PPPP PPPPP+ Sbjct: 909 PPPLPLAPEPPPPLP--PPPPPI 929 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPP 511 PPPP + PP P PPP Sbjct: 951 PPPPTSALPPPIPATQVPPP 970 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGP 480 G PPP PPPP PPPP T GP Sbjct: 93 GDPPPPA----TPPPPTMPPTPPPPQTPAPPGP 121 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXGXK 607 G GGG GGGG+ GGG G G G + Sbjct: 314 GRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGRR 347 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 505 GGGGGXXXXGGGGFYXXXXGGG 570 GG GG GGGG Y GGG Sbjct: 313 GGRGGGYRSGGGGGYGGGRGGG 334 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 5/29 (17%) Frame = -2 Query: 573 PPPPPXXXVKPPPP-----XXXXPPPXPF 502 PPPPP PPPP PPP PF Sbjct: 302 PPPPPTDFAPPPPPPEPTSELPPPPPPPF 330 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXF 459 PPPP PPPPP PP F Sbjct: 303 PPPPTDFAPPPPPPEPTSELPPPPPPPF 330 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 31.5 bits (68), Expect = 0.98 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXG 484 PPPPP PPPP PPP G G Sbjct: 867 PPPPPPPP--PPPPPPPPPPPASSTGSTPG 894 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP G P Sbjct: 867 PPPPP----PPPPPPPPPPPPPPASSTGSTP 893 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 P P P PPPP PPP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPP 882 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPP 504 P P PPPP PPPPP Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPP 883 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = -2 Query: 573 PPPPPXXXVKPPPP--XXXXPPPXPFDG 496 PPPP + PPPP PPP P G Sbjct: 197 PPPPGPGGIPPPPPPIRGGVPPPPPMGG 224 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 31.5 bits (68), Expect = 0.98 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPP 511 PPPPP PP P PPP Sbjct: 217 PPPPPTTGAPPPTPVTNKPPP 237 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPP PPPP PP Sbjct: 217 PPPPPTTGAPPPTPVTNKPPPPRPATTQAPP 247 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 31.5 bits (68), Expect = 0.98 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -2 Query: 600 PXXPXFXXX-PPPPPXXXVKPPPPXXXXPPPXPF 502 P P F PPPPP PPPP PP + Sbjct: 201 PPPPGFPGGAPPPPPPPFGAPPPPALNGGPPREY 234 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = -2 Query: 573 PPPP--PXXXVKPPPPXXXXPPPXPFDG 496 PPPP P PPPP PPP +G Sbjct: 201 PPPPGFPGGAPPPPPPPFGAPPPPALNG 228 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPP 477 PPPP PPPP L GGPP Sbjct: 213 PPPPPFGAPPPPAL---NGGPP 231 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 G PPP PPPP PPP G PP Sbjct: 193 GMPPPPPP----PPPPGFPGGAPPPPPPPFGAPP 222 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPPP PPPPP G PP F P Sbjct: 195 PPPP----PPPPPPGFPGGAPPPPPPPFGAPPP 223 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 31.5 bits (68), Expect = 0.98 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXGXK 607 G GGG GGGG+ GGGG G G + Sbjct: 190 GYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGR 223 Score = 28.3 bits (60), Expect = 9.2 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 512 GGGXXXSGGGGFTXXXGGGGG 574 GGG GGGG+ GGGG Sbjct: 150 GGGGYRGGGGGYRGRGRGGGG 170 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.5 bits (68), Expect = 0.98 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKK--XXFPXSXPLF 438 G PP NPPP PPP T G PP P + PLF Sbjct: 81 GDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIQGDPLTIPLF 129 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 G PP NPPP PPP T G PP Sbjct: 51 GDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPP 84 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXP-PPPPLTXXXGGPP 477 PPP PPP P PPP T G PP Sbjct: 63 PPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPP 94 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPP-PPPLTXXXGGPP 477 PPP PPP P PPP T G PP Sbjct: 73 PPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPP 104 Score = 28.3 bits (60), Expect = 9.2 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPP 411 G PP +PPP PPP T G PP P P N PP Sbjct: 41 GDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPP-PNTPIPGDPPPNTPIPGNPPP 95 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P PPPPP PPPP PPP Sbjct: 75 PMMMPFPPPPPIYM--PPPPVYMPPPP 99 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -2 Query: 567 PPPXXXVKPPPPXXXXPPPXP 505 PPP PPPP PPP P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPP 93 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP P P Sbjct: 79 PPPPPPPPPPPPPPPGAKKPDDP 101 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPP 507 PPP PPPP PPPP Sbjct: 73 PPPLCAPPPPPPPPPPPPPPP 93 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXP 517 P PPPPP PPPP P Sbjct: 74 PPLCAPPPPPPPPPPPPPPPGAKKP 98 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PP PP + P PP PP P Sbjct: 324 PTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPP 355 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PP PP + P PP PP P Sbjct: 333 PPAPPNPSIPPAPPNPSIPPAPPNLFIPPATP 364 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/42 (30%), Positives = 15/42 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 P P P PP PP PP+ PP + P P Sbjct: 177 PKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSP 218 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDG 496 L P P PPPPP PPPP PPP P G Sbjct: 55 LMVGPTVPIPPTLPPPPPP----PPPPL---PPPPPSGG 86 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGG 574 G GGG GGGG GGGGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGG 75 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGG 574 G GGG GGGG GGGGG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGG 76 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGG 574 G GGG GGGG GGGGG Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGG 77 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -2 Query: 567 PPPXXXVKPPPPXXXXPPPXP 505 PPP PPPP PPP P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPP 294 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP P P Sbjct: 280 PPPPPPPPPPPPPPPGAKKPDDP 302 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPP 507 PPP PPPP PPPP Sbjct: 274 PPPLCAPPPPPPPPPPPPPPP 294 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXP 517 P PPPPP PPPP P Sbjct: 275 PPLCAPPPPPPPPPPPPPPPGAKKP 299 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDG 496 L P P PPPPP PPPP PPP P G Sbjct: 279 LMVGPTVPIPPTLPPPPPP----PPPPL---PPPPPSGG 310 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGG 574 G GGG GGGG GGGGG Sbjct: 86 GDGGGGDGGGGGGGGDGGGGGGG 108 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 512 GGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 GGG GGGG GGGGG G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGG 91 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG GGG G G G Sbjct: 71 GGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDG 102 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGG GGGGG G G Sbjct: 78 GGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG GGGG G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDG 93 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG G GGG G G Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGG 99 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG GGGG G G Sbjct: 69 GGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGG 100 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG G GG GGGGG G G Sbjct: 77 GGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGG 108 Score = 28.3 bits (60), Expect = 9.2 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +2 Query: 455 GGKXFFXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGG 574 GG GD G GGG GGGG GGGGG Sbjct: 78 GGGGGGDDGDGGGGDGGGGGGGGDGGGGGG-----GGGGG 112 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGG 574 G GGG GGGG GGGGG Sbjct: 343 GGGGGGGGGGGGGGGGGRGGGGG 365 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 485 PXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXG 592 P +G GGG GGGG GGGG G Sbjct: 335 PRGGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRG 370 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 515 GGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 GG GGGG GGGGG + G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGG 365 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXGXKKS 613 G G G +GGGG GGGGG G G + S Sbjct: 32 GHGYGGGPNGGGGGGGGGGGGGGDEDDSGKNGKEYS 67 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG SGGGG GGGGG G G Sbjct: 488 GFGGGGGASGGGG-----GGGGGGGFSGGACG 514 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 503 KGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 +G GGG GGGG GG GG G G Sbjct: 1796 EGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAG 1828 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXG 592 G GGG GGGG GG GG G Sbjct: 1760 GGGGGGGMGGGGGMAGGGGGMGGGGMAAG 1788 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXG-GGGGXXXKXGXXG 601 G GGG +GGG F G GGGG G G Sbjct: 1779 GMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMG 1811 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP P P Sbjct: 56 PPPPPPPPPPPPPPPPSSSPSRP 78 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPP 511 PPPPP PPPP PPP Sbjct: 54 PPPPPP---PPPPPPPPPPPP 71 Score = 28.3 bits (60), Expect = 9.2 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 545 NPPPPXXXXPPPPP 504 +PPPP PPPPP Sbjct: 53 DPPPPPPPPPPPPP 66 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXP 505 PPPP PPPP PPP P Sbjct: 54 PPPPPPPPPPPPP----PPPPP 71 >SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -2 Query: 564 PPXXXVKPPPPXXXXPPPXPFD 499 PP PPPP PPP P D Sbjct: 197 PPPSGAPPPPPIGAPPPPPPDD 218 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXGXK 607 G GG SGGGG+ GG GG G G + Sbjct: 182 GSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGR 215 >SB_58404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 532 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 456 GEXXFFXGGTPXXXRQRGXGGGXXXRGGGVLXXXXGGG 569 G F GG R+ G GG RGGG GGG Sbjct: 438 GNRGGFRGGNERGQRRGGRGGHGPPRGGGGFSGPRGGG 475 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 479 GDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 GD G GGG GG G GGG G G G Sbjct: 439 GDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGG 479 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 SP P PPP P PPP PPP Sbjct: 510 SPPPPPPASPPPPLPAEEDNSPPPLPAGPPP 540 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = -3 Query: 545 NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPL 441 +PPPP PPPP PP P P+ Sbjct: 510 SPPPPPPASPPPPLPAEEDNSPPPLPAGPPPDEPM 544 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 27.1 bits (57), Expect(2) = 3.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPL 501 PP PPPP PPPPPL Sbjct: 712 PPLSSTLGPPPPA---PPPPPL 730 Score = 21.0 bits (42), Expect(2) = 3.5 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = -3 Query: 518 PPPPPLTXXXGGPP 477 PPPPP G P Sbjct: 757 PPPPPAVPGEGARP 770 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPP 511 PPPPP V PPP PP Sbjct: 86 PPPPPASNVPAPPPPPPVMPP 106 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 G PP P P PPPP + GGPP Sbjct: 49 GYGYPPAGGYPPPQPGYAGGPPPPGIAPGIGGPP 82 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPP 514 SP P PPPP V PPPP PP Sbjct: 229 SPKPPTAPPNTPPPP---VTPPPPNTPGPP 255 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP + PPP PPP P Sbjct: 122 PPPPPTGTLPPPP---VTPPPGP 141 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXG--GPPXKKXXFPXSXP 444 PPPP PPPP+T G PP P P Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPP 156 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPPP P PP P P G P Sbjct: 134 PVTPPPGPETPPPPDTPAPPVPPTEAPPTAPPTGGSCVSKP 174 >SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/46 (34%), Positives = 18/46 (39%) Frame = -3 Query: 545 NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 N PPP PPP PP +P + P F N PPP Sbjct: 136 NYPPPGPQAPPPGSTVHYP--PPQTTMGYPSAQPGFAPPGNYPPPP 179 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -3 Query: 542 PPPPXXXXPPPPPL 501 PPPP PPPPPL Sbjct: 1313 PPPPPPPPPPPPPL 1326 Score = 28.3 bits (60), Expect = 9.2 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 545 NPPPPXXXXPPPPP 504 +PPPP PPPPP Sbjct: 1310 SPPPPPPPPPPPPP 1323 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP PP P Sbjct: 1311 PPPPPPPPPPPPPPPL---PPTP 1330 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 512 GGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 GGG GGGG+ G GGG G G Sbjct: 761 GGGGYGGGGGGYRGGGGYGGGHRGGGGYGG 790 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P PP PP PP P PPP Sbjct: 174 PGILAPPPAPPGVLAPPPAPPGVLPPP 200 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = -2 Query: 573 PPPPPXXXVKPP--PPXXXXPPPXP 505 PPP P + PP PP PPP P Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAP 203 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPP-PPXXXXPPP 511 P P PP PP PP PP PPP Sbjct: 181 PAPPGVLAPPPAPPGVLPPPPAPPGALIPPP 211 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 29.1 bits (62), Expect = 5.2 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +2 Query: 455 GGKXFFXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 GGK F G G GG GGG + GGGGG G G Sbjct: 206 GGKAFLNGGVGGRSVWNGVPGGFG-GGGGVWGNGGGGGGGGGYSGGGSG 253 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 478 GGPPXXXVKGGGGGXXXXGGGGFYXXXXGGGXXPXK 585 GGPP +G G GGG F GG P K Sbjct: 510 GGPPRGAPRGRSGPPRGRGGGDFGGRGGRGGTTPGK 545 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/53 (30%), Positives = 21/53 (39%) Frame = +2 Query: 449 RTGGKXFFXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXGXK 607 R+GG + +G GG GGGG+ GGG G + G K Sbjct: 97 RSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGGSK 149 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGG 574 G GGG GGG GGGGG Sbjct: 59 GCGGGNDGGNGGGGAGNGGGGGG 81 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 29.1 bits (62), Expect = 5.2 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXS---XPLFFLGKNNXPPP 408 PPPP PPPPP G PP P P +G PPP Sbjct: 660 PPPP----PPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPP 703 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPP 532 P P PPPPP PPPP Sbjct: 681 PPLPGGAAPPPPPPIGGGAPPPP 703 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXF 459 G PPP PPP PPPP G PP F Sbjct: 673 GGAPPPP-----PPPLPGGAAPPPPPPIGGGAPPPPPPGF 707 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 512 GGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 GGG GGGG T GGGGG G G Sbjct: 333 GGGGATGGGGGVT---GGGGGATGGGGGPG 359 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +2 Query: 512 GGGXXXSGGGGFTXXXGG--GGGXXXKXGXXG 601 GGG GGGG T GG GGG G G Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGGATGGGGG 273 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +2 Query: 512 GGGXXXSGGGGFTXXXGG--GGGXXXKXGXXG 601 GGG GGGG T GG GGG G G Sbjct: 256 GGGGATGGGGGATGGGGGATGGGGGATGGGGG 287 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +2 Query: 512 GGGXXXSGGGGFTXXXGG--GGGXXXKXGXXG 601 GGG GGGG T GG GGG G G Sbjct: 270 GGGGATGGGGGATGGGGGATGGGGGATGGGGG 301 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +2 Query: 512 GGGXXXSGGGGFTXXXGG--GGGXXXKXGXXG 601 GGG GGGG T GG GGG G G Sbjct: 298 GGGGATGGGGGATGVGGGATGGGGGATGGGVG 329 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 503 KGXGGGXXXSGGGGFTXXXGGGGG 574 +G G G GGGGF GGG G Sbjct: 52 RGGGRGGGRGGGGGFKSPRGGGRG 75 Score = 28.7 bits (61), Expect = 6.9 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +2 Query: 479 GDPXXXP-SKGXGGGXXXSGGGGFTXXXGGGGGXXXKXG 592 G P P G GGG GGG GGGGG G Sbjct: 33 GRPGFSPRGAGRGGGRGGPRGGGRGGGRGGGGGFKSPRG 71 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 512 GGGXXXSGGGGFTXXXGGGGG 574 GGG GGGG GGGGG Sbjct: 80 GGGGCGGGGGGGGGVGGGGGG 100 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 512 GGGXXXSGGGGFTXXXGGGGG 574 GGG GGGG GGGGG Sbjct: 81 GGGCGGGGGGGGGVGGGGGGG 101 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 482 DPXXXPSKGXGGGXXXSGGGGFTXXXGGGGG 574 D + G GG GGGG GGGGG Sbjct: 72 DDGGGDTDGGGGCGGGGGGGGGVGGGGGGGG 102 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 515 GGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 GG GGGG GGGGG G G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGG 102 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXG 592 G GGG GG G GGGGG + G Sbjct: 83 GCGGGGGGGGGVGGGGGGGGGGGDDCEDG 111 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = -3 Query: 533 PXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P PPPP G PP P P+ G PPP Sbjct: 236 PPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPP 277 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 28.7 bits (61), Expect = 6.9 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 7/52 (13%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXX-------PPPPPLTXXXGGPPXKKXXFPXSXPLFF 435 PPP PPPP PPPPP G PP PLF+ Sbjct: 718 PPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKPLFW 769 Score = 28.3 bits (60), Expect = 9.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP P P Sbjct: 744 PPPPPGCAGLPPPPPPIDVPMKP 766 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 479 GDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 GD G GG GGG GGGGG G G Sbjct: 70 GDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGG 110 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXG 592 G GGG GGGG G GGG G Sbjct: 89 GGGGGDGDGGGGGDGGGGGDGGGGNDDDG 117 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +2 Query: 512 GGGXXXSGGGGFTXXXGG--GGGXXXKXGXXG 601 GGG GGGG T GG GGG G G Sbjct: 99 GGGGATGGGGGATGGHGGATGGGVGATGGHGG 130 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 479 GDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 GD G GG GGG GGGGG G G Sbjct: 85 GDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGG 125 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXG 592 G GGG GGGG G GGG G Sbjct: 104 GGGGGDGDGGGGGDGGGGGDGGGGNDDDG 132 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 28.7 bits (61), Expect = 6.9 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 542 PPPPXXXXPPPPPL 501 PPPP PPPPP+ Sbjct: 212 PPPPPPPPPPPPPM 225 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG GGGGG G G Sbjct: 306 GDGGGGGDGGGGG-----GGGGGGGGDGGGDG 332 >SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1128 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPP 514 PPPP PPPP PP Sbjct: 104 PPPPATTSAPPPPTTTAPP 122 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDG 496 PPPPP P PP PPP P G Sbjct: 303 PPPPPLPAGVPAPP---PPPPPPMLG 325 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = -2 Query: 600 PXXPXFXXXPPP-PPXXXVKPPPPXXXXPPPXP 505 P P PP PP +P PP PPP P Sbjct: 858 PLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPP 890 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 28.3 bits (60), Expect = 9.2 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = +2 Query: 452 TGGKXFFXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGG 574 TGGK F G+ + GG GGG GGGGG Sbjct: 2303 TGGKSFLNGGEGGESRAGPVGG---FGGGGSSRIRPGGGGG 2340 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.317 0.151 0.481 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,180,665 Number of Sequences: 59808 Number of extensions: 271793 Number of successful extensions: 5758 Number of sequences better than 10.0: 84 Number of HSP's better than 10.0 without gapping: 558 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2622 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2645618622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -