BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_O02 (916 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 46 3e-05 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 45 6e-05 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 41 0.001 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 41 0.001 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 41 0.001 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 41 0.001 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 41 0.001 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 40 0.002 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 39 0.005 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 38 0.007 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 38 0.007 At2g30560.1 68415.m03722 glycine-rich protein 38 0.009 At1g75550.1 68414.m08780 glycine-rich protein 38 0.012 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 37 0.021 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 37 0.021 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 36 0.028 At5g38560.1 68418.m04662 protein kinase family protein contains ... 36 0.037 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 36 0.037 At1g21310.1 68414.m02662 proline-rich extensin-like family prote... 36 0.037 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 35 0.065 At4g18570.1 68417.m02749 proline-rich family protein common fami... 35 0.086 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 35 0.086 At2g04190.1 68415.m00404 meprin and TRAF homology domain-contain... 35 0.086 At1g24490.1 68414.m03084 60 kDa inner membrane family protein si... 35 0.086 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 34 0.11 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 34 0.11 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 34 0.11 At5g67060.1 68418.m08455 basic helix-loop-helix (bHLH) family pr... 34 0.15 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 34 0.15 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 34 0.15 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 33 0.20 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 33 0.20 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 33 0.20 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 33 0.20 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 33 0.26 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 33 0.26 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 33 0.26 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 33 0.26 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 33 0.26 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 33 0.26 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 33 0.26 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 33 0.35 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 32 0.46 At5g48050.1 68418.m05937 hypothetical protein low similarity to ... 32 0.46 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 32 0.46 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 32 0.46 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 32 0.46 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 32 0.46 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 32 0.46 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 32 0.46 At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) fa... 32 0.46 At3g05920.1 68416.m00668 heavy-metal-associated domain-containin... 32 0.46 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 32 0.46 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 32 0.61 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 32 0.61 At4g16240.1 68417.m02464 hypothetical protein 32 0.61 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 32 0.61 At3g18810.1 68416.m02389 protein kinase family protein contains ... 32 0.61 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 32 0.61 At1g61080.1 68414.m06877 proline-rich family protein 32 0.61 At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp... 32 0.61 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 32 0.61 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 31 0.81 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 31 0.81 At4g30460.1 68417.m04325 glycine-rich protein 31 0.81 At4g08400.1 68417.m01388 proline-rich extensin-like family prote... 31 0.81 At1g27710.1 68414.m03387 glycine-rich protein 31 0.81 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 31 0.81 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 31 1.1 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 31 1.1 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 31 1.1 At5g35190.1 68418.m04170 proline-rich extensin-like family prote... 31 1.1 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 31 1.1 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 31 1.1 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 31 1.1 At3g29390.1 68416.m03693 hydroxyproline-rich glycoprotein family... 31 1.1 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 31 1.1 At1g70990.1 68414.m08190 proline-rich family protein 31 1.1 At1g26150.1 68414.m03192 protein kinase family protein similar t... 31 1.1 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 31 1.4 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 31 1.4 At5g06640.1 68418.m00750 proline-rich extensin-like family prote... 31 1.4 At4g08410.1 68417.m01390 proline-rich extensin-like family prote... 31 1.4 At4g01985.1 68417.m00265 expressed protein 31 1.4 At3g54590.1 68416.m06040 proline-rich extensin-like family prote... 31 1.4 At3g54580.1 68416.m06039 proline-rich extensin-like family prote... 31 1.4 At3g24550.1 68416.m03083 protein kinase family protein contains ... 31 1.4 At3g08640.1 68416.m01003 alphavirus core protein family contains... 31 1.4 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 31 1.4 At1g76930.2 68414.m08956 proline-rich extensin-like family prote... 31 1.4 At1g76930.1 68414.m08955 proline-rich extensin-like family prote... 31 1.4 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 31 1.4 At5g49080.1 68418.m06074 proline-rich extensin-like family prote... 30 1.9 At5g46730.1 68418.m05757 glycine-rich protein 30 1.9 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 30 1.9 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 30 1.9 At5g06630.1 68418.m00749 proline-rich extensin-like family prote... 30 1.9 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 30 1.9 At4g32640.1 68417.m04646 sec23/sec24 transport protein-related 30 1.9 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 30 1.9 At4g08230.1 68417.m01358 glycine-rich protein 30 1.9 At3g51290.1 68416.m05614 proline-rich family protein 30 1.9 At2g24980.1 68415.m02987 proline-rich extensin-like family prote... 30 1.9 At1g29380.1 68414.m03592 hypothetical protein 30 1.9 At1g22420.1 68414.m02803 hydroxyproline-rich glycoprotein family... 30 1.9 At1g15830.1 68414.m01900 expressed protein 30 1.9 At1g02710.1 68414.m00222 glycine-rich protein 30 1.9 At4g21720.1 68417.m03145 expressed protein 30 2.5 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 30 2.5 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 30 2.5 At1g70250.1 68414.m08082 receptor serine/threonine kinase, putat... 30 2.5 At1g15840.1 68414.m01901 expressed protein 30 2.5 At1g07135.1 68414.m00759 glycine-rich protein 30 2.5 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 29 3.2 At4g03390.1 68417.m00461 leucine-rich repeat transmembrane prote... 29 3.2 At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar... 29 3.2 At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, ... 29 3.2 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 29 3.2 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 29 3.2 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 29 3.2 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 29 4.3 At5g19900.1 68418.m02368 PRLI-interacting factor, putative stron... 29 4.3 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 29 4.3 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 29 4.3 At4g33660.1 68417.m04781 expressed protein 29 4.3 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 29 4.3 At3g05220.2 68416.m00570 heavy-metal-associated domain-containin... 29 4.3 At3g05220.1 68416.m00569 heavy-metal-associated domain-containin... 29 4.3 At2g30505.1 68415.m03716 Expressed protein 29 4.3 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 29 4.3 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 29 4.3 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 29 4.3 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 29 4.3 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 29 4.3 At1g49270.1 68414.m05524 protein kinase family protein contains ... 29 4.3 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 29 5.7 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 29 5.7 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 29 5.7 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 29 5.7 At3g50180.1 68416.m05486 hypothetical protein 29 5.7 At3g49300.1 68416.m05388 proline-rich family protein contains pr... 29 5.7 At3g13225.1 68416.m01660 WW domain-containing protein contains P... 29 5.7 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 29 5.7 At2g05510.1 68415.m00583 glycine-rich protein 29 5.7 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 29 5.7 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 29 5.7 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 29 5.7 At1g23540.1 68414.m02960 protein kinase family protein contains ... 29 5.7 At1g11850.2 68414.m01364 expressed protein 29 5.7 At5g65410.1 68418.m08226 zinc finger homeobox family protein / Z... 28 7.5 At5g64430.1 68418.m08093 octicosapeptide/Phox/Bem1p (PB1) domain... 28 7.5 At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family prot... 28 7.5 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 28 7.5 At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family... 28 7.5 At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) s... 28 7.5 At3g08630.1 68416.m01002 expressed protein 28 7.5 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 28 7.5 At2g23770.1 68415.m02839 protein kinase family protein / peptido... 28 7.5 At2g05440.2 68415.m00575 glycine-rich protein 28 7.5 At2g05440.1 68415.m00574 glycine-rich protein 28 7.5 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 28 7.5 At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family... 28 7.5 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 28 7.5 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 28 9.9 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 28 9.9 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 28 9.9 At4g18020.3 68417.m02683 pseudo-response regulator 2 (APRR2) (TO... 28 9.9 At4g18020.2 68417.m02682 pseudo-response regulator 2 (APRR2) (TO... 28 9.9 At4g18020.1 68417.m02681 pseudo-response regulator 2 (APRR2) (TO... 28 9.9 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 28 9.9 At3g50650.1 68416.m05540 scarecrow-like transcription factor 7 (... 28 9.9 At3g26400.1 68416.m03292 eukaryotic translation initiation facto... 28 9.9 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 28 9.9 At3g15400.1 68416.m01954 anther development protein, putative si... 28 9.9 At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ b... 28 9.9 At2g39750.1 68415.m04881 dehydration-responsive family protein s... 28 9.9 At2g39250.1 68415.m04820 AP2 domain-containing transcription fac... 28 9.9 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 28 9.9 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 28 9.9 At1g12810.1 68414.m01488 proline-rich family protein contains pr... 28 9.9 At1g10620.1 68414.m01204 protein kinase family protein contains ... 28 9.9 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 46.0 bits (104), Expect = 3e-05 Identities = 29/123 (23%), Positives = 41/123 (33%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP +PPPP PPPP PP + P ++ K+ PPP Sbjct: 151 PPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 210 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXXXS 210 P + + + + + PP + PP PP+ S Sbjct: 211 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYK-SPPPPPYVYSS 269 Query: 209 PPP 201 PPP Sbjct: 270 PPP 272 Score = 44.8 bits (101), Expect = 8e-05 Identities = 34/140 (24%), Positives = 44/140 (31%), Gaps = 3/140 (2%) Frame = -2 Query: 612 LFXSPXXPXFXXX-PPPPPXXXVKPPPP--XXXXPPPXPFDGXXXGSPXXXXXXXXXXXX 442 ++ SP P + PPPPP PPPP PPP P+ SP Sbjct: 66 IYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPY---VYKSPPPPPYVYSSPPP 122 Query: 441 XXXXXKQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPX 262 K PPP P + +P P + PP Sbjct: 123 PPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPP 182 Query: 261 XPFFXLXPPFXPFLXXXPPP 202 P+ PP P++ PPP Sbjct: 183 PPYVYSSPPPPPYVYKSPPP 202 Score = 43.6 bits (98), Expect = 2e-04 Identities = 32/135 (23%), Positives = 39/135 (28%), Gaps = 2/135 (1%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXX--PPPXPFDGXXXGSPXXXXXXXXXXXXXXXXX 427 P P PPPPP PPPP PPP P+ SP Sbjct: 91 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPY---VYKSPPPPPYVYSSPPPPPYVY 147 Query: 426 KQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPFFX 247 K PPP P + + P + PP P+ Sbjct: 148 SSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 207 Query: 246 LXPPFXPFLXXXPPP 202 PP P++ PPP Sbjct: 208 SSPPPPPYVYKSPPP 222 Score = 43.2 bits (97), Expect = 2e-04 Identities = 28/123 (22%), Positives = 40/123 (32%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP +PPPP PPP PP + P ++ K+ PPP Sbjct: 111 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPP 170 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXXXS 210 P + + + + + PP + PP PP+ S Sbjct: 171 PPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYK-SPPPPPYVYSS 229 Query: 209 PPP 201 PPP Sbjct: 230 PPP 232 Score = 43.2 bits (97), Expect = 2e-04 Identities = 33/139 (23%), Positives = 41/139 (29%), Gaps = 2/139 (1%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVK--PPPPXXXXPPPXPFDGXXXGSPXXXXXXXXXXXXX 439 ++ SP P + PPPP K PPPP PPP P SP Sbjct: 136 VYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPP--PYVYQSPPPPPYVYSSPPPP 193 Query: 438 XXXXKQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXX 259 K PPP P + P + PP Sbjct: 194 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 253 Query: 258 PFFXLXPPFXPFLXXXPPP 202 P+ PP P++ PPP Sbjct: 254 PYVYKSPPPPPYVYSSPPP 272 Score = 42.7 bits (96), Expect = 3e-04 Identities = 29/136 (21%), Positives = 42/136 (30%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP +PPPP PPP PP + P ++ K+ PPP Sbjct: 231 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 290 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXXXS 210 P + + + + + PP + PP P S Sbjct: 291 PPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYS 350 Query: 209 PPPXFFXXPPXXFXKK 162 PPP + P + K Sbjct: 351 PPPAPYVYKPPPYVYK 366 Score = 42.3 bits (95), Expect = 4e-04 Identities = 29/123 (23%), Positives = 40/123 (32%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP PPPP PPPP PP + P ++ K+ PPP Sbjct: 62 PPPYIYSSPPPPPYVYSSPPPP-PYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 120 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXXXS 210 P + + + + + PP + PP PP+ S Sbjct: 121 PPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYK-SPPPPPYVYSPPPPPPYVYQS 179 Query: 209 PPP 201 PPP Sbjct: 180 PPP 182 Score = 42.3 bits (95), Expect = 4e-04 Identities = 31/132 (23%), Positives = 37/132 (28%), Gaps = 2/132 (1%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXX--PPPXPFDGXXXGSPXXXXXXXXXXXXXXXXXKQX 418 P PPPPP PPPP PPP P+ SP Sbjct: 64 PYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPY---VYSSPPPPPYVYKSPPPPPYVYSSP 120 Query: 417 XXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPFFXLXP 238 K PPP P + P + PP P+ P Sbjct: 121 PPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSP 180 Query: 237 PFXPFLXXXPPP 202 P P++ PPP Sbjct: 181 PPPPYVYSSPPP 192 Score = 41.9 bits (94), Expect = 6e-04 Identities = 28/123 (22%), Positives = 39/123 (31%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP +PPPP PPP PP + P ++ K+ PPP Sbjct: 81 PPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 140 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXXXS 210 P + + + + PP + PP PP+ S Sbjct: 141 PPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQ-SPPPPPYVYSSPPPPPYVYKS 199 Query: 209 PPP 201 PPP Sbjct: 200 PPP 202 Score = 41.9 bits (94), Expect = 6e-04 Identities = 27/133 (20%), Positives = 41/133 (30%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP +PPPP PPP PP + P ++ + PPP Sbjct: 241 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSP 300 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXXXS 210 P + + + + + PP + PP P+ Sbjct: 301 PPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPAPY-VYK 359 Query: 209 PPPXFFXXPPXXF 171 PPP + PP + Sbjct: 360 PPPYVYKPPPYVY 372 Score = 41.5 bits (93), Expect = 8e-04 Identities = 31/137 (22%), Positives = 41/137 (29%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSPXXXXXXXXXXXXXXX 433 ++ SP P + P PP KPPP PPP P+ SP Sbjct: 41 VYNSP--PPYVYNSPSPPPYVYKPPPYIYSSPPPPPY---VYSSPPPPPYVYNSPPPPPY 95 Query: 432 XXKQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPF 253 K PPP P + + P + PP P+ Sbjct: 96 VYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPY 155 Query: 252 FXLXPPFXPFLXXXPPP 202 PP P++ PPP Sbjct: 156 VYKSPPPPPYVYSPPPP 172 Score = 41.5 bits (93), Expect = 8e-04 Identities = 27/123 (21%), Positives = 39/123 (31%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP +PPPP PPP PP + P ++ + PPP Sbjct: 221 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 280 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXXXS 210 P + + + + + PP + PP PP+ S Sbjct: 281 PPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYK-SPPPPPYVYTSPPPPPYVYKS 339 Query: 209 PPP 201 PPP Sbjct: 340 PPP 342 Score = 36.7 bits (81), Expect = 0.021 Identities = 29/131 (22%), Positives = 40/131 (30%), Gaps = 1/131 (0%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP PPP PPPPP PP P P ++ + PPP Sbjct: 55 PPPYVY--KPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPP--YVYSSPPPPPYVYKSP 110 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSP-PFXXX 213 P + + + + + PP + PP P + Sbjct: 111 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPP 170 Query: 212 SPPPXFFXXPP 180 PPP + PP Sbjct: 171 PPPPYVYQSPP 181 Score = 36.7 bits (81), Expect = 0.021 Identities = 31/142 (21%), Positives = 38/142 (26%), Gaps = 2/142 (1%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPP--XXXXPPPXPFDGXXXGSPXXXXXXXXXXXXXXXXX 427 P P PPPPP PPPP PPP P+ P Sbjct: 271 PPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPY--VYSSPPPPPYVYKSPPPPPYVYT 328 Query: 426 KQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPFFX 247 PPP P + + P P + PP P+ Sbjct: 329 SPPPPPYVYKSPPPPPYVDSYSPPPAP---YVYKPPPYVYKP--PPYVYNYSPPPAPYVY 383 Query: 246 LXPPFXPFLXXXPPPRXFFXPP 181 PP+ P P + PP Sbjct: 384 KPPPYVYSYSPPPAPYVYKPPP 405 Score = 36.7 bits (81), Expect = 0.021 Identities = 33/151 (21%), Positives = 45/151 (29%), Gaps = 7/151 (4%) Frame = -2 Query: 612 LFXSPXXPXFXXX-PPPPPXXXVKPPPP--XXXXPPPXPFDGXXXGSPXXXXXXXXXXXX 442 ++ SP P + PPPPP PPPP PPP P+ SP Sbjct: 276 VYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPY---VYKSPPPPPYVYTSPPP 332 Query: 441 XXXXXKQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFF-XXNPFF---XPXFFXX 274 K PPP+ + + P+ P + Sbjct: 333 PPYVYKSPPPPPYVDSYSPPPAPYVYKPPPYVYKPPPYVYNYSPPPAPYVYKPPPYVYSY 392 Query: 273 XPPXXPFFXLXPPFXPFLXXXPPPRXFFXPP 181 PP P+ PP+ P P + PP Sbjct: 393 SPPPAPYVYKPPPYVYSYSPPPAPYVYKPPP 423 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPP--XXXXPPPXPF 502 P P PPPPP PPPP PPP P+ Sbjct: 241 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPY 275 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPP--XXXXPPPXPF 502 P P PPPPP PPPP PPP P+ Sbjct: 251 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 285 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPP--XXXXPPPXPF 502 P P PPPPP PPPP PPP P+ Sbjct: 261 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPY 295 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 45.2 bits (102), Expect = 6e-05 Identities = 32/135 (23%), Positives = 39/135 (28%), Gaps = 2/135 (1%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPP--XXXXPPPXPFDGXXXGSPXXXXXXXXXXXXXXXXX 427 P P PPPPP PPPP PPP P+ SP Sbjct: 281 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY---VYSSPPPPPYVYKSPPPPPYVY 337 Query: 426 KQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPFFX 247 K PPP P + + P + PP P+ Sbjct: 338 NSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 397 Query: 246 LXPPFXPFLXXXPPP 202 PP P++ PPP Sbjct: 398 SSPPPPPYVYKSPPP 412 Score = 44.8 bits (101), Expect = 8e-05 Identities = 32/135 (23%), Positives = 39/135 (28%), Gaps = 2/135 (1%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXX--PPPXPFDGXXXGSPXXXXXXXXXXXXXXXXX 427 P P PPPPP PPPP PPP P+ SP Sbjct: 61 PPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPY---VYSSPPPPPYIYKSPPPPPYVY 117 Query: 426 KQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPFFX 247 K PPP P + + P + PP P+ Sbjct: 118 SSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 177 Query: 246 LXPPFXPFLXXXPPP 202 PP P++ PPP Sbjct: 178 SSPPPPPYVYKSPPP 192 Score = 44.8 bits (101), Expect = 8e-05 Identities = 32/135 (23%), Positives = 39/135 (28%), Gaps = 2/135 (1%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXX--PPPXPFDGXXXGSPXXXXXXXXXXXXXXXXX 427 P P PPPPP PPPP PPP P+ SP Sbjct: 81 PPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPY---VYSSPPPPPYVYKSPPPPPYVY 137 Query: 426 KQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPFFX 247 K PPP P + + P + PP P+ Sbjct: 138 NSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 197 Query: 246 LXPPFXPFLXXXPPP 202 PP P++ PPP Sbjct: 198 SSPPPPPYVYKSPPP 212 Score = 44.8 bits (101), Expect = 8e-05 Identities = 32/135 (23%), Positives = 39/135 (28%), Gaps = 2/135 (1%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXX--PPPXPFDGXXXGSPXXXXXXXXXXXXXXXXX 427 P P PPPPP PPPP PPP P+ SP Sbjct: 101 PPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPY---VYNSPPPPPYVYKSPPPPPYVY 157 Query: 426 KQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPFFX 247 K PPP P + + P + PP P+ Sbjct: 158 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 217 Query: 246 LXPPFXPFLXXXPPP 202 PP P++ PPP Sbjct: 218 SSPPPPPYVYKSPPP 232 Score = 44.4 bits (100), Expect = 1e-04 Identities = 32/135 (23%), Positives = 39/135 (28%), Gaps = 2/135 (1%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXX--PPPXPFDGXXXGSPXXXXXXXXXXXXXXXXX 427 P P PPPPP PPPP PPP P+ SP Sbjct: 141 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY---VYSSPPPPPYVYKSPPPPPYVY 197 Query: 426 KQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPFFX 247 K PPP P + + P + PP P+ Sbjct: 198 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 257 Query: 246 LXPPFXPFLXXXPPP 202 PP P++ PPP Sbjct: 258 SSPPPPPYVYKSPPP 272 Score = 44.4 bits (100), Expect = 1e-04 Identities = 32/135 (23%), Positives = 39/135 (28%), Gaps = 2/135 (1%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXX--PPPXPFDGXXXGSPXXXXXXXXXXXXXXXXX 427 P P PPPPP PPPP PPP P+ SP Sbjct: 161 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY---VYSSPPPPPYVYKSPPPPPYVY 217 Query: 426 KQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPFFX 247 K PPP P + + P + PP P+ Sbjct: 218 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 277 Query: 246 LXPPFXPFLXXXPPP 202 PP P++ PPP Sbjct: 278 SSPPPPPYVYKSPPP 292 Score = 44.4 bits (100), Expect = 1e-04 Identities = 32/135 (23%), Positives = 39/135 (28%), Gaps = 2/135 (1%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXX--PPPXPFDGXXXGSPXXXXXXXXXXXXXXXXX 427 P P PPPPP PPPP PPP P+ SP Sbjct: 181 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY---VYSSPPPPPYVYKSPPPPPYVY 237 Query: 426 KQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPFFX 247 K PPP P + + P + PP P+ Sbjct: 238 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 297 Query: 246 LXPPFXPFLXXXPPP 202 PP P++ PPP Sbjct: 298 SSPPPPPYVYKSPPP 312 Score = 44.4 bits (100), Expect = 1e-04 Identities = 32/135 (23%), Positives = 39/135 (28%), Gaps = 2/135 (1%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXX--PPPXPFDGXXXGSPXXXXXXXXXXXXXXXXX 427 P P PPPPP PPPP PPP P+ SP Sbjct: 301 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY---VYNSPPPPPYVYKSPPPPPYVY 357 Query: 426 KQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPFFX 247 K PPP P + + P + PP P+ Sbjct: 358 SSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 417 Query: 246 LXPPFXPFLXXXPPP 202 PP P++ PPP Sbjct: 418 SSPPPPPYVYKSPPP 432 Score = 44.0 bits (99), Expect = 1e-04 Identities = 32/135 (23%), Positives = 39/135 (28%), Gaps = 2/135 (1%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXX--PPPXPFDGXXXGSPXXXXXXXXXXXXXXXXX 427 P P PPPPP PPPP PPP P+ SP Sbjct: 121 PPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPY---VYSSPPPPPYVYKSPPPPPYVY 177 Query: 426 KQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPFFX 247 K PPP P + + P + PP P+ Sbjct: 178 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 237 Query: 246 LXPPFXPFLXXXPPP 202 PP P++ PPP Sbjct: 238 SSPPPPPYVYKSPPP 252 Score = 43.6 bits (98), Expect = 2e-04 Identities = 31/126 (24%), Positives = 37/126 (29%), Gaps = 2/126 (1%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXX--PPPXPFDGXXXGSPXXXXXXXXXXXXXXXXXKQXXXXXXP 400 PPPPP PPPP PPP P+ SP Sbjct: 50 PPPPPYVYSSPPPPPYIYKSPPPPPY---VYSSPPPPPYIYKSPPPPPYVYSSPPPPPYI 106 Query: 399 XKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPFFXLXPPFXPFL 220 K PPP P + N P + PP P+ PP P++ Sbjct: 107 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYV 166 Query: 219 XXXPPP 202 PPP Sbjct: 167 YKSPPP 172 Score = 43.2 bits (97), Expect = 2e-04 Identities = 28/123 (22%), Positives = 40/123 (32%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP +PPPP PPP PP + P ++ K+ PPP Sbjct: 61 PPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSP 120 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXXXS 210 P + + + + + PP + PP PP+ S Sbjct: 121 PPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYK-SPPPPPYVYSS 179 Query: 209 PPP 201 PPP Sbjct: 180 PPP 182 Score = 43.2 bits (97), Expect = 2e-04 Identities = 32/125 (25%), Positives = 40/125 (32%), Gaps = 2/125 (1%) Frame = -3 Query: 569 PPPXXXX*NPPPPXX--XXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXX 396 PPP +PPPP PPPPP PP P P + N+ PPP Sbjct: 291 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY---NSPPPPPYVY 347 Query: 395 KXXXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXX 216 K P + + + PP + PP PP+ Sbjct: 348 KSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY 407 Query: 215 XSPPP 201 SPPP Sbjct: 408 KSPPP 412 Score = 42.7 bits (96), Expect = 3e-04 Identities = 28/123 (22%), Positives = 40/123 (32%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP +PPPP PPP PP + P ++ K+ PPP Sbjct: 141 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 200 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXXXS 210 P + + + + + PP + PP PP+ S Sbjct: 201 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYK-SPPPPPYVYSS 259 Query: 209 PPP 201 PPP Sbjct: 260 PPP 262 Score = 42.7 bits (96), Expect = 3e-04 Identities = 28/123 (22%), Positives = 40/123 (32%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP +PPPP PPP PP + P ++ K+ PPP Sbjct: 221 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 280 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXXXS 210 P + + + + + PP + PP PP+ S Sbjct: 281 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYK-SPPPPPYVYNS 339 Query: 209 PPP 201 PPP Sbjct: 340 PPP 342 Score = 42.7 bits (96), Expect = 3e-04 Identities = 28/123 (22%), Positives = 40/123 (32%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP +PPPP PPP PP + P ++ K+ PPP Sbjct: 301 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSP 360 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXXXS 210 P + + + + + PP + PP PP+ S Sbjct: 361 PPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYK-SPPPPPYVYSS 419 Query: 209 PPP 201 PPP Sbjct: 420 PPP 422 Score = 42.7 bits (96), Expect = 3e-04 Identities = 34/144 (23%), Positives = 42/144 (29%), Gaps = 4/144 (2%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXX--PPPXPFDGXXXGSPXXXXXXXXXXXXXXXXX 427 P P PPPPP PPPP PPP P+ SP Sbjct: 321 PPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPY---VYSSPPPSPYVYKSPPPPPYVY 377 Query: 426 KQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPFFX 247 K PPP P + + P + PP P+ Sbjct: 378 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 437 Query: 246 LXPPFXPFL--XXXPPPRXFFXPP 181 PP P++ PPP + PP Sbjct: 438 SSPPPPPYVYKSPSPPPYVYKSPP 461 Score = 41.5 bits (93), Expect = 8e-04 Identities = 33/140 (23%), Positives = 42/140 (30%), Gaps = 3/140 (2%) Frame = -2 Query: 612 LFXSPXXPXFXXX-PPPPPXXXVKPPPP--XXXXPPPXPFDGXXXGSPXXXXXXXXXXXX 442 ++ SP P + PPPPP PPPP PPP P+ SP Sbjct: 46 IYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPY---IYKSPPPPPYVYSSPPP 102 Query: 441 XXXXXKQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPX 262 K PPP P + P + PP Sbjct: 103 PPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPP 162 Query: 261 XPFFXLXPPFXPFLXXXPPP 202 P+ PP P++ PPP Sbjct: 163 PPYVYKSPPPPPYVYSSPPP 182 Score = 41.5 bits (93), Expect = 8e-04 Identities = 27/123 (21%), Positives = 39/123 (31%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP +PPPP PPP PP + P ++ + PPP Sbjct: 131 PPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 190 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXXXS 210 P + + + + + PP + PP PP+ S Sbjct: 191 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYK-SPPPPPYVYSSPPPPPYVYKS 249 Query: 209 PPP 201 PPP Sbjct: 250 PPP 252 Score = 41.5 bits (93), Expect = 8e-04 Identities = 27/123 (21%), Positives = 39/123 (31%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP +PPPP PPP PP + P ++ + PPP Sbjct: 211 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 270 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXXXS 210 P + + + + + PP + PP PP+ S Sbjct: 271 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYK-SPPPPPYVYSSPPPPPYVYKS 329 Query: 209 PPP 201 PPP Sbjct: 330 PPP 332 Score = 41.5 bits (93), Expect = 8e-04 Identities = 32/138 (23%), Positives = 39/138 (28%), Gaps = 2/138 (1%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXX--PPPXPFDGXXXGSPXXXXXXXXXXXXXXXXX 427 P P PPPPP PPPP PPP P+ SP Sbjct: 231 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPY---VYKSPPPPPYVYSSPPPPPYVY 287 Query: 426 KQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPFFX 247 K PPP P + P + PP P+ Sbjct: 288 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVY 347 Query: 246 LXPPFXPFLXXXPPPRXF 193 PP P++ PPP + Sbjct: 348 KSPPPPPYVYSSPPPSPY 365 Score = 41.5 bits (93), Expect = 8e-04 Identities = 28/131 (21%), Positives = 41/131 (31%), Gaps = 1/131 (0%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP +PPPP PPP PP + P ++ + PPP Sbjct: 251 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 310 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXXXS 210 P + + + + + PP + PPSP Sbjct: 311 PPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSP 370 Query: 209 PPPXF-FXXPP 180 PPP + + PP Sbjct: 371 PPPPYVYSSPP 381 Score = 41.1 bits (92), Expect = 0.001 Identities = 27/123 (21%), Positives = 39/123 (31%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP +PPPP PPP PP + P ++ + PPP Sbjct: 51 PPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSP 110 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXXXS 210 P + + + + + PP + PP PP+ S Sbjct: 111 PPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYK-SPPPPPYVYSSPPPPPYVYKS 169 Query: 209 PPP 201 PPP Sbjct: 170 PPP 172 Score = 40.3 bits (90), Expect = 0.002 Identities = 27/122 (22%), Positives = 39/122 (31%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKXX 387 PP +PPPP PPP PP + P ++ K+ PPP Sbjct: 42 PPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPP 101 Query: 386 XEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXXXSP 207 P + + + + + PP + PP PP+ SP Sbjct: 102 PPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYK-SPPPPPYVYSSP 160 Query: 206 PP 201 PP Sbjct: 161 PP 162 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Frame = -3 Query: 569 PPPXXXX*NPPPPXX--XXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPPP PP P P + ++ PPP Sbjct: 421 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPPSYSYSYSSPPPP 476 Score = 38.7 bits (86), Expect = 0.005 Identities = 28/124 (22%), Positives = 35/124 (28%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSPXXXXXXXXXXXXXXXXXKQXXXXXXPXK 394 PP PP KPP PPP P+ SP K Sbjct: 32 PPSPPSYVYKPPTHIYSSPPPPPY---VYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYK 88 Query: 393 XXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPFFXLXPPFXPFLXX 214 PPP P + + P + PP P+ PP P++ Sbjct: 89 SPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYK 148 Query: 213 XPPP 202 PPP Sbjct: 149 SPPP 152 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/54 (31%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPP PP + P ++ K+ PPP Sbjct: 411 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPP 464 Score = 36.7 bits (81), Expect = 0.021 Identities = 17/54 (31%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPP PP + P ++ K+ PPP Sbjct: 381 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 434 Score = 36.7 bits (81), Expect = 0.021 Identities = 17/54 (31%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPP PP + P ++ K+ PPP Sbjct: 401 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPP 454 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/54 (29%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPP PP + P ++ + PPP Sbjct: 371 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 424 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/54 (29%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPP PP + P ++ + PPP Sbjct: 391 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 444 Score = 34.7 bits (76), Expect = 0.086 Identities = 27/123 (21%), Positives = 37/123 (30%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 P P PP PPPPP PP P P ++ + PPP Sbjct: 33 PSPPSYVYKPPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPP--YVYSSPPPPPYIYKSP 90 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXXXS 210 P + + + + + PP + PP PP+ S Sbjct: 91 PPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYN-SPPPPPYVYKS 149 Query: 209 PPP 201 PPP Sbjct: 150 PPP 152 Score = 34.7 bits (76), Expect = 0.086 Identities = 20/66 (30%), Positives = 24/66 (36%), Gaps = 1/66 (1%) Frame = -3 Query: 602 PXFXXXFXGXXPPPXXXX*NPPPPXX-XXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGK 426 P + PPP PPPP PPPPP PP P P + Sbjct: 361 PPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY--- 417 Query: 425 NNXPPP 408 ++ PPP Sbjct: 418 SSPPPP 423 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/48 (35%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVK---PPPPXXXXPPPXPFDGXXXGSP 478 ++ SP P + PPPP K PPP PPP P SP Sbjct: 426 VYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPPSYSYSYSSP 473 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/38 (34%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVK--PPPPXXXXPPPXP 505 ++ SP P + PPPP PPPP P P Sbjct: 416 VYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPP 453 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/32 (37%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = -3 Query: 269 PPXXXFFXFXPPSPPFXXXSPPPX--FFXXPP 180 PP + PP PP+ SPPP + PP Sbjct: 60 PPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPP 91 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/32 (37%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = -3 Query: 269 PPXXXFFXFXPPSPPFXXXSPPPX--FFXXPP 180 PP + PP PP+ SPPP + PP Sbjct: 80 PPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPP 111 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P + PPPPP V PPP PPP P Sbjct: 430 SPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPP 462 Score = 39.5 bits (88), Expect = 0.003 Identities = 36/142 (25%), Positives = 39/142 (27%), Gaps = 2/142 (1%) Frame = -2 Query: 600 PXXPXFXXXP--PPPPXXXVKPPPPXXXXPPPXPFDGXXXGSPXXXXXXXXXXXXXXXXX 427 P P + P PPPP V PPP PPP P P Sbjct: 475 PPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP----VYSPPPPPVYSSPPPPPSPAPT 530 Query: 426 KQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPFFX 247 P S PPP P P P PP P+ Sbjct: 531 PVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPY-- 588 Query: 246 LXPPFXPFLXXXPPPRXFFXPP 181 L PP P PPP + PP Sbjct: 589 LSPPPPPTPVSSPPPTPVYSPP 610 Score = 37.9 bits (84), Expect = 0.009 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP PPPP PPP P SP Sbjct: 456 PPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSP 487 Score = 37.1 bits (82), Expect = 0.016 Identities = 19/54 (35%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP PP S P + ++ PPP Sbjct: 601 PPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPP 654 Score = 36.3 bits (80), Expect = 0.028 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P + PPPPP PPPP PPP P Sbjct: 459 PPPPVYSPPPPPPPPP---PPPPVYSPPPPSP 487 Score = 35.5 bits (78), Expect = 0.049 Identities = 32/136 (23%), Positives = 36/136 (26%), Gaps = 5/136 (3%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSPXXXXXXXXXXXXXXXXXKQXXXXXXPXK 394 PPPPP V PPP PPP P P Sbjct: 471 PPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPT 530 Query: 393 XXSXXXXXXXXP--PPFPXXXXXFXXXFFXXN---PFFXPXFFXXXPPXXPFFXLXPPFX 229 P PP P ++ + P P PP P PP Sbjct: 531 PVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSP----PPPIY 586 Query: 228 PFLXXXPPPRXFFXPP 181 P+L PPP PP Sbjct: 587 PYLSPPPPPTPVSSPP 602 Score = 35.5 bits (78), Expect = 0.049 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P + PPPP V PPP PP P Sbjct: 580 SPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPP 612 Score = 35.5 bits (78), Expect = 0.049 Identities = 18/56 (32%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXF--PXSXPLFFLGKNNXPPP 408 PPP PPP PPPPP PP + P P+++ ++ PPP Sbjct: 612 PPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYY---SSPPPP 664 Score = 35.1 bits (77), Expect = 0.065 Identities = 18/54 (33%), Positives = 23/54 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPP + PP P P++ + PPP Sbjct: 442 PPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPP-----PPPPPVYSPPPPSPPPP 490 Score = 35.1 bits (77), Expect = 0.065 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP V PPP PPP P Sbjct: 455 PPPPPPPPVYSPPPPPPPPPPPP 477 Score = 35.1 bits (77), Expect = 0.065 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPP-----PXXXVKPPPPXXXXPPPXPF 502 ++ P P + PPPP P +PPPP PPP F Sbjct: 509 VYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQF 550 Score = 35.1 bits (77), Expect = 0.065 Identities = 18/54 (33%), Positives = 23/54 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPP PP + + S P + ++ PPP Sbjct: 643 PPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHY-HSPPPSPVHYSSPPPP 695 Score = 34.7 bits (76), Expect = 0.086 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 443 PPPPPVYSPPPPPPP---PPPPPVYSPPPPPP 471 Score = 34.7 bits (76), Expect = 0.086 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 + SP P PPP PPPP PPP P Sbjct: 588 YLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPP 622 Score = 34.7 bits (76), Expect = 0.086 Identities = 18/54 (33%), Positives = 20/54 (37%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPP PPPPP PP P P + PPP Sbjct: 592 PPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPP 645 Score = 34.7 bits (76), Expect = 0.086 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPP P PPPP PPP P Sbjct: 592 PPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPP 623 Score = 34.3 bits (75), Expect = 0.11 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP PPPP PPP + P Sbjct: 457 PPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPP 488 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP PPPPP PPPP PP P Sbjct: 600 SPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPP 632 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/54 (31%), Positives = 23/54 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PP +PPPP PPPP+ PP + P P+ + + PPP Sbjct: 705 PPAPVVHHSPPPPMVHHSPPPPVIHQSPPPPSPEYEGPL-PPVIGVSYASPPPP 757 Score = 33.9 bits (74), Expect = 0.15 Identities = 19/54 (35%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPPP PP P P++ PPP Sbjct: 426 PPPP----SPPPPVYSPPPPPPPPPPVYSPPPPPPP-PPPPPVYSPPPPPPPPP 474 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/54 (35%), Positives = 23/54 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPPP+ PP S P + + PPP Sbjct: 473 PPPPPPVYSPPPPSP-PPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPP 525 Score = 33.5 bits (73), Expect = 0.20 Identities = 31/131 (23%), Positives = 38/131 (29%), Gaps = 2/131 (1%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKXX 387 PP +PPPP PPP P PP P S P ++ PPP Sbjct: 537 PPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPP-PHSPP----PPHSPPPPIYPYLSP 591 Query: 386 XEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXXXS- 210 P + + PP PP PP S Sbjct: 592 PPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSP 651 Query: 209 -PPPXFFXXPP 180 PPP ++ PP Sbjct: 652 PPPPVYYSSPP 662 Score = 33.5 bits (73), Expect = 0.20 Identities = 30/137 (21%), Positives = 38/137 (27%) Frame = -3 Query: 611 FFXPXFXXXFXGXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFL 432 F P + PPP PP PPPP PP P P++ Sbjct: 550 FSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVY-- 607 Query: 431 GKNNXPPPXNXXKXXXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXF 252 PPP P + H ++ PP + Sbjct: 608 -SPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPP---------PVYYSSPPPPPVY 657 Query: 251 FXFXPPSPPFXXXSPPP 201 + PP PP SPPP Sbjct: 658 YSSPPPPPPVHYSSPPP 674 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/40 (37%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPP----XXXXPPPXP 505 ++ P P PPPPP PPPP PPP P Sbjct: 606 VYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPP 645 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 429 PSPPPPVYSPPPPP----PPPPPVYSPPPPPP 456 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPP---PPXXXXPPPXP 505 P P PPPPP PP PP PPP P Sbjct: 458 PPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPP 492 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P F PPP P PPPP PP P Sbjct: 544 SPPPPQF-SPPPPEPYYYSSPPPPHSSPPPHSP 575 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Frame = -2 Query: 609 FXSPXXPX--FXXXPPPPPXXXVKPPPP--XXXXPPPXP 505 + SP P + PPPPP PPPP PPP P Sbjct: 648 YSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSP 686 Score = 32.7 bits (71), Expect = 0.35 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPP---XXXXPPP 511 P P + PPPPP PPPP PPP Sbjct: 642 PPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPP 674 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPPP PP P P PPP Sbjct: 488 PPPPPPVYSPPPPPP--PPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPP 539 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 +F +P P PPP P V PPP PPP Sbjct: 416 IFSTP--PTLTSPPPPSPPPPVYSPPPPPPPPPP 447 Score = 31.5 bits (68), Expect = 0.81 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = -2 Query: 573 PPPPPXXXVKPPPP--XXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 641 PPPPPVYYSSPPPPPVYYSSPPPPP 665 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP PPPP PPPP PP P Sbjct: 703 SPPPAPVVHHSPPPPMVHHSPPPPVIHQSPPPP 735 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = -2 Query: 600 PXXPXFXXXP----PPPPXXXVKPPPPXXXXPPPXP 505 P P F P PPPP PPPP PPP P Sbjct: 412 PPAPIFSTPPTLTSPPPP----SPPPPVYSPPPPPP 443 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P + PPPP PPPP PP P Sbjct: 633 PPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPP 664 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 SP P PPPP PPP P P G SP Sbjct: 713 SPPPPMVHHSPPPPVIHQSPPPPSPEYEGPLPPVIGVSYASP 754 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVK---PPPPXXXXPPPXP 505 + SP P PPPP PPPP PP P Sbjct: 638 YSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPP 675 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/54 (29%), Positives = 19/54 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPP PPP PP S P + ++ PPP Sbjct: 664 PPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPP 717 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/54 (35%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP+ PP P P++ PPP Sbjct: 459 PPPPVYSPPPPPPPP--PPPPPV---YSPPPPSPP--PPPPPVYSPPPPPPPPP 505 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 4/36 (11%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXX--VKPPPPXX--XXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 620 PPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPP 655 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPP-PXXXXPPPXPFDGXXXGSP 478 P P PPPP PPP P PP P SP Sbjct: 663 PPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESP 704 Score = 28.7 bits (61), Expect = 5.7 Identities = 19/61 (31%), Positives = 25/61 (40%), Gaps = 7/61 (11%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXP-------PPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPP 411 PPP +PPPP P PPPP PP + P P ++ ++ PP Sbjct: 512 PPPPPVYSSPPPPPSPAPTPVYCTRPPPP---PPHSPPPPQFSPPPPEPYYY---SSPPP 565 Query: 410 P 408 P Sbjct: 566 P 566 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/54 (27%), Positives = 19/54 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PP PPPP PPP PP + P + ++ PPP Sbjct: 622 PPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPP 675 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 271 PPXXPXFFXXAPLXPLFXXXPPPP 200 PP P ++ P P++ PPPP Sbjct: 641 PPPPPVYYSSPPPPPVYYSSPPPP 664 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXP 505 PPPP PP PPP P Sbjct: 410 PPPPAPIFSTPPTLTSPPPPSP 431 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/35 (37%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVK---PPPPXXXXPPPXP 505 P P PPPPP + PP P PP P Sbjct: 683 PPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPP 717 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 L S P F PPPPP PPPP PPP P Sbjct: 29 LVQSQDPPLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PP PPPP PPPPP PP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PP ++ G PP PL ++ PPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPL-----SSPPPP 94 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -1 Query: 568 PPPXXXXKTPPPRXXXPPPXPL*RXXXGVPP 476 PPP PPP PPP G+PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPAVNMSVETGIPP 76 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 61 SPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPP 93 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 70 SPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPP 102 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 79 SPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPP 111 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 88 SPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPP 120 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 97 SPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPP 129 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 106 SPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPP 138 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 115 SPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPP 147 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 124 SPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPP 156 Score = 39.1 bits (87), Expect = 0.004 Identities = 37/137 (27%), Positives = 38/137 (27%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSPXXXXXXXXXXXXXXXXXKQXXX 412 P PPPPP PPPP PPP P + P Sbjct: 38 PLVDLSPPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLS 97 Query: 411 XXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPFFXLXPPF 232 P S PPP P P P PP P L PP Sbjct: 98 PPPPPVNLS--------PPPPPVNLSPPPPPVLLSPP--PPPVLLSPPP--PPVNLSPPP 145 Query: 231 XPFLXXXPPPRXFFXPP 181 P L PPP F PP Sbjct: 146 PPVLLSPPPPPVLFSPP 162 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 SP P PPPPP PPPP PPP Sbjct: 133 SPPPPPVNLSPPPPPVLLSPPPPPVLFSPPP 163 Score = 37.9 bits (84), Expect = 0.009 Identities = 33/130 (25%), Positives = 38/130 (29%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP PPPP PPPPP+ PP P P+ + PPP N Sbjct: 54 PPPPVNLSPPPPPVNLSPPPPPVN--LSPPPPPVNLSPPPPPVLL---SPPPPPVNLSPP 108 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXXXS 210 P+ L + PP PP P Sbjct: 109 PPPVNLSPPPPPVLLSPPPPP---------------VLLSPPPPPVNLSPPPPPVLLSPP 153 Query: 209 PPPXFFXXPP 180 PPP F PP Sbjct: 154 PPPVLFSPPP 163 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPP PPPP PPP P Sbjct: 43 SPPPPPVNISSPPPPVNLSPPPPPVNLSPPPPP 75 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 S P PPPPP PPPP PPP P Sbjct: 52 SSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPP 84 Score = 37.5 bits (83), Expect = 0.012 Identities = 20/54 (37%), Positives = 23/54 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPPP+ PP P P+ F + PPP Sbjct: 117 PPPPVLLSPPPPPVLLSPPPPPVN--LSPPPPPVLLSPPPPPVLF----SPPPP 164 Score = 37.5 bits (83), Expect = 0.012 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 142 SPPPPPVLLSPPPPP-VLFSPPPPTVTRPPPPP 173 Score = 36.7 bits (81), Expect = 0.021 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP +PPPP PPPPP+ PP Sbjct: 45 PPPPVNISSPPPPVNLSPPPPPVNLSPPPPP 75 Score = 36.3 bits (80), Expect = 0.028 Identities = 18/54 (33%), Positives = 20/54 (37%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPPP PPPP +T P + P K PPP Sbjct: 144 PPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPP 197 Score = 35.9 bits (79), Expect = 0.037 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPP PP P P PPP Sbjct: 143 PPPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPP 196 Score = 31.9 bits (69), Expect = 0.61 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 SP P PPPP PPP PPP Sbjct: 151 SPPPPPVLFSPPPPTVTRPPPPPTITRSPPP 181 Score = 31.1 bits (67), Expect = 1.1 Identities = 32/130 (24%), Positives = 37/130 (28%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 P P PPPP PPPP+ PP P P + + PPP N Sbjct: 36 PAPLVDLSPPPPPVNISSPPPPVN--LSPPPPPVNLSPPPPP---VNLSPPPPPVNLSPP 90 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXXXS 210 P+ L L+ PP PP PP Sbjct: 91 PPPVLLSPPPPPVNLSPPPPP----VNLSPPPPPVLLSPPPPP---VLLSPPPPPVNLSP 143 Query: 209 PPPXFFXXPP 180 PPP PP Sbjct: 144 PPPPVLLSPP 153 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 7/44 (15%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPP-------XXXXPPPXPF 502 LF P P PPPPP PPPP PPP P+ Sbjct: 158 LFSPP--PPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPY 199 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPF 502 SP P PPPPP PPPP PPP P+ Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPY 408 Score = 37.5 bits (83), Expect = 0.012 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P + PPPPP PP P PPP P Sbjct: 418 PSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPP 449 Score = 34.7 bits (76), Expect = 0.086 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP P P P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPP 415 Score = 34.7 bits (76), Expect = 0.086 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PP P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 34.7 bits (76), Expect = 0.086 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 34.3 bits (75), Expect = 0.11 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 585 FXXXPPPPPXXXVKPPPPXXXXPPPXP 505 F PP PP PPPP PPP P Sbjct: 372 FGCSPPSPPPPPPPPPPPPPPPPPPPP 398 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSPP 414 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP PP P P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYP 426 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKP-PPPXXXXPPP 511 P P PPPPP V P PPP PPP Sbjct: 392 PPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 32.7 bits (71), Expect = 0.35 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 G PP PPPP PPPPP PP P P Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPF 502 P P PPPPP PPP PPP P+ Sbjct: 404 PPPPYVYPSPPPPPPS----PPPYVYPPPPPPY 432 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/42 (33%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPP + PP + P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPP 428 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPP P V PPPP PP P Sbjct: 416 PPPSPPPYVYPPPPPPYVYPPPP 438 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPF 502 P P PPPP V PPPP P P P+ Sbjct: 426 PPPPPPYVYPPPPSPPYVYPPPP----PSPQPY 454 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = -3 Query: 536 PPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PP PPPPP PP P P + PPP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 29.1 bits (62), Expect = 4.3 Identities = 18/54 (33%), Positives = 20/54 (37%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PP PP PP P S P + P P Sbjct: 404 PPPPYVYPSPPPP----PPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQP 453 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/35 (34%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPP-PXXXVKPPPPXXXXPPP 511 ++ P P + PPPP P + P PP P P Sbjct: 433 VYPPPPSPPYVYPPPPPSPQPYMYPSPPCNDLPTP 467 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/53 (28%), Positives = 20/53 (37%) Frame = -2 Query: 360 PPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPFFXLXPPFXPFLXXXPPP 202 PPP P + P P + PP P+ PP P++ PPP Sbjct: 398 PPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPP-PYVYPPPPSPPYVYPPPPP 449 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -3 Query: 269 PPXXXFFXFXPPSPPFXXXSPPPXFFXXPP 180 PP + + PP PP+ PP + PP Sbjct: 417 PPSPPPYVYPPPPPPYVYPPPPSPPYVYPP 446 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PP PPPP PPP P PP + S P Sbjct: 420 PPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPP 460 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPP PP + P Sbjct: 420 PPPYVYP--PPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSP 459 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 509 SPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPP 541 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP PPPP PPP P Sbjct: 500 SPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPP 532 Score = 37.5 bits (83), Expect = 0.012 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 ++ P P PPPPP PPPP PPP Sbjct: 515 VYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPP 548 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPPPP+ PP P P Sbjct: 511 PPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSP 552 Score = 35.1 bits (77), Expect = 0.065 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP +PPPP PPPPP PP Sbjct: 501 PPPPSPIHSPPPPPVYSPPPPPPVYSPPPPP 531 Score = 34.7 bits (76), Expect = 0.086 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP+ PP Sbjct: 502 PPPSPIHSPPPPPVYSPPPPPPVYSPPPPPP 532 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 510 PPPPPVYSPPPPPPVYSPPPPPPVYSPPPPP 540 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 SP P PPPPP PPPP PPP Sbjct: 526 SPPPPPPVYSPPPPPPVH-SPPPPVHSPPPP 555 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = -2 Query: 603 SPXXPXFXXXPPPP----PXXXVKPPPPXXXXPPP 511 SP P + PPPP P PPPP PPP Sbjct: 608 SPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPP 642 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = -2 Query: 603 SPXXPXFXXXPP---PPPXXXVKPPPPXXXXPPPXPF 502 SP P PP PPP PPPP PPP F Sbjct: 594 SPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVF 630 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = -2 Query: 603 SPXXPXFXXXPP--PPPXXXVKPPPPXXXXPPP 511 SP P F PP PP PPPP PPP Sbjct: 624 SPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPP 656 Score = 33.1 bits (72), Expect = 0.26 Identities = 21/54 (38%), Positives = 24/54 (44%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPPP+ PP K P P+ N PPP Sbjct: 646 PPPPVY--SPPPPPVKSPPPPPVYSPPLLPP-KMSSPPTQTPV------NSPPP 690 Score = 32.7 bits (71), Expect = 0.35 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP PPPP PP P P Sbjct: 518 PPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSP 559 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = -2 Query: 603 SPXXPXFXXXPP---PPPXXXVKPPPPXXXXPPP 511 SP P PP PPP PPPP PPP Sbjct: 565 SPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPP 598 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = -2 Query: 603 SPXXPXFXXXPP---PPPXXXVKPPPPXXXXPPP 511 SP P PP PPP PPPP PPP Sbjct: 572 SPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPP 605 Score = 31.9 bits (69), Expect = 0.61 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 585 FXXXPPPPPXXXVKPPPPXXXXPPP 511 F PPPPP PP P PPP Sbjct: 489 FRRSPPPPPVHSPPPPSPIHSPPPP 513 Score = 31.5 bits (68), Expect = 0.81 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 SP P PPP P PPP PPP Sbjct: 492 SPPPPPVHSPPPPSPIHSPPPPPVYSPPPPP 522 Score = 31.5 bits (68), Expect = 0.81 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPP PPPPP+ PP Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPPPPPP 523 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 4/34 (11%) Frame = -2 Query: 600 PXXPXFXXXPPPP----PXXXVKPPPPXXXXPPP 511 P P + PPPP P PPPP PPP Sbjct: 529 PPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPP 562 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPP---PPXXXVKPPPPXXXXPPP 511 ++ P P PPP PP PPPP PPP Sbjct: 533 VYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 569 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = -2 Query: 603 SPXXPXFXXXPP--PPPXXXVKPPPPXXXXPPP 511 SP P PP PP PPPP PPP Sbjct: 544 SPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 576 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = -2 Query: 573 PPPP---PXXXVKPPPPXXXXPPPXP 505 PPPP P V PPP PPP P Sbjct: 566 PPPPVHSPPPPVHSPPPPVYSPPPPP 591 Score = 29.1 bits (62), Expect = 4.3 Identities = 23/83 (27%), Positives = 28/83 (33%), Gaps = 2/83 (2%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP--XSXPLFFLGKNNXPPPXNXX 396 PPP +PPPP PPPPP+ P P S P N+ PP Sbjct: 639 PPPPVY--SPPPPVY-SPPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTPVNSPPPRTPSQ 695 Query: 395 KXXXEXXXXXXXLPLFLXHXXXS 327 +P F+ H S Sbjct: 696 TVEAPPPSEEFIIPPFIGHQYAS 718 Score = 27.9 bits (59), Expect = 9.9 Identities = 18/54 (33%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP + PPP PPPPP+ PP P P + PPP Sbjct: 573 PPPPV---HSPPPPVYSPPPPPVHSPP--PPVHSPPPPVHSPPPPVYSPPPPPP 621 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 40.3 bits (90), Expect = 0.002 Identities = 33/144 (22%), Positives = 40/144 (27%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSPXXXXXXXXXXXXXXX 433 ++ SP P + PPPP PPPP PPP P Sbjct: 500 VYSSPPPP-YVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPV 558 Query: 432 XXKQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPF 253 P PPP P +P + P PP P Sbjct: 559 YYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPL 618 Query: 252 FXLXPPFXPFLXXXPPPRXFFXPP 181 + PP P PPP + PP Sbjct: 619 Y--YPPVTP---SPPPPSPVYYPP 637 Score = 37.5 bits (83), Expect = 0.012 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPF 502 P P PPPPP PPPP PP P+ Sbjct: 485 PPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPY 517 Score = 37.5 bits (83), Expect = 0.012 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 ++ SP P + PPPP PPPP PP P Sbjct: 490 VYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPP 525 Score = 37.1 bits (82), Expect = 0.016 Identities = 32/144 (22%), Positives = 40/144 (27%), Gaps = 1/144 (0%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVK-PPPPXXXXPPPXPFDGXXXGSPXXXXXXXXXXXXXX 436 ++ SP P PPPPP PPPP PP P+ SP Sbjct: 471 VYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPY---VYSSPPPPYVYSSPPPPPP 527 Query: 435 XXXKQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXP 256 P PPP P +P + P PP P Sbjct: 528 SPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSP 587 Query: 255 FFXLXPPFXPFLXXXPPPRXFFXP 184 + + P PPP + P Sbjct: 588 VY-----YPPVTYSPPPPSPVYYP 606 Score = 36.7 bits (81), Expect = 0.021 Identities = 18/54 (33%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPP PP P P + ++ PPP Sbjct: 457 PPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVY---SSPPPP 507 Score = 35.9 bits (79), Expect = 0.037 Identities = 30/135 (22%), Positives = 44/135 (32%), Gaps = 6/135 (4%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPP--LTXXXGGPPXKKXXFPXSXP----LFFLGKNNXPPP 408 PPP +PPPP PPPP + PP P S P +++ PPP Sbjct: 495 PPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPP 554 Query: 407 XNXXKXXXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSP 228 + P++ S ++ + PP ++ PSP Sbjct: 555 PSPVYYPPVTQSPPPPSPVYYPPVTNSPPP--PSPVYYPPVTYSPPPPSPVYYPQVTPSP 612 Query: 227 PFXXXSPPPXFFXXP 183 P PP + P Sbjct: 613 P-----PPSPLYYPP 622 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXX-XXPPPXPF 502 SP P PPPP PPPP PPP P+ Sbjct: 465 SPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPY 499 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPF 502 S P PPPPP PPPP PP P+ Sbjct: 447 SKMSPSVRAYPPPPPPSP-SPPPPYVYSSPPPPY 479 Score = 31.9 bits (69), Expect = 0.61 Identities = 16/54 (29%), Positives = 19/54 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPP PP + P + PPP Sbjct: 475 PPPPYVYSSPPPPPYVYSSPPPPPYVYSSPP-PPYVYSSPPPPYVYSSPPPPPP 527 Score = 31.5 bits (68), Expect = 0.81 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -3 Query: 269 PPXXXFFXFXPPSPPFXXXSPPPXF-FXXPPXXF 171 PP + PP PP+ SPPP + + PP + Sbjct: 484 PPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPY 517 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPF 502 P P PPPP PPP PPP P+ Sbjct: 457 PPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPY 489 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/60 (26%), Positives = 22/60 (36%) Frame = -2 Query: 360 PPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPFFXLXPPFXPFLXXXPPPRXFFXPP 181 PPP P + P P + PP P+ PP P++ PPP + P Sbjct: 457 PPPPPPSPSPPPPYVYSSPP---PPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSP 513 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 3/33 (9%) Frame = -2 Query: 591 PXFXXXPP---PPPXXXVKPPPPXXXXPPPXPF 502 P + PP PPP VKPPPP PPP P+ Sbjct: 78 PPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPY 110 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 5/37 (13%) Frame = -2 Query: 600 PXXPXFXXXPPPP-----PXXXVKPPPPXXXXPPPXP 505 P P + PPPP P VKPPPP PPP P Sbjct: 89 PPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPP 125 Score = 34.7 bits (76), Expect = 0.086 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPF 502 P P + PPPPP PPP PPP P+ Sbjct: 105 PPPPPYVK-PPPPPTVKPPPPPTPYTPPPPTPY 136 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 4/34 (11%) Frame = -2 Query: 600 PXXPXFXXXPPP----PPXXXVKPPPPXXXXPPP 511 P P PPP PP VKPPPP PPP Sbjct: 122 PPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPP 155 Score = 32.3 bits (70), Expect = 0.46 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPP PPPP PPP Sbjct: 79 PYTPKPPTVKPPPPPYVKPPPPPTVKPPPP 108 Score = 31.9 bits (69), Expect = 0.61 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP 456 PPP PPPP PPPP T PP +P Sbjct: 138 PPPPTV--KPPPPPVVTPPPPTPTPEAPCPPPPPTPYP 173 Score = 31.9 bits (69), Expect = 0.61 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = -2 Query: 600 PXXPXFXXXPPPP-PXXXVKPPPPXXXXPPPXP 505 P P PP P P PPPP PPP P Sbjct: 146 PPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKP 178 Score = 31.5 bits (68), Expect = 0.81 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPP 511 PPPPP PPP PPP Sbjct: 121 PPPPPTPYTPPPPTPYTPPPP 141 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXK 471 PP PPPP PPPPP P K Sbjct: 89 PPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVK 120 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPP 507 PPP PPPP PPPP Sbjct: 121 PPPPPTPYTPPPPTPYTPPPP 141 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 9/42 (21%) Frame = -2 Query: 603 SPXXPXFXXXPP----PPPXXX-----VKPPPPXXXXPPPXP 505 +P P PP PPP VKPPPP PPP P Sbjct: 60 TPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPP 101 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPP---PXXXXPPPXP 505 +P P PPPP PPP P PPP P Sbjct: 134 TPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPP 169 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFP 456 PPPP PPPPP T PP K P Sbjct: 89 PPPPPYVKPPPPP-TVKPPPPPYVKPPPP 116 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 5/35 (14%) Frame = -2 Query: 600 PXXPXFXXXPP-----PPPXXXVKPPPPXXXXPPP 511 P P PP PPP PPPP PPP Sbjct: 114 PPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPP 148 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PP PPPP PPPP +T PP P P Sbjct: 130 PPPPTPYTPPPPTVKPPPPPVVTPP---PPTPTPEAPCPPP 167 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP 456 PP PPPP PPPP T PP K P Sbjct: 113 PPPPPTVKPPPPPTPYTPPPP-TPYTPPPPTVKPPPP 148 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/39 (33%), Positives = 15/39 (38%) Frame = -1 Query: 565 PPXXXXKTPPPRXXXPPPXPL*RXXXGVPPXKKXFSPXP 449 PP TPPP PPP P+ P + P P Sbjct: 130 PPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPP 168 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PP PPPP PPP P PP P P Sbjct: 138 PPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKP 178 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPP T PP Sbjct: 97 PPPPPTVKPPPPPY--VKPPPPPTVKPPPPP 125 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/32 (34%), Positives = 12/32 (37%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPP 514 + P P PPPP PP P PP Sbjct: 110 YVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPP 141 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDG 496 P P PPPPP PPPP PPP P G Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPPG 706 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PP P PPPP PPP P G P Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPP 703 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PP P PPPPP GGPP P P Sbjct: 672 PPLPGGGPPPPPP--PPGGGPPPPPGGGPPPPP 702 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/54 (37%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPP PPPP LT PP P P+ F + PPP Sbjct: 61 PPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDA--PPPIPIVFPPPIDSPPP 112 Score = 33.5 bits (73), Expect = 0.20 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P PPPPP PPPP PP P Sbjct: 62 PPTVSSPPPPPLDSSPPPPPDLTPPPSSP 90 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKP-PPPXXXXPPPXP 505 SP P PPPPP P PP PPP P Sbjct: 67 SPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIP 100 Score = 32.3 bits (70), Expect = 0.46 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 567 PPPXXXVKPPPPXXXXPPPXPFD 499 PPP PPPP PPP P D Sbjct: 110 PPPESTNSPPPPEVFEPPPPPAD 132 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/59 (32%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP---XSXPLFFLGKNNXPPPXN 402 PPP +PP P PPP + GGP K P S P + P P N Sbjct: 128 PPPADEDESPPAPPPPEQLPPPASSPQGGPKKPKKHHPGPATSPPAPSAPATSPPAPPN 186 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKP--PPPXXXXPPP 511 SP P PPPP P PPP PPP Sbjct: 117 SPPPPEVFEPPPPPADEDESPPAPPPPEQLPPP 149 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP N PPP PPPP PP Sbjct: 110 PPPEST--NSPPPPEVFEPPPPPADEDESPP 138 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP + PPP PPPP PP + P + P Sbjct: 104 PPPI----DSPPPESTNSPPPPEVFEPPPPPADEDESPPAPP 141 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXGXKKS 613 G GGG GGGG GGGGG K G G KS Sbjct: 8 GSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKS 43 Score = 31.9 bits (69), Expect = 0.61 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG G GGG K G G Sbjct: 100 GCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSG 131 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +2 Query: 455 GGKXFFXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXG 592 GGK G G GG GGGG + GGGGG G Sbjct: 12 GGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPG 57 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG GGGG G G Sbjct: 20 GSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGG 51 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 455 GGKXFFXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 GGK G G GG GGGG GGGG G G Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGG 50 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 497 PSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 P G GGG GGGG G GG G G Sbjct: 73 PKGGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSG 107 Score = 28.7 bits (61), Expect = 5.7 Identities = 31/130 (23%), Positives = 32/130 (24%) Frame = +2 Query: 185 GXKKXRGGGXXXKKGXKGGXXKKXGXXGGXXXKKXGKKXGLXXKXXXXNXXXXXGKGGGX 364 G + GGG K G GG G GG G G GGG Sbjct: 22 GGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNRSSYISRDNFESDPKGGSGGGG 81 Query: 365 XXXXXXXXFXXXXXXXXXXCFFLKKKXXRTGGKXFFXXGDPXXXPSKGXGGGXXXSGGGG 544 GGK G G GG GGGG Sbjct: 82 KGGGGGGGISGGG----------------AGGKSGCGGGKSGGGGGGGKNGGGCGGGGGG 125 Query: 545 FTXXXGGGGG 574 GGG G Sbjct: 126 KGGKSGGGSG 135 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 512 GGGXXXSGGGGFTXXXGGGGGXXXKXGXXGXK 607 G G SGGGG GG GG G G K Sbjct: 3 GKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAK 34 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXGXKK 610 G GGG GGGG+ GGGGG K G G K Sbjct: 80 GGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGK 114 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG GGGGG G G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGG 99 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG GGGGG G G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGG 101 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 36.7 bits (81), Expect = 0.021 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDG 496 PPPPP PPPP PPP P G Sbjct: 278 PPPPPPKPQPPPPPKIARPPPAPPKG 303 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PP PP PPPP PPP P Sbjct: 264 APPPPPAAAPPPQPP-----PPPPPKPQPPPPP 291 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPP + PP Sbjct: 273 PPPQPPP--PPPPKPQPPPPPKIARPPPAPP 301 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PP PPPP P PPP PP Sbjct: 268 PPAAAPPPQPPPPPPPKPQPPPPPKIARPPP 298 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 36.7 bits (81), Expect = 0.021 Identities = 34/148 (22%), Positives = 40/148 (27%), Gaps = 11/148 (7%) Frame = -2 Query: 612 LFXSPXXPXFXXX--PPPPPXXXVKPPPP--XXXXPPPXPF-------DGXXXGSPXXXX 466 L+ SP P + PPPPP PP P PPP PF SP Sbjct: 61 LYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTYIYNSPPPPP 120 Query: 465 XXXXXXXXXXXXXKQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPX 286 PPP P F + P Sbjct: 121 YVYKSVPRITFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSAPRVLFIYSSPPPPP 180 Query: 285 FFXXXPPXXPFFXLXPPFXPFLXXXPPP 202 + PP P+ P PF+ PPP Sbjct: 181 YVYNSPPPPPYVYESVPRIPFIYSSPPP 208 Score = 36.3 bits (80), Expect = 0.028 Identities = 30/134 (22%), Positives = 39/134 (29%) Frame = -3 Query: 602 PXFXXXFXGXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKN 423 P + PPP PPPP PP PP + P ++ N Sbjct: 56 PPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTYI-YN 114 Query: 422 NXPPPXNXXKXXXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXF 243 + PPP K P + F + + P F Sbjct: 115 SPPPPPYVYKSVPRITFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSAPRVLFIYS 174 Query: 242 XPPSPPFXXXSPPP 201 PP PP+ SPPP Sbjct: 175 SPPPPPYVYNSPPP 188 Score = 35.1 bits (77), Expect = 0.065 Identities = 27/123 (21%), Positives = 37/123 (30%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 P P +PPPP PPP T PP + + F+ + PPP Sbjct: 87 PRPPYVYKSPPPPPFVYSSPPPPTYIYNSPPPPPYVYKSVPRITFIYSSPPPPPYVYNSA 146 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXXXS 210 P + F + + + PP + P PF S Sbjct: 147 PRIPFIYSSPPPPPYVYNSAPRVLFIYSSPPPPPYVYNSPPPPPYVYE-SVPRIPFIYSS 205 Query: 209 PPP 201 PPP Sbjct: 206 PPP 208 Score = 32.7 bits (71), Expect = 0.35 Identities = 30/140 (21%), Positives = 37/140 (26%), Gaps = 3/140 (2%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVK---PPPPXXXXPPPXPFDGXXXGSPXXXXXXXXXXXX 442 ++ SP + PPPP PPPP PP P SP Sbjct: 51 VYKSPPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRP--PYVYKSPPPPPFVYSSPPP 108 Query: 441 XXXXXKQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPX 262 K PPP P F + P + P Sbjct: 109 PTYIYNSPPPPPYVYKSVPRITFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSAPR 168 Query: 261 XPFFXLXPPFXPFLXXXPPP 202 F PP P++ PPP Sbjct: 169 VLFIYSSPPPPPYVYNSPPP 188 Score = 31.5 bits (68), Expect = 0.81 Identities = 26/132 (19%), Positives = 40/132 (30%), Gaps = 2/132 (1%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP +PPPP P + PP + + + F+ + PPP Sbjct: 177 PPPPYVYNSPPPPPYVYESVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSA 236 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXXXS 210 P + F + + + P + PP PP+ S Sbjct: 237 PRVPFIYSSPPPPPYVYKSVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSLPP-PPYVYNS 295 Query: 209 PP--PXFFXXPP 180 P P + PP Sbjct: 296 APRVPFIYSSPP 307 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -2 Query: 291 PXFFXXXPPXXPFFXLXPPFXPFLXXXPPPRXF 193 P + PP P+ PP P++ PPP F Sbjct: 69 PYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPF 101 Score = 29.9 bits (64), Expect = 2.5 Identities = 34/158 (21%), Positives = 43/158 (27%), Gaps = 12/158 (7%) Frame = -2 Query: 618 LXLFXSPXXPXFXXX-PPPPPXXXVKPP--PPXXXXPPPXPF-------DGXXXGSPXXX 469 L ++ SP P + PPPPP P P PPP P+ SP Sbjct: 170 LFIYSSPPPPPYVYNSPPPPPYVYESVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSPPPP 229 Query: 468 XXXXXXXXXXXXXXKQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXP 289 K PPP P F + P Sbjct: 230 PYVYNSAPRVPFIYSSPPPPPYVYKSVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSLPPP 289 Query: 288 XFFXXXPPXXPFFXLXPPFXPFLXXXPP--PRXFFXPP 181 + P PF PP P++ P P + PP Sbjct: 290 PYVYNSAPRVPFIYSSPPPPPYVYNSAPRIPFIYSSPP 327 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPP---XXXXPPPXPF 502 P PPP P PPPP PPP P+ Sbjct: 49 PYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPPY 81 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/31 (35%), Positives = 13/31 (41%) Frame = -1 Query: 286 FFXXXPPXXPXFFXXAPLXPLFXXXPPPPXF 194 F PP P + AP P PPPP + Sbjct: 131 FIYSSPPPPPYVYNSAPRIPFIYSSPPPPPY 161 Score = 29.5 bits (63), Expect = 3.2 Identities = 32/153 (20%), Positives = 36/153 (23%), Gaps = 2/153 (1%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPP--PPXXXXPPPXPFDGXXXGSPXXXXXXXXXXXXXXXXX 427 P P PPPPP P P PPP P+ S Sbjct: 197 PRIPFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPY---VYNSAPRVPFIYSSPPPPPYVY 253 Query: 426 KQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXXPPXXPFFX 247 K P P + N F PP P+ Sbjct: 254 KSVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSLPPPPYVYNSAPRVPFIYSSPPPPPYVY 313 Query: 246 LXPPFXPFLXXXPPPRXFFXPP*XFFXKXQXXT 148 P PF+ PPP F F Q T Sbjct: 314 NSAPRIPFIYSSPPPHHMFTSLFLIFHHLQLST 346 Score = 29.1 bits (62), Expect = 4.3 Identities = 26/126 (20%), Positives = 35/126 (27%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 P P PP P PPPP PP + ++ K+ PPP Sbjct: 47 PSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSP 106 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPSPPFXXXS 210 P + F + + + P F PP PP+ S Sbjct: 107 PPPTYIYNSPPPPPYVYKSVPRITFIYSSPPPPPYVYN-SAPRIPFIYSSPPPPPYVYNS 165 Query: 209 PPPXFF 192 P F Sbjct: 166 APRVLF 171 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -3 Query: 287 FFFXVXPPXXXFFXFXPPSPPFXXXSPPPX-F-FXXPP 180 + + PP + PP PP+ SPPP F + PP Sbjct: 70 YVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPP 107 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 36.3 bits (80), Expect = 0.028 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 SP P + PPPPP PPPP PPP Sbjct: 525 SPPPPVYSPPPPPPPVH--SPPPPVHSPPPP 553 Score = 35.1 bits (77), Expect = 0.065 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 SP P PPPPP PPPP PPP Sbjct: 549 SPPPPPVYSPPPPPPPVH-SPPPPVFSPPPP 578 Score = 35.1 bits (77), Expect = 0.065 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPF 502 PPPPP PPPP PPP F Sbjct: 550 PPPPPVYSPPPPPPPVHSPPPPVF 573 Score = 35.1 bits (77), Expect = 0.065 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -2 Query: 603 SPXXPXFXXXPP--PPPXXXVKPPPPXXXXPPPXP 505 SP P F PP PP PPPP PPP P Sbjct: 567 SPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAP 601 Score = 34.7 bits (76), Expect = 0.086 Identities = 19/56 (33%), Positives = 21/56 (37%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXN 402 PPP +PPPP PPPPP+ PP P P PP N Sbjct: 596 PPPPAPVHSPPPPVHSPPPPPPV---YSPPPPVFSPPPSQSPPVVYSPPPRPPKIN 648 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP PPPP + PP P P Sbjct: 534 PPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSP 575 Score = 32.7 bits (71), Expect = 0.35 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPP PPPP PPP P Sbjct: 532 SPPPPPPPVHSPPPPVH--SPPPPPVYSPPPPP 562 Score = 32.7 bits (71), Expect = 0.35 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP + PPP PPPPP+ PP Sbjct: 533 PPPPPPPVHSPPPPVHSPPPPPVYSPPPPPP 563 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 4/34 (11%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPP----PPXXXXPPP 511 P P + PPPPP PP PP PPP Sbjct: 551 PPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPP 584 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P PPPP PPPP PPP Sbjct: 545 PPVHSPPPPPVYSPPPPPPPVHSPPPP 571 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/53 (32%), Positives = 22/53 (41%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPP 411 PPP +PPPP PPPP+ PP + P+F + PP Sbjct: 589 PPPPVH--SPPPPAPVHSPPPPV----HSPPPPPPVYSPPPPVFSPPPSQSPP 635 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPP 504 PP +PPPP PPPPP Sbjct: 518 PPPAPVNSPPPPVYSPPPPPP 538 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP N PPP PPPPP PP Sbjct: 518 PPPAPV--NSPPPPVYSPPPPPPPVHSPPPP 546 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P PPP P PPPP PPP P Sbjct: 591 PPVHSPPPPAPVH--SPPPPVHSPPPPPP 617 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXF 171 + PP PP SPPP F PP + Sbjct: 556 YSPPPPPPPVHSPPPPVFSPPPPVY 580 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = -2 Query: 603 SPXXPXFXXXPP----PPPXXXVKPPPPXXXXPPP 511 SP P + PP PPP PP P PPP Sbjct: 574 SPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPP 608 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PP PPPP PPPP + P P P PPP Sbjct: 605 PPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPP 657 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP + PPP PPPP + PP P P ++ PPP Sbjct: 558 PPPPPPPVHSPPPPVFSPPPPVYSPP---PPVHSPPPPVHSPPPPAPVHSPPPP 608 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 SP P PPPP PPP PPP F SP Sbjct: 595 SPPPPAPVHSPPPPVHSPPPPPPVY--SPPPPVFSPPPSQSP 634 Score = 27.9 bits (59), Expect = 9.9 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Frame = -2 Query: 603 SPXXPXFXXXPPPP----PXXXVKPPP----PXXXXPPPXP 505 SP P PPPP P PPP P PPP P Sbjct: 604 SPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRP 644 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 35.9 bits (79), Expect = 0.037 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PPPPP PP P PPP P Sbjct: 105 TPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKP 137 Score = 31.9 bits (69), Expect = 0.61 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPP P PP PPP P Sbjct: 87 SPPPPVVIASPPPSTPATTPPAPPQTVSPPPPP 119 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPP PPPP PPP Sbjct: 37 PVTPPPSPPQSPPPVVSSSPPPPVVSSPPP 66 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/42 (33%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPP PPPP+ PP P + P Sbjct: 70 PPPSPPVITSPPPTVASSPPPPVV-IASPPPSTPATTPPAPP 110 Score = 28.7 bits (61), Expect = 5.7 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPP 511 PPP P PPP PPP Sbjct: 70 PPPSPPVITSPPPTVASSPPP 90 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP +PP P PPP P G P Sbjct: 116 PPPPDASPSPPAPTTTNPPPKPSPSPPGETP 146 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPP 411 PP +PPPP P PP T PP K P G+ PP Sbjct: 106 PPAPPQTVSPPPPPDASPSPPAPTTT--NPPPKPSPSPPGETPSPPGETPSPP 156 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 35.9 bits (79), Expect = 0.037 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPF 502 SP P PP PP PPPP PPP F Sbjct: 574 SPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVF 607 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 585 PSPPPPVHSPPPPPVF--SPPPPVFSPPPPSP 614 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 SP P F PPPP PPPP PPP Sbjct: 601 SPPPPVFS---PPPPSPVYSPPPPSHSPPPP 628 Score = 32.3 bits (70), Expect = 0.46 Identities = 34/132 (25%), Positives = 40/132 (30%), Gaps = 2/132 (1%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP PPP P P P + PP P P++ + PPP + Sbjct: 524 PPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSPPP---PVY-----SSPPPPHVYSP 575 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFXLTXFFXXFFFXVXPPXXXFFXFXPPS--PPFXX 216 P H F F PP + PPS PP Sbjct: 576 PPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSP------PPPSPVYSPPPPSHSPPPPV 629 Query: 215 XSPPPXFFXXPP 180 SPPP F PP Sbjct: 630 YSPPPPTFSPPP 641 Score = 31.9 bits (69), Expect = 0.61 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P + PPP PPPP PPP P Sbjct: 558 SPPPPVY---SSPPPPHVYSPPPPVASPPPPSP 587 Score = 31.9 bits (69), Expect = 0.61 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 ++ SP P PPP PPP PPP P Sbjct: 563 VYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPP 598 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = -2 Query: 603 SPXXPXFXXXPP----PPPXXXVKPPPPXXXXPPP 511 SP P + PP PPP PPPP PPP Sbjct: 544 SPPSPIYSPPPPVHSPPPPVYS-SPPPPHVYSPPP 577 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = -2 Query: 603 SPXXPXFXXXPPPP----PXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 SP P PPPP P PPPP PP + G+P Sbjct: 608 SPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPPTHNTNQPPMGAP 653 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -1 Query: 568 PPPXXXXKTPPPRXXXPPPXPL*R-XXXGVPPXKKXFSPXPXXF 440 PPP PPP PPP P+ P +SP P F Sbjct: 594 PPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTF 637 Score = 28.7 bits (61), Expect = 5.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPP 511 P PP PPPP PPP Sbjct: 543 PSPPSPIYSPPPPVHSPPPP 562 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPP + PPP P P P Sbjct: 523 PPPPKVEDTRVPPPQPPMPSPSP 545 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPP 511 PP PP PP P PPP Sbjct: 535 PPQPPMPSPSPPSPIYSPPPP 555 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = -3 Query: 239 PPSPPFXXXSPPPX-FFXXPPXXF 171 PPSPP SPPP F PP F Sbjct: 584 PPSPPPPVHSPPPPPVFSPPPPVF 607 >At1g21310.1 68414.m02662 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 431 Score = 35.9 bits (79), Expect = 0.037 Identities = 30/137 (21%), Positives = 43/137 (31%), Gaps = 7/137 (5%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP +PPP PPP PP K P P++ ++ PPP Sbjct: 69 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVY----HSPPPPKKHYVY 122 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFX-------LTXFFXXFFFXVXPPXXXFFXFXPPS 231 P + H + + + + PP + + P Sbjct: 123 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 182 Query: 230 PPFXXXSPPPXFFXXPP 180 PP SPPP + PP Sbjct: 183 PPVKHYSPPPVYHSPPP 199 Score = 35.9 bits (79), Expect = 0.037 Identities = 30/137 (21%), Positives = 43/137 (31%), Gaps = 7/137 (5%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP +PPP PPP PP K P P++ ++ PPP Sbjct: 97 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVY----HSPPPPKKHYVY 150 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFX-------LTXFFXXFFFXVXPPXXXFFXFXPPS 231 P + H + + + + PP + + P Sbjct: 151 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 210 Query: 230 PPFXXXSPPPXFFXXPP 180 PP SPPP + PP Sbjct: 211 PPVKHYSPPPVYHSPPP 227 Score = 35.9 bits (79), Expect = 0.037 Identities = 30/137 (21%), Positives = 43/137 (31%), Gaps = 7/137 (5%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP +PPP PPP PP K P P++ ++ PPP Sbjct: 125 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVY----HSPPPPKKHYVY 178 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFX-------LTXFFXXFFFXVXPPXXXFFXFXPPS 231 P + H + + + + PP + + P Sbjct: 179 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 238 Query: 230 PPFXXXSPPPXFFXXPP 180 PP SPPP + PP Sbjct: 239 PPVKHYSPPPVYHSPPP 255 Score = 35.9 bits (79), Expect = 0.037 Identities = 30/137 (21%), Positives = 43/137 (31%), Gaps = 7/137 (5%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP +PPP PPP PP K P P++ ++ PPP Sbjct: 153 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVY----HSPPPPKKHYVY 206 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFX-------LTXFFXXFFFXVXPPXXXFFXFXPPS 231 P + H + + + + PP + + P Sbjct: 207 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 266 Query: 230 PPFXXXSPPPXFFXXPP 180 PP SPPP + PP Sbjct: 267 PPVKHYSPPPVYHSPPP 283 Score = 35.9 bits (79), Expect = 0.037 Identities = 30/137 (21%), Positives = 43/137 (31%), Gaps = 7/137 (5%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP +PPP PPP PP K P P++ ++ PPP Sbjct: 181 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVY----HSPPPPKKHYVY 234 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFX-------LTXFFXXFFFXVXPPXXXFFXFXPPS 231 P + H + + + + PP + + P Sbjct: 235 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 294 Query: 230 PPFXXXSPPPXFFXXPP 180 PP SPPP + PP Sbjct: 295 PPVKHYSPPPVYHSPPP 311 Score = 35.9 bits (79), Expect = 0.037 Identities = 30/137 (21%), Positives = 43/137 (31%), Gaps = 7/137 (5%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP +PPP PPP PP K P P++ ++ PPP Sbjct: 209 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVY----HSPPPPKKHYVY 262 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFX-------LTXFFXXFFFXVXPPXXXFFXFXPPS 231 P + H + + + + PP + + P Sbjct: 263 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 322 Query: 230 PPFXXXSPPPXFFXXPP 180 PP SPPP + PP Sbjct: 323 PPVKHYSPPPVYHSPPP 339 Score = 35.9 bits (79), Expect = 0.037 Identities = 30/137 (21%), Positives = 43/137 (31%), Gaps = 7/137 (5%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP +PPP PPP PP K P P++ ++ PPP Sbjct: 237 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVY----HSPPPPKKHYVY 290 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFX-------LTXFFXXFFFXVXPPXXXFFXFXPPS 231 P + H + + + + PP + + P Sbjct: 291 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 350 Query: 230 PPFXXXSPPPXFFXXPP 180 PP SPPP + PP Sbjct: 351 PPVKHYSPPPVYHSPPP 367 Score = 35.9 bits (79), Expect = 0.037 Identities = 30/137 (21%), Positives = 43/137 (31%), Gaps = 7/137 (5%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXNXXKX 390 PPP +PPP PPP PP K P P++ ++ PPP Sbjct: 265 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP--PVY----HSPPPPKKHYVY 318 Query: 389 XXEXXXXXXXLPLFLXHXXXSXXXFFX-------LTXFFXXFFFXVXPPXXXFFXFXPPS 231 P + H + + + + PP + + P Sbjct: 319 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPP 378 Query: 230 PPFXXXSPPPXFFXXPP 180 PP SPPP + PP Sbjct: 379 PPVKHYSPPPVYHSPPP 395 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = -1 Query: 568 PPPXXXXKTPPPRXXXPPPXPL*RXXXGVPPXKKXFSPXP 449 PPP +PPP PPP PP K +SP P Sbjct: 69 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 108 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = -1 Query: 568 PPPXXXXKTPPPRXXXPPPXPL*RXXXGVPPXKKXFSPXP 449 PPP +PPP PPP PP K +SP P Sbjct: 97 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 136 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = -1 Query: 568 PPPXXXXKTPPPRXXXPPPXPL*RXXXGVPPXKKXFSPXP 449 PPP +PPP PPP PP K +SP P Sbjct: 125 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 164 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = -1 Query: 568 PPPXXXXKTPPPRXXXPPPXPL*RXXXGVPPXKKXFSPXP 449 PPP +PPP PPP PP K +SP P Sbjct: 153 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 192 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = -1 Query: 568 PPPXXXXKTPPPRXXXPPPXPL*RXXXGVPPXKKXFSPXP 449 PPP +PPP PPP PP K +SP P Sbjct: 181 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 220 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = -1 Query: 568 PPPXXXXKTPPPRXXXPPPXPL*RXXXGVPPXKKXFSPXP 449 PPP +PPP PPP PP K +SP P Sbjct: 209 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 248 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = -1 Query: 568 PPPXXXXKTPPPRXXXPPPXPL*RXXXGVPPXKKXFSPXP 449 PPP +PPP PPP PP K +SP P Sbjct: 237 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 276 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = -1 Query: 568 PPPXXXXKTPPPRXXXPPPXPL*RXXXGVPPXKKXFSPXP 449 PPP +PPP PPP PP K +SP P Sbjct: 265 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 304 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = -1 Query: 568 PPPXXXXKTPPPRXXXPPPXPL*RXXXGVPPXKKXFSPXP 449 PPP +PPP PPP PP K +SP P Sbjct: 293 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 332 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = -1 Query: 568 PPPXXXXKTPPPRXXXPPPXPL*RXXXGVPPXKKXFSPXP 449 PPP +PPP PPP PP K +SP P Sbjct: 321 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 360 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = -1 Query: 568 PPPXXXXKTPPPRXXXPPPXPL*RXXXGVPPXKKXFSPXP 449 PPP +PPP PPP PP K +SP P Sbjct: 349 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPP 388 Score = 32.7 bits (71), Expect = 0.35 Identities = 32/147 (21%), Positives = 44/147 (29%), Gaps = 12/147 (8%) Frame = -3 Query: 584 FXGXXPPPXXXX*NP-----PPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNN 420 F PPP P PPP PPPP PP + S P + ++ Sbjct: 30 FYSSPPPPVKHYTPPVKHYSPPPVYHSPPPPKKHYEYKSPPPPVKHY--SPPPVY---HS 84 Query: 419 XPPPXNXXKXXXEXXXXXXXLPLFLXHXXXSXXXFFX-------LTXFFXXFFFXVXPPX 261 PPP P + H + + + + PP Sbjct: 85 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 144 Query: 260 XXFFXFXPPSPPFXXXSPPPXFFXXPP 180 + + P PP SPPP + PP Sbjct: 145 KKHYVYKSPPPPVKHYSPPPVYHSPPP 171 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -2 Query: 612 LFXSPXXPX--FXXXPPPPPXXXVKPPPPXXXXPPP 511 ++ SP P + PPPP PPP PPP Sbjct: 53 VYHSPPPPKKHYEYKSPPPPVKHYSPPPVYHSPPPP 88 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -2 Query: 612 LFXSPXXPX--FXXXPPPPPXXXVKPPPPXXXXPPP 511 ++ SP P + PPPP PPP PPP Sbjct: 81 VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 116 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -2 Query: 612 LFXSPXXPX--FXXXPPPPPXXXVKPPPPXXXXPPP 511 ++ SP P + PPPP PPP PPP Sbjct: 109 VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 144 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -2 Query: 612 LFXSPXXPX--FXXXPPPPPXXXVKPPPPXXXXPPP 511 ++ SP P + PPPP PPP PPP Sbjct: 137 VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 172 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -2 Query: 612 LFXSPXXPX--FXXXPPPPPXXXVKPPPPXXXXPPP 511 ++ SP P + PPPP PPP PPP Sbjct: 165 VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 200 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -2 Query: 612 LFXSPXXPX--FXXXPPPPPXXXVKPPPPXXXXPPP 511 ++ SP P + PPPP PPP PPP Sbjct: 193 VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 228 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -2 Query: 612 LFXSPXXPX--FXXXPPPPPXXXVKPPPPXXXXPPP 511 ++ SP P + PPPP PPP PPP Sbjct: 221 VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 256 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -2 Query: 612 LFXSPXXPX--FXXXPPPPPXXXVKPPPPXXXXPPP 511 ++ SP P + PPPP PPP PPP Sbjct: 249 VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 284 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -2 Query: 612 LFXSPXXPX--FXXXPPPPPXXXVKPPPPXXXXPPP 511 ++ SP P + PPPP PPP PPP Sbjct: 277 VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 312 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -2 Query: 612 LFXSPXXPX--FXXXPPPPPXXXVKPPPPXXXXPPP 511 ++ SP P + PPPP PPP PPP Sbjct: 305 VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 340 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -2 Query: 612 LFXSPXXPX--FXXXPPPPPXXXVKPPPPXXXXPPP 511 ++ SP P + PPPP PPP PPP Sbjct: 333 VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 368 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -2 Query: 612 LFXSPXXPX--FXXXPPPPPXXXVKPPPPXXXXPPP 511 ++ SP P + PPPP PPP PPP Sbjct: 361 VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 396 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/54 (31%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPP PPP PP K P P++ ++ PPP Sbjct: 349 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP--PPVY----HSPPPP 396 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 35.1 bits (77), Expect = 0.065 Identities = 21/55 (38%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPL--TXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PP PPP PPPPPL T PP K P P G ++ PPP Sbjct: 705 PPSSTRLGAPPP----PPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPP 755 Score = 32.3 bits (70), Expect = 0.46 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPP PPP P Sbjct: 577 PPPPPLPSRSIPPPLAQPPPPRP 599 Score = 30.7 bits (66), Expect = 1.4 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNN---XPPP 408 PPP PPPP PPPPP + P P P F N PPP Sbjct: 588 PPPLA---QPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPP 641 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP P P PPP P Sbjct: 594 PPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPP 625 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = -2 Query: 573 PPPPPXXXVK--PPPPXXXXPPPXPFDGXXXGS 481 PPPPP PPPP P P P G G+ Sbjct: 717 PPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGT 749 Score = 28.7 bits (61), Expect = 5.7 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP N P P PP PP + G PP P P L K PPP Sbjct: 686 PPPKANISNAPKPPAP-PPLPPSSTRLGAPPP-----PPPPP---LSKTPAPPP 730 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/49 (34%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFF----LGKNNXPPP 408 PPPP PPPP T P + P PLF + PPP Sbjct: 482 PPPPPP--PPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPP 528 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = -2 Query: 573 PPPPPXXXVKPP---PPXXXXPPPXP 505 PPP P + PP PP PPP P Sbjct: 579 PPPLPSRSIPPPLAQPPPPRPPPPPP 604 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P PPPPP P PPP P G+P Sbjct: 677 PSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAP 714 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPPP PPPPPL PP + P P Sbjct: 572 PPPPP---PPPPPLPSRSIPPPLAQPPPPRPPP 601 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/42 (30%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP + PPP PPP P P + P + P Sbjct: 578 PPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPP 619 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP + P PPP P Sbjct: 641 PPPPPPPPTRIPAAKCAPPPPPP 663 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 34.7 bits (76), Expect = 0.086 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPPP PPP P Sbjct: 315 PPPPPLLQQPPPPPSVSKAPPPP---PPPPPP 343 Score = 31.9 bits (69), Expect = 0.61 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = -2 Query: 573 PPPPPXXXVKPPPP--XXXXPPPXP 505 PPPPP +PPPP PPP P Sbjct: 314 PPPPPPLLQQPPPPPSVSKAPPPPP 338 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP PP Sbjct: 310 PPPPPP---PPPPLLQQPPPPPSVSKAPPPP 337 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = -2 Query: 573 PPPPPXXXVK--PPPPXXXXPPPXP 505 PPPPP ++ PPPP PP P Sbjct: 313 PPPPPPPLLQQPPPPPSVSKAPPPP 337 Score = 28.7 bits (61), Expect = 5.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -1 Query: 568 PPPXXXXKTPPPRXXXPPPXPL 503 PPP K PPP PPP L Sbjct: 325 PPPPSVSKAPPPPPPPPPPKSL 346 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 34.7 bits (76), Expect = 0.086 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 SP P PPPPP PPPP PPP Sbjct: 638 SPQSPPVHSPPPPPPVH--SPPPPVFSPPPP 666 Score = 34.7 bits (76), Expect = 0.086 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = -2 Query: 603 SPXXPXFXXXPP---PPPXXXVKPPPPXXXXPPPXP 505 SP P PP PPP PPPP PPP P Sbjct: 712 SPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAP 747 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = -2 Query: 603 SPXXPXFXXXPP---PPPXXXVKPPPPXXXXPPP 511 SP P + PP PPP PPPP PPP Sbjct: 669 SPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPP 702 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = -2 Query: 603 SPXXPXFXXXPP---PPPXXXVKPPPPXXXXPPPXP 505 SP P PP PPP + PPP PPP P Sbjct: 787 SPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKP 822 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = -2 Query: 603 SPXXPXFXXXPP---PPPXXXVKPPPPXXXXPPP 511 SP P PP PPP PPPP PPP Sbjct: 662 SPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPP 695 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = -2 Query: 603 SPXXPXFXXXPPP---PPXXXVKPPPPXXXXPPP 511 SP P PPP PP PPPP PPP Sbjct: 676 SPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPP 709 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = -2 Query: 603 SPXXPXFXXXPPP---PPXXXVKPPPPXXXXPPP 511 SP P PPP PP PPPP PPP Sbjct: 683 SPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 716 Score = 32.3 bits (70), Expect = 0.46 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = -2 Query: 603 SPXXPXFXXXPPP-----PPXXXVKPPPPXXXXPPPXP 505 SP P PPP PP V PPP PPP P Sbjct: 733 SPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPP 770 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = -2 Query: 603 SPXXPXFXXXPPP---PPXXXVKPPPPXXXXPPP 511 SP P PPP PP PPPP PPP Sbjct: 758 SPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPP 791 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = -2 Query: 603 SPXXPXFXXXPP---PPPXXXVKPPPPXXXXPPPXP 505 SP P F PP PPP V PPP PPP P Sbjct: 655 SPPPPVFSPPPPMHSPPPP--VYSPPPPVHSPPPPP 688 Score = 31.9 bits (69), Expect = 0.61 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = -2 Query: 612 LFXSPXXPXFXXXPP---PPPXXXVKPPPPXXXXPPP 511 ++ P P PP PPP PPPP PPP Sbjct: 748 IYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPP 784 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 4/34 (11%) Frame = -2 Query: 600 PXXPXFXXXPPP----PPXXXVKPPPPXXXXPPP 511 P P + PPP PP PPPP PPP Sbjct: 744 PPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPP 777 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = -2 Query: 603 SPXXPXFXXXPP--PPPXXXVKPPPPXXXXPPPXPF 502 SP P PP PP PPPP PPP F Sbjct: 705 SPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVF 740 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = -2 Query: 603 SPXXPXFXXXPP---PPPXXXVKPPPPXX-XXPPPXP 505 SP P PP PPP PPPP PPP P Sbjct: 719 SPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPP 755 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPP 507 PPP +PPPP PPPP Sbjct: 742 PPPPAPIYSPPPPPVHSPPPP 762 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = -2 Query: 603 SPXXPXFXXXPP---PPPXXXVKPPPPXXXXPPPXPF 502 SP P PP PPP PPP PPP F Sbjct: 780 SPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVF 816 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP +PPPP PPPP PP P P Sbjct: 727 PPPPVQ--SPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSP 766 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPP----PPXXXXPPPXP 505 SP P PPPPP PP PP PP P Sbjct: 741 SPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPP 777 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = -2 Query: 603 SPXXPXFXXXPPP--PPXXXVKPPPPXXXXPPP 511 SP P PPP P V PPP PPP Sbjct: 765 SPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 797 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/54 (33%), Positives = 23/54 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPP + PP P P+ ++ PPP Sbjct: 720 PPPPVH--SPPPPVQSPPPPPVFSP----PPPAPIYSPPPPPV-----HSPPPP 762 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -1 Query: 568 PPPXXXXKTPPPRXXXPPPXPL*RXXXGVPPXKKXFSPXP 449 PPP PPP PPP P+ PP SP P Sbjct: 727 PPPPVQSPPPPPVFSPPPPAPI-----YSPPPPPVHSPPP 761 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLT 498 PPP +PPPP PPP P+T Sbjct: 802 PPPPSPIYSPPPPV-FSPPPKPVT 824 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -1 Query: 568 PPPXXXXKTPPPRXXXPPPXPL 503 PPP +PPP PPP P+ Sbjct: 802 PPPPSPIYSPPPPVFSPPPKPV 823 >At2g04190.1 68415.m00404 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 411 Score = 34.7 bits (76), Expect = 0.086 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 451 DXGKXFFFXGGPPXXXVKGGGGGXXXXGGGG---FYXXXXGGG 570 D G FFF G P GGGG GGGG Y GGG Sbjct: 62 DPGPGFFFGGAGPGPGYGGGGGHGPGYGGGGDGRGYGSETGGG 104 >At1g24490.1 68414.m03084 60 kDa inner membrane family protein similar to chloroplast membrane protein (ALBINO3) (GI:3927828) [Arabidopsis thaliana] Length = 1013 Score = 34.7 bits (76), Expect = 0.086 Identities = 20/48 (41%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +2 Query: 452 TGGKXFFXXGDPXXXPSKGXGGGXXXS-GGGGFTXXXGGGGGXXXKXG 592 +GG G PS G G G S GGGG + GGGGG K G Sbjct: 401 SGGGSPSPGGGSGSPPSTGGGSGSPPSTGGGGGSPSKGGGGGKSGKSG 448 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +2 Query: 497 PSKGXGGGXXXS--GGGGFTXXXGGGGGXXXKXGXXG 601 PS G G G S GG G GGGGG K G G Sbjct: 406 PSPGGGSGSPPSTGGGSGSPPSTGGGGGSPSKGGGGG 442 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = -3 Query: 545 NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 +PPPP PPPL+ PP P P F+ ++ PPP Sbjct: 66 SPPPPPPHKHSPPPLSQSLSPPPLITVIHP-PPPRFYYFESTPPPP 110 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/58 (34%), Positives = 23/58 (39%), Gaps = 4/58 (6%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXX----PPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPPPL+ G P P S G+ P P Sbjct: 86 PPPLITVIHPPPPRFYYFESTPPPPPLSPDGKGSPPSVPSSPPSPKGQSQGQQQPPYP 143 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/55 (34%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXF---PXSXPLFFLGKNNXP 414 PPP + PPP PPPL PP + F P PL GK + P Sbjct: 67 PPPPPPHKHSPPPLSQSLSPPPLITVIHPPPPRFYYFESTPPPPPLSPDGKGSPP 121 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 SP P PPPPP PP PPP Sbjct: 58 SPSLPLSSSPPPPPPHKHSPPPLSQSLSPPP 88 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -2 Query: 618 LXLFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 L L SP P PPP + PPP PP P Sbjct: 61 LPLSSSPPPPPPHKHSPPPLSQSLSPPPLITVIHPPPP 98 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 3/57 (5%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXX---PPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPPP+ PP + P P+ + + PPP Sbjct: 436 PPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSPEFEGPL-PPVIGVSYASPPPP 491 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPP---XXXXPPPXP-FDG 496 +F P P PPPP PPPP PPP P F+G Sbjct: 433 VFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSPEFEG 475 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPP P PP P PPP P Sbjct: 417 SPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPP 449 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP P PP PPP P Sbjct: 403 PSPPIVALPPPPPPS---PPLPPPVYSPPPSP 431 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP +PPP PPPP + PP Sbjct: 427 PPPSPPVFSPPPSPPVYSPPPPPSIHYSSPP 457 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 ++ P P PP PP PPP PP P Sbjct: 424 VYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPP 459 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP P P Sbjct: 456 PPPPPVHHSSPPPPSPEFEGPLP 478 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPP PP PP+ PP P S + ++ PPP Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPS-----IHYSSPPPP 459 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/54 (31%), Positives = 20/54 (37%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PP P PPP P PP P P+ ++ PPP Sbjct: 421 PPPVYSP--PPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVH---HSSPPPP 469 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +2 Query: 500 SKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 S+G GGG GGGG GGGGG G G Sbjct: 86 SRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYG 119 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGG-GGGXXXKXGXXG 601 G GGG GGGG++ G GGG + G G Sbjct: 98 GGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGG 130 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/55 (34%), Positives = 24/55 (43%), Gaps = 4/55 (7%) Frame = +2 Query: 449 RTGGKXFFXXGDPXXXPSKGX--GGGXXXSGGGGFTXXXGGGG--GXXXKXGXXG 601 R+GG + G G GGG GGGG++ GGGG G + G G Sbjct: 104 RSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGG 158 >At5g67060.1 68418.m08455 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 241 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGG 574 G GGG GGGG T GGGGG Sbjct: 195 GGGGGRVLIGGGGMTAASGGGGG 217 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP P PP PPPPPL+ PP Sbjct: 1093 PPPPAALFPPLPPPPSQPPPPPLSPPPSPPP 1123 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP P PPPPP P PP PPP P Sbjct: 1083 SPPLPP-SSLPPPPPAALFPPLPPPPSQPPPPP 1114 Score = 31.5 bits (68), Expect = 0.81 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PP PP PPPP P P P Sbjct: 1092 PPPPPAALFPPLPPPPSQPPPPPLSPPPSPPP 1123 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 4/36 (11%) Frame = -2 Query: 600 PXXPXFXXXPPPP----PXXXVKPPPPXXXXPPPXP 505 P P PPPP P + PPPP PP P Sbjct: 1070 PPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPP 1105 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 1101 PPLPPPPSQPPPPPL----SPPPSPPPPPPPP 1128 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPP--PXXXXPPPXP 505 P P P PPP PPP P PPP P Sbjct: 1093 PPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPP 1126 Score = 29.1 bits (62), Expect = 4.3 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PP P PP PPL PP FP P + PPP Sbjct: 1069 PPPL-----PPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPP----PPSQPPPP 1113 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 5/46 (10%) Frame = -2 Query: 600 PXXPXFXXXPPPP-----PXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P + PPPP P PPPP PPP P SP Sbjct: 504 PPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSP 549 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = -2 Query: 600 PXXPXFXXXP-PPPPXXXVKPPPPXXXXPPP 511 P P P PPPP PPPP PPP Sbjct: 529 PPPPLSPPPPSPPPPYIYSSPPPPSPSPPPP 559 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXV--KPPPPXXXXPPPXP 505 S P PPPPP PPPP PP P Sbjct: 518 SEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPP 552 Score = 28.7 bits (61), Expect = 5.7 Identities = 19/64 (29%), Positives = 26/64 (40%), Gaps = 10/64 (15%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPP-----PPLTXXXGGP-----PXKKXXFPXSXPLFFLGKNN 420 PPP +PPPP PP PP T P P + +P P ++ ++ Sbjct: 549 PPPPSP--SPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSS 606 Query: 419 XPPP 408 PPP Sbjct: 607 PPPP 610 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPP 514 PPPPP PPPP P Sbjct: 503 PPPPPEYEPSPPPPSSEMSP 522 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +2 Query: 512 GGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 GGG SGGGG GGGGG + G G Sbjct: 104 GGGGGYSGGGGGGYSGGGGGGYERRSGGYG 133 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXGXKKS 613 G GGG GGGG++ GGGGG G ++S Sbjct: 96 GSGGGYRSGGGGGYSG--GGGGGYSGGGGGGYERRS 129 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 500 SKGXGGGXXXSGGGGFTXXXGGGGG 574 S+G GGG GG G GGGGG Sbjct: 84 SRGSGGGGGGRGGSGGGYRSGGGGG 108 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 502 KGGGGGXXXXGGGGFYXXXXGGG 570 +GG GG GGGG Y GGG Sbjct: 94 RGGSGGGYRSGGGGGYSGGGGGG 116 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 502 KGGGGGXXXXGGGGFYXXXXGGG 570 + GGGG GGGG Y GGG Sbjct: 102 RSGGGGGYSGGGGGGYSGGGGGG 124 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/41 (39%), Positives = 19/41 (46%), Gaps = 4/41 (9%) Frame = +2 Query: 500 SKGXGGGXXXSGGGGFTXXXG----GGGGXXXKXGXXGXKK 610 S G GGG GGGG+ G GGGG G G ++ Sbjct: 110 SGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRRE 150 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 505 GGGGGXXXXGGGGFYXXXXGG 567 GGGGG GGGG Y GG Sbjct: 111 GGGGGGYSGGGGGGYERRSGG 131 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG G GGG G G Sbjct: 135 GGGGGGRGYGGGGRREGGGYGGGDGGSYGGGG 166 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 4/41 (9%) Frame = +2 Query: 500 SKGXGGGXXXSGG----GGFTXXXGGGGGXXXKXGXXGXKK 610 S G GGG SGG GG GGGGG G G ++ Sbjct: 87 SGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYER 127 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 33.5 bits (73), Expect = 0.20 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPP 511 PPP P +KPPPP PPP Sbjct: 262 PPPLPPQTLKPPPPQTTPPPP 282 Score = 31.5 bits (68), Expect = 0.81 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPP + PPPP PPP Sbjct: 105 PPPPAITPPPPPAITPPLSPPPPAITPPPP 134 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PP PPPP PPPPP PP Sbjct: 95 PPLSPPQTTPPPPPAITPPPPPAITPPLSPP 125 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPP 477 PPPP PPPP +T PP Sbjct: 105 PPPPAITPPPPPAITPPLSPPP 126 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPP PPPP T PP K P S P + PPP Sbjct: 114 PPPAITPPLSPPPPAITPPPPLATTPPALPP-KPLPPPLSPP-----QTTPPPP 161 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P P PP + PPPP PP P Sbjct: 111 TPPPPPAITPPLSPPPPAITPPPPLATTPPALP 143 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPP PPPPP PP Sbjct: 262 PPPLPPQTLKPPPPQTTPPPPPAITPPLSPP 292 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P P PP +P PP PPP P Sbjct: 41 NPGPPPPQPDPQPPTPPTFQPAPPANDQPPPPP 73 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPP PPPP PPP P Sbjct: 94 PPPLSPPQTTPPPPPAITPPPPP 116 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 +P P PPPP PPP PPP Sbjct: 103 TPPPPPAITPPPPPAITPPLSPPPPAITPPP 133 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP + PPPP PP P Sbjct: 104 PPPPPA--ITPPPPPAITPPLSP 124 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PP P PPPP PPP Sbjct: 86 PALPPKPLPPPLSPPQTTPPPPPAITPPPP 115 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P P PP PPPP PPP Sbjct: 51 PQPPTPPTFQPAPPANDQPPPPPQSTSPPP 80 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = -2 Query: 573 PPPPPXXXV---KPPPPXXXXPPPXP 505 PPPPP + PPPP PP P Sbjct: 31 PPPPPCICICNPGPPPPQPDPQPPTP 56 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 33.5 bits (73), Expect = 0.20 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P + P PP + PPPP PPP P Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPPSLPPPVP 34 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PP PP PPPPP + PP P S P Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYP 46 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXGXKKS 613 G GGG GGGG GGGG G G K+ Sbjct: 186 GGGGGSFGGGGGGGAGSYGGGGAGAGSGGGGGFSKA 221 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 451 DXGKXFFFXGGPPXXXVKGGGGGXXXXGGGGFYXXXXGGG 570 D G+ GG GGGGG GGGG GGG Sbjct: 177 DQGRQGSRYGGGGGSFGGGGGGGAGSYGGGGAGAGSGGGG 216 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXX-VKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPPPP +PPPP P P G SP Sbjct: 792 PPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPPIPGISYASP 833 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/58 (31%), Positives = 20/58 (34%), Gaps = 4/58 (6%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXX----PPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP NPPPP PP PP+ PP + P PPP Sbjct: 759 PPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPP 816 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPP---PXXXXPPPXP 505 P PPPPP PPP P PPP P Sbjct: 752 PCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSP 783 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = -2 Query: 600 PXXPXFXXX-PPPPPXXXVKPPPP---XXXXPPPXP 505 P P + PPPPP PPPP PPP P Sbjct: 781 PSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPP 816 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/54 (29%), Positives = 19/54 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PP PPPP PPPP PP P+ + + PPP Sbjct: 783 PPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPPIPGISYASPPPP 836 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/54 (33%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = -3 Query: 566 PPXXXX*NPPPPXX-XXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PP PPPP PPPPP PP + S P + PPP Sbjct: 751 PPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPP 804 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P + PP P + PPPP P P Sbjct: 716 PPPPHYSLPPPTPTYHYISPPPPPTPIHSPPP 747 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = -2 Query: 573 PPPPPXXXVKPPPP--XXXXPPPXP 505 PPPPP + PP P PPP P Sbjct: 715 PPPPPHYSLPPPTPTYHYISPPPPP 739 Score = 29.1 bits (62), Expect = 4.3 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXF--PXSXPLFFLGKNNXPPP 408 PPP +PP PPPPP PP + P S P+++ N+ PPP Sbjct: 745 PPPQS---HPPCIEY-SPPPPPTVHYNPPPPPSPAHYSPPPSPPVYYY--NSPPPP 794 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/37 (35%), Positives = 15/37 (40%), Gaps = 5/37 (13%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXP-----PPXP 505 P P + PPPP + PPP P PP P Sbjct: 725 PPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPP 761 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -3 Query: 281 FXVXPPXXXFFXFXPPSPPFXXXSPPP 201 + + PP + PP PP SPPP Sbjct: 721 YSLPPPTPTYHYISPPPPPTPIHSPPP 747 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -1 Query: 541 PPPRXXXPPPXPL*RXXXGVPPXKKXFSPXP 449 PPP PPP P PP SP P Sbjct: 717 PPPHYSLPPPTPTYHYISPPPPPTPIHSPPP 747 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 5/40 (12%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPP-----XXXXPPPXP 505 + P P PPPPP PPP PPP P Sbjct: 756 YSPPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPP 795 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 4/40 (10%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPP----XXXXPPPXPF 502 + P P PPPP P PP PPP PF Sbjct: 799 YSPPPPPVIHHSQPPPPPIYEGPLPPIPGISYASPPPPPF 838 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/53 (28%), Positives = 21/53 (39%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPP 411 P P PPPP PPPPP + P + +P ++ + PP Sbjct: 54 PEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPP 106 Score = 32.3 bits (70), Expect = 0.46 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 P PPP PPPP PPP P Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSP 83 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = -2 Query: 573 PPPPPXXXVKP-PPPXXXXPPPXP 505 PPPP + P PPP PPP P Sbjct: 91 PPPPYHHYITPSPPPPRPLPPPPP 114 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 SP + PPPP PPP P P P Sbjct: 53 SPEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSP 85 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 545 NPPPPXXXXPPPPP 504 +PPPP PPPPP Sbjct: 102 SPPPPRPLPPPPPP 115 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P P P + PPP PPP P SP Sbjct: 52 PSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSP 83 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXX-PPPPPLTXXXGGPPXKK 468 PPP P PP PPPPP P KK Sbjct: 92 PPPYHHYITPSPPPPRPLPPPPPPPLHFSSPLIKK 126 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXX--PPPPPLTXXXGGPPXKKXXFPXSXP 444 G PPP PPPP PPPP + G PP P P Sbjct: 250 GPPPPPHIGGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPP 296 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/49 (36%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = -3 Query: 542 PPP--PXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXN 402 PPP P PPPPP PP P +G+N PPP N Sbjct: 241 PPPQRPPMGGPPPPPHIGGSAPPPPHMGGSAPPPP--HMGQNYGPPPPN 287 Score = 32.7 bits (71), Expect = 0.35 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPP-XXXXPPPXPFDGXXXGSP 478 P P PPPP PPPP PP P G G P Sbjct: 243 PQRPPMGGPPPPPHIGGSAPPPPHMGGSAPPPPHMGQNYGPP 284 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/59 (28%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXX---XXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPP 411 G PP PPPP PPPP + PP + P G + PP Sbjct: 239 GGPPPQRPPMGGPPPPPHIGGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPPP 297 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 33.1 bits (72), Expect = 0.26 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP P PP PPP P Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSP 87 Score = 31.9 bits (69), Expect = 0.61 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP +PPPP P PPP G P Sbjct: 73 PPPSPPPPSPPPPSPPPPSPPPPAFAVGKTP 103 Score = 31.5 bits (68), Expect = 0.81 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPF 502 P P PP PP PP P PPP F Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSPPPPAF 97 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPP 511 PPPPP PP P PPP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPP 84 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PP +PPPP P PPP + PP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPP 93 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = -3 Query: 539 PPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGK 426 PPP PPPP PP P F +GK Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPPPAFAVGK 101 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPP P PPP PP P Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPP PPPP PP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPP 94 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/56 (32%), Positives = 22/56 (39%) Frame = +2 Query: 434 KKKXXRTGGKXFFXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 ++ R GG+ F G GGG GGGG+ G GGG G G Sbjct: 563 RRSGGRFGGRDFRREGSFGSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGG 618 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 33.1 bits (72), Expect = 0.26 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PP P PPP P Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPSP 85 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXP 505 PPPP PPPP PP P Sbjct: 80 PPPPSPPPSPPPPQLPPPPQLP 101 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 P P P PPPP PPP P Sbjct: 54 PEPEPADCPPPPPPPPCPPPPSP 76 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP P PP PP P Sbjct: 64 PPPPPPCPPPPSPPPCPPPPSPP 86 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPP P P P Sbjct: 65 PPPPPCPPPPSPPPCPPPPSPPP 87 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPP PP Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPPPP 92 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPPP PPP PPP Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPPP 91 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PP PP + PPP PP P Sbjct: 77 PPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKP 108 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PPP P PP P PPP Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPSPPPSPPPP 92 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPP PPPP L PP Sbjct: 72 PPPSPPPCPPPPSPPPSPPPPQLPPPPQLPP 102 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPP---PXXXXPPPXP 505 P P PPPP PPP P PPP P Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAP 105 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PP PP P PP PP P Sbjct: 64 PPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLP 95 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P PP PP P PP PPP Sbjct: 68 PPCPPPPSPPPCPPPPSPPPSPPPPQLPPP 97 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P P PPP PPP PPP Sbjct: 69 PCPPPPSPPPCPPPPSPPPSPPPPQLPPPP 98 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 P P PPPP PP PP PP Sbjct: 56 PEPADCPPPPPPPPCPPPPSPPPCPPPPSPP 86 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 33.1 bits (72), Expect = 0.26 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 + SP P PPPPP P P PPP Sbjct: 555 YKSPPTPYVYHSPPPPPYYSPSPKPAYKSSPPP 587 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 L+ SP P PPPP PPPP P P Sbjct: 18 LYDSPT-PKVDYKSPPPPYVYSSPPPPLSYSPSP 50 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP---PXXXVK---PPPPXXXXPPPXPF 502 + SP P PPPP P V+ PPPP PP P+ Sbjct: 54 YKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPY 95 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 ++ SP P PPPP P K PPPP PP P+ Sbjct: 478 VYKSPPPPYVYSSPPPPYYSPSPKPSYKSPPPPYVYNSPPPPY 520 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 7/43 (16%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPP-------XXXVKPPPPXXXXPPPXPF 502 + SP P PPPPP PPPP PP P+ Sbjct: 731 YKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPY 773 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 104 YKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYNSPPPPY 145 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 179 YKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYIYSSPPPPY 220 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/54 (31%), Positives = 23/54 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPPL+ P K + P + ++ PPP Sbjct: 22 PTPKVDYKSPPPPYVYSSPPPPLSY----SPSPKVDYKSPPPPYVY--SSPPPP 69 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPF 502 ++ SP P + P P P PPP PPP P+ Sbjct: 714 VYSSPPPPYYS--PSPKPTYKSPPPPYVYSSPPPPPY 748 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/40 (35%), Positives = 17/40 (42%), Gaps = 6/40 (15%) Frame = -2 Query: 612 LFXSPXXPXFXXXP------PPPPXXXVKPPPPXXXXPPP 511 ++ SP P + P PPPP PPPP P P Sbjct: 765 VYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSP 804 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 7/43 (16%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP----PXXXV---KPPPPXXXXPPPXPF 502 + SP P PPPP P V PPPP PP P+ Sbjct: 28 YKSPPPPYVYSSPPPPLSYSPSPKVDYKSPPPPYVYSSPPPPY 70 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 7/43 (16%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVKPPPPXX--XXPPPXPF 502 + SP P PPPP P K PPP PPP P+ Sbjct: 757 YKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPPY 799 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 + SP P PPPPP P PPP Sbjct: 782 YKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPP 814 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 + SP P PPPP PPPP P P Sbjct: 799 YYSPS-PKVEYKSPPPPYVYSSPPPPTYYSPSP 830 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP P K + P + N+ PPP Sbjct: 373 PSPKPTYKSPPPPYVYSSPPPPYY-----SPSPKPVYKSPPPPYIY--NSPPPP 419 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP P K + P + N+ PPP Sbjct: 802 PSPKVEYKSPPPPYVYSSPPPPTYY----SPSPKVEYKSPPPPYVY--NSPPPP 849 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 7/42 (16%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP----PXXXVK---PPPPXXXXPPPXP 505 + SP P PPPP P V+ PPPP PP P Sbjct: 808 YKSPPPPYVYSSPPPPTYYSPSPKVEYKSPPPPYVYNSPPPP 849 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 + SP P PPPP PPPP P P Sbjct: 825 YYSPS-PKVEYKSPPPPYVYNSPPPPAYYSPSP 856 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/42 (35%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 612 LFXSPXXPXFXXXP------PPPPXXXVKPPPPXXXXPPPXP 505 ++ SP P + P PPPP PPPP P P P Sbjct: 87 VYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP-YYSPSPKP 127 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP P K + P + N+ PPP Sbjct: 98 PSPKVDYKSPPPPYVYSSPPPPYY-----SPSPKPTYKSPPPPYVY--NSPPPP 144 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP P K + P + N+ PPP Sbjct: 148 PSPKVEYKSPPPPYVYSSPPPPYY-----SPSPKVDYKSPPPPYVY--NSPPPP 194 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP P K + P + N+ PPP Sbjct: 248 PSPKPAYKSPPPPYVYSSPPPPYY-----SPSPKPIYKSPPPPYVY--NSPPPP 294 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 ++ SP P + PPPP P P PPP Sbjct: 278 IYKSPPPP-YVYNSPPPPYYSPSPKPAYKSPPPP 310 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/54 (31%), Positives = 22/54 (40%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP P K + S P + ++ PPP Sbjct: 423 PSPKPSYKSPPPPYVYSSPPPPYY-----SPSPKLTYKSSPPPYVY--SSPPPP 469 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/42 (35%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 612 LFXSPXXPXFXXXP------PPPPXXXVKPPPPXXXXPPPXP 505 ++ SP P + P PPPP PPPP P P P Sbjct: 462 VYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPP-YYSPSPKP 502 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP P K + P + N+ PPP Sbjct: 473 PSPKVVYKSPPPPYVYSSPPPPYY-----SPSPKPSYKSPPPPYVY--NSPPPP 519 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/42 (35%), Positives = 18/42 (42%), Gaps = 7/42 (16%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP----PXXXVK---PPPPXXXXPPPXP 505 + SP P PPPP P ++ PPPP PP P Sbjct: 834 YKSPPPPYVYNSPPPPAYYSPSPKIEYKSPPPPYVYSSPPPP 875 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/42 (35%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 612 LFXSPXXPXFXXXP------PPPPXXXVKPPPPXXXXPPPXP 505 ++ SP P + P PPPP PPPP P P P Sbjct: 162 VYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPP-YYSPSPKP 202 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/43 (32%), Positives = 17/43 (39%) Frame = -1 Query: 568 PPPXXXXKTPPPRXXXPPPXPL*RXXXGVPPXKKXFSPXPXXF 440 PPP +PPP P P P+ PP SP P + Sbjct: 207 PPPPYIYSSPPPPYYSPSPKPV---YKSPPPPYVYSSPPPPYY 246 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 ++ SP P + PPPP P P PPP Sbjct: 228 VYKSPPPP-YVYSSPPPPYYSPSPKPAYKSPPPP 260 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 ++ SP P + PPPP P P PPP Sbjct: 328 VYKSPPPP-YVYNSPPPPYYSPSPKPAYKSPPPP 360 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 ++ SP P + PPPP P P PPP Sbjct: 403 VYKSPPPP-YIYNSPPPPYYSPSPKPSYKSPPPP 435 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P PP P PPPP P P P Sbjct: 551 PKIEYKSPPTPYVYHSPPPPPYYSPSPKP 579 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 ++ SP P + PPPP P P PPP Sbjct: 605 VYKSPPPP-YVYNSPPPPYYSPSPKPTYKSPPPP 637 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP P K S P ++ + PPP Sbjct: 700 PAPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYK------SPPPPYVYSSPPPPP 747 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 32.7 bits (71), Expect = 0.35 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPP PPPP PPP P Sbjct: 234 PPPPHQAQPPPPPPSGLFPPPPP 256 Score = 32.7 bits (71), Expect = 0.35 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PPPP PPPPP G P Sbjct: 235 PPPHQAQPPPPPPSGLFPPPPPPMANNGFRP 265 Score = 31.9 bits (69), Expect = 0.61 Identities = 13/26 (50%), Positives = 14/26 (53%), Gaps = 3/26 (11%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXX---XXPPPXP 505 PPPPP +PPPP PPP P Sbjct: 232 PPPPPPHQAQPPPPPPSGLFPPPPPP 257 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 G PPP PPPP PPPPP + PP Sbjct: 228 GLPPPP------PPPPHQAQPPPPPPSGLFPPPP 255 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPP 532 P P PPPPP + PPPP Sbjct: 233 PPPPPHQAQPPPPPPSGLFPPPP 255 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPP 532 P P PPPPP PPPP Sbjct: 234 PPPPHQAQPPPPPPSGLFPPPPP 256 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 32.3 bits (70), Expect = 0.46 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPP 504 PPP PPPP PPPPP Sbjct: 373 PPPLQTPPPPPPPPPLAPPPPP 394 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXP 517 P PPPPP + PPPP P Sbjct: 374 PPLQTPPPPPPPPPLAPPPPPQKRP 398 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKK 468 PPP +PPP PPPPP PP K+ Sbjct: 367 PPPRR---SPPPLQTPPPPPPPPPLAPPPPPQKR 397 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPP 511 PPPPP PPPP PPP Sbjct: 379 PPPPP-----PPPPLAPPPPP 394 >At5g48050.1 68418.m05937 hypothetical protein low similarity to copia-like polyprotein [Arabidopsis thaliana] GI:13872712 Length = 369 Score = 32.3 bits (70), Expect = 0.46 Identities = 16/48 (33%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = -3 Query: 545 NPPPPXXXXPPPPPLTXXXGGPP--XKKXXFPXSXPLFFLGKNNXPPP 408 N PP PP P GGP KK FP P++ ++ P P Sbjct: 270 NQPPTWIYGPPQSPYMYPHGGPQFFHKKTYFPQQPPVYMSVTSHKPSP 317 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPP-PXPFDGXXXGSP 478 PPPPP PPPP PP P F G P Sbjct: 219 PPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMP 251 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/58 (29%), Positives = 20/58 (34%) Frame = -3 Query: 584 FXGXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPP 411 F G PP PPP PPP GPP + P + F + PP Sbjct: 195 FSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMPP 252 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/37 (35%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = -2 Query: 600 PXXPXFXXXPP----PPPXXXVKPPPPXXXXPPPXPF 502 P P PP PPP ++PPP PPP + Sbjct: 167 PPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQY 203 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = -1 Query: 601 PXXXXFXXGXXPPPXXXXKTPPPRXXXPP-PXPL*RXXXGVPP 476 P G PPP PPPR PP P G+PP Sbjct: 210 PPPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMPP 252 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPP-PXPFDGXXXGSP 478 PPPPP PPPP PP P F G P Sbjct: 219 PPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMP 251 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/58 (29%), Positives = 20/58 (34%) Frame = -3 Query: 584 FXGXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPP 411 F G PP PPP PPP GPP + P + F + PP Sbjct: 195 FSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMPP 252 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/37 (35%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = -2 Query: 600 PXXPXFXXXPP----PPPXXXVKPPPPXXXXPPPXPF 502 P P PP PPP ++PPP PPP + Sbjct: 167 PPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQY 203 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = -1 Query: 601 PXXXXFXXGXXPPPXXXXKTPPPRXXXPP-PXPL*RXXXGVPP 476 P G PPP PPPR PP P G+PP Sbjct: 210 PPPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMPP 252 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 32.3 bits (70), Expect = 0.46 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PPP PPP P PP LT P KK P P Sbjct: 91 PPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTP 132 Score = 31.5 bits (68), Expect = 0.81 Identities = 16/46 (34%), Positives = 18/46 (39%) Frame = -3 Query: 545 NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 +PPPP PPPP PP P P K+ PPP Sbjct: 89 SPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTP----KKSPSPPP 130 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = -2 Query: 573 PPPPPXXXVKP--PPPXXXXPPPXPF 502 PPPPP V P PPP PP PF Sbjct: 13 PPPPPRLLVLPPLPPPPPPPPPQLPF 38 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP + PP PPP P Sbjct: 12 PPPPPPRLLVLPPLPPPPPPPPP 34 >At3g28550.1 68416.m03565 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1018 Score = 32.3 bits (70), Expect = 0.46 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 7/44 (15%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKP-------PPPXXXXPPPXPF 502 L+ SP P PPPPP P PPP PP P+ Sbjct: 625 LYKSPPHPHVCVCPPPPPCYSPSPKVVYKSSPPPYVYSSPPPPY 668 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 L+ SP P PPPP P K PPPP PP P+ Sbjct: 509 LYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPY 551 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 ++ SP P PPPP P K PPPP PP P+ Sbjct: 209 VYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 251 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 ++ SP P PPPP P K PPPP PP P+ Sbjct: 259 VYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 301 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 ++ SP P PPPP P K PPPP PP P+ Sbjct: 309 VYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPY 351 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 ++ SP P PPPP P K PPPP PP P+ Sbjct: 384 VYKSPPPPYVYSSPPPPYYTPSPKVVYKSPPPPYVYSSPPPPY 426 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 ++ SP P PPPP P K PPPP PP P+ Sbjct: 409 VYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 451 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 ++ SP P PPPP P K PPPP PP P+ Sbjct: 459 VYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 501 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 ++ SP P PPPP P K PPPP PP P+ Sbjct: 534 VYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPY 576 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 ++ SP P PPPP P K PPPP PP P+ Sbjct: 559 VYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPY 601 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 ++ SP P PPPP P K PPPP PP P+ Sbjct: 726 VYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPY 768 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 ++ SP P PPPP P K PPPP PP P+ Sbjct: 751 VYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPY 793 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 ++ SP P PPPP P K PPPP PP P+ Sbjct: 776 VYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPY 818 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 ++ SP P PPPP P K PPPP PP P+ Sbjct: 801 VYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPY 843 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 ++ SP P PPPP P K PPPP PP P+ Sbjct: 826 VYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPY 868 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 ++ SP P PPPP P K PPPP PP P+ Sbjct: 851 VYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 893 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 110 YKSPPPPYVYSSPPPPIYSPSPKVDYKSPPPPYVYSSPPPPY 151 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 185 YKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPY 226 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 235 YKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPPY 276 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 285 YKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPY 326 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 335 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 376 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 360 YKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPPY 401 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 435 YKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPY 476 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 485 YKSPPPPYVYSSPPPPYYSPSPKVLYKSPPPPYVYSSPPPPY 526 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 677 YKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPY 718 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 702 YKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPY 743 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 877 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 918 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 902 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 943 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/54 (29%), Positives = 19/54 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP K P P + + PPP Sbjct: 946 PAPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYYSPSPKVDYKSPPPP 999 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPP------PPXXXVKPPPPXXXXPPPXPF 502 + SP P PPP P PPPP PP P+ Sbjct: 160 YKSPPSPYVYNSPPPSYYSPSPKVDYKSPPPPYVYSSPPPPY 201 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 585 YKSPPPPYVYSSPPPPYYSPSPKVYYK 611 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPL 501 P P +PPPP PPPP+ Sbjct: 104 PSPKVDYKSPPPPYVYSSPPPPI 126 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 32.3 bits (70), Expect = 0.46 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = -1 Query: 568 PPPXXXXKTPPPRXXXPPPXPL*RXXXGVPPXKKXFSP 455 PPP +PPP PPP P +PP + P Sbjct: 55 PPPPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPP 92 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXPF 502 PPPP V PPP PPP P+ Sbjct: 55 PPPPTP-VYSPPPADLPPPPTPY 76 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 7/40 (17%) Frame = -2 Query: 600 PXXPXFXXXP---PPPPXXXVKPP----PPXXXXPPPXPF 502 P P + P PPPP PP PP PPP F Sbjct: 57 PPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPPVAF 96 >At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 Zinc finger, C3HC4 type (RING finger) Length = 359 Score = 32.3 bits (70), Expect = 0.46 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPP 514 PPPPP + PPPP PP Sbjct: 24 PPPPPYYYLDPPPPPPPFPP 43 >At3g05920.1 68416.m00668 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 126 Score = 32.3 bits (70), Expect = 0.46 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPP P KPP P PPP P Sbjct: 72 PPPKPPEPPKPPEPEKPKPPPAP 94 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 4/36 (11%) Frame = -2 Query: 573 PPPPPXXXVKPPPP----XXXXPPPXPFDGXXXGSP 478 PPPPP PPPP PPP P G P Sbjct: 386 PPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGP 421 Score = 31.5 bits (68), Expect = 0.81 Identities = 23/59 (38%), Positives = 24/59 (40%), Gaps = 3/59 (5%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXP--PPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXP-PPXN 402 PPP PPPP P PPPP PP KK P P + K P PP N Sbjct: 388 PPPSAAAPPPPPPPKKGPAAPPPP------PPPGKKGAGPPPPPP--MSKKGPPKPPGN 438 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 31.9 bits (69), Expect = 0.61 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PP P PPPP PPP P Sbjct: 708 PPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAP 739 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/56 (32%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKK--XXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPP P T G K P + P + PPP Sbjct: 718 PTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPP 773 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 3/44 (6%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXX---VKPPPPXXXXPPPXPFDGXXXGSP 478 P P PPPPP K PPP PP P SP Sbjct: 684 PALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSP 727 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 2/25 (8%) Frame = -2 Query: 573 PPPPPXXXVKPPPP--XXXXPPPXP 505 PPPPP PP P PPP P Sbjct: 707 PPPPPPAPPAPPTPIVHTSSPPPPP 731 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P PP P PPPP PPP Sbjct: 754 PPAPPAPPRLPTHSASPPPPTAPPPPP 780 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 31.9 bits (69), Expect = 0.61 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGG 571 G GGG GGGG++ GGGG Sbjct: 104 GGGGGYSGGGGGGYSGGGGGGG 125 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG++ GGGGG G G Sbjct: 96 GSGGGYRSGGGGGYSG--GGGGGYSGGGGGGG 125 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 500 SKGXGGGXXXSGGGGFTXXXGGGGG 574 S+G GGG GG G GGGGG Sbjct: 84 SRGSGGGGGGRGGSGGGYRSGGGGG 108 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 502 KGGGGGXXXXGGGGFYXXXXGGG 570 +GG GG GGGG Y GGG Sbjct: 94 RGGSGGGYRSGGGGGYSGGGGGG 116 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 503 KGXGGGXXXSGGGGFTXXXGGGGG 574 + GGG GGGG GGGGG Sbjct: 102 RSGGGGGYSGGGGGGYSGGGGGGG 125 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = +2 Query: 500 SKGXGGGXXXSGG----GGFTXXXGGGGGXXXKXGXXG 601 S G GGG SGG GG GGGGG G G Sbjct: 87 SGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 31.9 bits (69), Expect = 0.61 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGG 574 G GGG GGGF GGGGG Sbjct: 15 GGGGGHGGGAGGGFGGGAGGGGG 37 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 31.9 bits (69), Expect = 0.61 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPF 502 PP PP PPP PPP P+ Sbjct: 32 PPSPPPYVYSSPPPYTYSPPPSPY 55 Score = 31.9 bits (69), Expect = 0.61 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 P + PPPP KPPP PPP ++ P Sbjct: 385 PPYAYSPPPPCPDVYKPPPYVYSSPPPYVYNPPPSSPP 422 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -3 Query: 251 FXFXPPSPP-FXXXSPPPXFFXXPPXXFXKK 162 + + PPSPP + SPPP + PP + K Sbjct: 28 YPYSPPSPPPYVYSSPPPYTYSPPPSPYVYK 58 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPP------PPXXXXPPPXPF 502 ++ SP P + PPP P PP PP PPP P+ Sbjct: 39 VYSSP--PPYTYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPY 79 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPP------PPXXXXPPPXPF 502 ++ SP P + PPP P PP PP PPP P+ Sbjct: 63 VYSSP--PPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPY 103 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPP------PPXXXXPPPXPF 502 ++ SP P + PPP P PP PP PPP P+ Sbjct: 87 VYSSP--PPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPY 127 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPP------PPXXXXPPPXPF 502 ++ SP P + PPP P PP PP PPP P+ Sbjct: 229 VYSSP--PPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPY 269 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPP------PPXXXXPPPXPF 502 ++ SP P + PPP P PP PP PPP P+ Sbjct: 253 VYSSP--PPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPY 293 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPP------PPXXXXPPPXPF 502 ++ SP P + PPP P PP PP PPP P+ Sbjct: 277 VYSSP--PPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPY 317 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPP------PPXXXXPPPXPF 502 ++ SP P + PPP P PP PP PPP P+ Sbjct: 301 VYSSP--PPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPY 341 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPP------PPXXXXPPPXPF 502 ++ SP P + PPP P PP PP PPP P+ Sbjct: 325 VYSSP--PPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPY 365 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/36 (36%), Positives = 15/36 (41%), Gaps = 6/36 (16%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPP------PPXXXXPPPXPF 502 P + PPP P PP PP PPP P+ Sbjct: 155 PPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPY 190 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/36 (36%), Positives = 15/36 (41%), Gaps = 6/36 (16%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPP------PPXXXXPPPXPF 502 P + PPP P PP PP PPP P+ Sbjct: 210 PPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPY 245 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 31.9 bits (69), Expect = 0.61 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGS 481 PPPPP +P PP PPP P G G+ Sbjct: 267 PPPPPPGSWQPSPP----PPPPPVSGGMNGN 293 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 31.9 bits (69), Expect = 0.61 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXPF 502 PPPP PPPP PPP + Sbjct: 36 PPPPYEYKSPPPPVKSPPPPYEY 58 Score = 31.9 bits (69), Expect = 0.61 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 6/37 (16%) Frame = -2 Query: 603 SPXXPXFXXXPPPP------PXXXVKPPPPXXXXPPP 511 SP P + PPPP P PPPP PPP Sbjct: 67 SPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPP 103 Score = 31.9 bits (69), Expect = 0.61 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 6/37 (16%) Frame = -2 Query: 603 SPXXPXFXXXPPPP------PXXXVKPPPPXXXXPPP 511 SP P + PPPP P PPPP PPP Sbjct: 163 SPPPPYYYHSPPPPVKSPPPPYLYSSPPPPVKSPPPP 199 Score = 31.5 bits (68), Expect = 0.81 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPP 511 PPPP PPPP PPP Sbjct: 52 PPPPYEYKSPPPPVKSPPPP 71 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 ++ SP P PPPP PPPP PPP Sbjct: 89 VYSSPPPPV---KSPPPPYYYHSPPPPVKSPPPP 119 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 6/37 (16%) Frame = -2 Query: 603 SPXXPXFXXXPPPP------PXXXVKPPPPXXXXPPP 511 SP P + PPPP P PPPP PPP Sbjct: 99 SPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 135 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 6/37 (16%) Frame = -2 Query: 603 SPXXPXFXXXPPPP------PXXXVKPPPPXXXXPPP 511 SP P + PPPP P PPPP PPP Sbjct: 115 SPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 151 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 6/37 (16%) Frame = -2 Query: 603 SPXXPXFXXXPPPP------PXXXVKPPPPXXXXPPP 511 SP P + PPPP P PPPP PPP Sbjct: 131 SPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 167 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 + S P + PPPP PPPP PP P Sbjct: 32 YYSSPPPPYEYKSPPPPVK--SPPPPYEYKSPPPP 64 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP 456 PPP +PPPP PPPP PP K P Sbjct: 84 PPPPYVYSSPPPPVK--SPPPPYYYHSPPPPVKSPPPP 119 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP 456 PPP +PPPP PPPP PP K P Sbjct: 116 PPPPYYYHSPPPPVK--SPPPPYYYHSPPPPVKSPPPP 151 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP 456 PPP +PPPP PPPP PP K P Sbjct: 148 PPPPYYYHSPPPPVK--SPPPPYYYHSPPPPVKSPPPP 183 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P + PPPP PPPP PP P Sbjct: 54 PPYEYKSPPPPVK--SPPPPYYYHSPPPP 80 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P + PPPP PPPP PP P Sbjct: 86 PPYVYSSPPPPVK--SPPPPYYYHSPPPP 112 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P + PPPP PPPP PP P Sbjct: 150 PPYYYHSPPPPVK--SPPPPYYYHSPPPP 176 Score = 28.3 bits (60), Expect = 7.5 Identities = 20/54 (37%), Positives = 24/54 (44%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP PPPP L PP K P P++ + PPP Sbjct: 164 PPPPYYYHSPPPPVK-SPPPPYL--YSSPPPPVKSPPP---PVYIYA--SPPPP 209 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 31.9 bits (69), Expect = 0.61 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 6/38 (15%) Frame = -2 Query: 573 PPPPPXXXVKPPPP------XXXXPPPXPFDGXXXGSP 478 PPPPP V PPPP PPP P G P Sbjct: 526 PPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPP 563 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 7/39 (17%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXX-------PPPXPFDGXXXGSP 478 PPPPP PPPP PPP P G P Sbjct: 552 PPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGP 590 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 514 PPLPTTIAAPPPPP-----PPPRAAVAPPPPP 540 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 527 PPPPRAAVAPPPPP-----PPPGTAAAPPPPP 553 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPPP PPP PPP P Sbjct: 540 PPPPGTAAAPPPPP-----PPPGTQAAPPPPP 566 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPPP PPP + PP P PL K+ PPP Sbjct: 454 PPPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPL----KHFAPPP 494 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPP PPP P Sbjct: 525 PPPPPPRAAVAPPP----PPPPP 543 Score = 27.9 bits (59), Expect = 9.9 Identities = 19/59 (32%), Positives = 21/59 (35%), Gaps = 5/59 (8%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP-----XKKXXFPXSXPLFFLGKNNXPPP 408 PPP PP PPPPP T PP + P P+ G PPP Sbjct: 538 PPPPPPGTAAAPPP---PPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPP 593 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPPPP + PP PPP P P Sbjct: 550 PPPPPPPGTQAAPP---PPPPPPMQNRAPSPP 578 >At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein similar to SP|Q15459 Splicing factor 3 subunit 1 (Spliceosome associated protein 114) {Homo sapiens}; contains Pfam profiles PF00240: Ubiquitin family, PF01805: Surp module Length = 785 Score = 31.9 bits (69), Expect = 0.61 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -2 Query: 567 PPPXXXVKPPPPXXXXPPPXP 505 PPP + PPPP PPP P Sbjct: 654 PPPMPGMAPPPPPEEAPPPLP 674 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPP 504 G PP PPP PPPPP Sbjct: 642 GQLPPSAMGMMQPPPMPGMAPPPPP 666 >At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein similar to human splicing factor GB:CAA59494 GI:899298 from [Homo sapiens]; contains Pfam profile PF01805: Surp module Length = 735 Score = 31.9 bits (69), Expect = 0.61 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -2 Query: 567 PPPXXXVKPPPPXXXXPPPXP 505 PPP + PPPP PPP P Sbjct: 641 PPPMAEMPPPPPPGEAPPPLP 661 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 31.5 bits (68), Expect = 0.81 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = +2 Query: 458 GKXFFXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXG 592 G + G PS GGG SG GG+ GG GG + G Sbjct: 328 GGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGG 372 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXG 592 G GGG GGGG GGG G G Sbjct: 394 GNGGGSFYGGGGGRGGYGGGGSGRYHPYG 422 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 31.5 bits (68), Expect = 0.81 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPF 502 PPP P PPPP PPP PF Sbjct: 104 PPPQPLNLFSPPPPP---PPPDPF 124 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 31.5 bits (68), Expect = 0.81 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 503 KGXGGGXXXSGGGGFTXXXGGGGG 574 +G GGG GGGG GGGGG Sbjct: 117 RGSGGGGGHGGGGGGGGGRGGGGG 140 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG GGG G G G Sbjct: 120 GGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGG 151 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGG 574 G G G GGGG GGGGG Sbjct: 112 GSGRGRGSGGGGGHGGGGGGGGG 134 >At4g08400.1 68417.m01388 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 513 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 5/41 (12%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVKPPPPXXXXPPPXPF 502 + SP P PPPP P K PPP PP P+ Sbjct: 230 YKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYYRSPPPPY 270 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 5/41 (12%) Frame = -2 Query: 609 FXSPXXPXFXXXPPP-----PPXXXVKPPPPXXXXPPPXPF 502 + SP P + PPP P PPPP PP P+ Sbjct: 255 YKSPPPPYYRSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 295 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 404 YKSPPPPYIYNSPPPPYYSPSPKVNYKTPPPPYVYSSPPPPY 445 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 130 YKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPY 171 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 155 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 196 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 180 YKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPY 221 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 205 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 246 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 279 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 320 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 304 YKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPY 345 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 354 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPY 395 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 379 YKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYIYNSPPPPY 420 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 454 YKSPPPPYVYSSPPPPYYSPSPNVDYKSPPPPYVYSSPPTPY 495 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/42 (35%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + +P P PPPP P K PPPP PP P+ Sbjct: 429 YKTPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPY 470 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP P K + P + N+ PPP Sbjct: 348 PSPKVDYKSPPPPYVYSSPPPPYY-----SPSPKVDYKSPPPPYVY--NSPPPP 394 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/42 (40%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +2 Query: 452 TGGKXFFXXGDPXXXPSKGXGGGXXXSGGG-GFTXXXGGGGG 574 +GG + G+ P G GGG GGG G GGGGG Sbjct: 142 SGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGG 183 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG+ GGGGG G G Sbjct: 106 GYGGGGPGYGGGGY-GPGGGGGGVVIGGGFGG 136 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +2 Query: 455 GGKXFFXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 GG + G G GG SGGGG G GGG G G Sbjct: 136 GGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGG 184 Score = 28.7 bits (61), Expect = 5.7 Identities = 19/56 (33%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = +2 Query: 455 GGKXFFXXGDPXXXPSKGXGGGXXXSGGG---GFTXXXGGGGGXXXKXGXXGXKKS 613 GG + G G GGG GGG G + GGGGG G K S Sbjct: 154 GGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHGGVSTKGS 209 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG GGG G G G Sbjct: 113 GYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGG 144 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/56 (39%), Positives = 23/56 (41%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPPXN 402 PPP +PPPP PPPP PP KK P S L PPP N Sbjct: 49 PPPPP---SPPPPSCTPSPPPP-----SPPPPKKSSCPPSP----LPPPPPPPPPN 92 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P PPPPP PPPP PP P Sbjct: 43 PCLQNQPPPPP----SPPPPSCTPSPPPP 67 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP PP P PPPPP PP Sbjct: 69 PPPPKKSSCPPSPLPPPPPPPPPNYVFTYPP 99 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = -2 Query: 603 SPXXPXFXXXPPPP--PXXXVKPPPPXXXXPPPXP 505 SP P PPPP P PP PPP P Sbjct: 54 SPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPP 88 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPP 511 PP PP P PP PPP Sbjct: 52 PPSPPPPSCTPSPPPPSPPPP 72 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 SP P F PPP P PP PPP Sbjct: 161 SPDFPPFSPSIPPPSPPYFPPEPPSIPPPPP 191 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG+ G GGG G G Sbjct: 124 GFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGG 155 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPP 477 PPPP PPPPP + PP Sbjct: 25 PPPPSHISPPPPPFSPPHHPPP 46 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/56 (33%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXP--PPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP +PPPP P PPPP PP P P + PPP Sbjct: 26 PPPSHI--SPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPP 79 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXP--PPXP 505 P PPP + PPPP P PP P Sbjct: 23 PVPPPPSHISPPPPPFSPPHHPPPP 47 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXV--KPPPPXXXXPPPXP 505 P P PPPP +PPPP PPP P Sbjct: 56 PPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPP 89 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPP---XXXXPPPXPF 502 P P PPPP PPPP PPP P+ Sbjct: 25 PPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPY 60 >At5g35190.1 68418.m04170 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 328 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/40 (37%), Positives = 17/40 (42%), Gaps = 6/40 (15%) Frame = -2 Query: 612 LFXSPXXPXFXXXP------PPPPXXXVKPPPPXXXXPPP 511 ++ SP P F P PPPP PPPP P P Sbjct: 228 VYNSPPPPYFSPSPKVDYKSPPPPYVYSSPPPPPYYSPSP 267 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP---PXXXVK---PPPPXXXXPPPXPF 502 + SP P PPPP P V+ PPPP PP P+ Sbjct: 120 YKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPY 161 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 95 YKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPY 136 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 7/43 (16%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVKPPPPXX--XXPPPXPF 502 + SP P PPPP P K PPP PPP P+ Sbjct: 220 YKSPPPPYVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPPPPPY 262 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 + SP P PPPPP P PPP Sbjct: 245 YKSPPPPYVYSSPPPPPYYSPSPEVSYKSPPPP 277 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP P K + P + N+ PPP Sbjct: 89 PSPKEDYKSPPPPYVYNSPPPPYY-----SPSPKVDYKSPPPPYVY--NSPPPP 135 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 485 PXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 P P +G GG G GGF GGG G G G Sbjct: 77 PDGAPVQGNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGG 115 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/52 (34%), Positives = 21/52 (40%), Gaps = 3/52 (5%) Frame = +2 Query: 455 GGKXFFXXGDPXXXPSK-GXGGGXXXSGGGGFTXXXG--GGGGXXXKXGXXG 601 GG + G+P GGG GGGG+ G GGGG G G Sbjct: 127 GGSDCYKCGEPGHMARDCSEGGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGG 178 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG GGG G + G G Sbjct: 150 GYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGG 181 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 512 GGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 GGG GGGG+ GG GG G G Sbjct: 153 GGGGGYGGGGGYGGGGGGYGGGGRGGGGGG 182 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG GGGGG G G Sbjct: 163 GYGGGGGGYGGGG--RGGGGGGGSCYSCGESG 192 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 500 SKGXGGGXXXSGGGGFTXXXGGGGG 574 S G GGG GGGG+ GGGG Sbjct: 128 SYGGGGGGYGGGGGGYGGGGDGGGG 152 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 484 PPXXXVKGGGGGXXXXGGGGFYXXXXGG 567 P GGGGG GGGG Y GG Sbjct: 115 PSAPRAYGGGGGYSYGGGGGGYGGGGGG 142 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 31.1 bits (67), Expect = 1.1 Identities = 33/155 (21%), Positives = 44/155 (28%), Gaps = 12/155 (7%) Frame = -2 Query: 612 LFXSPXXPXFXXXP------PPPPXXXVKPPPPXXXXPPPXPFDGXXXGSPXXXXXXXXX 451 ++ SP P + P PPPP PPPP P P D P Sbjct: 259 VYSSPPPPPYSPSPKVEFKSPPPPYIYNSPPPPSYYSPSP-KIDYKSPPPPYVYSSPPPP 317 Query: 450 XXXXXXXXKQXXXXXXPXKXXSXXXXXXXXPPPFPXXXXXFXXXFFXXNPFFXPXFFXXX 271 P S PP P + P P + Sbjct: 318 TYYSPSPRVDYKSPPPPYVYNSLPPPYVYNSPPPPPYYSPSPTVNYKSPP---PPYVYNS 374 Query: 270 PPXXPFFXLXP------PFXPFLXXXPPPRXFFXP 184 PP P++ P P P++ PPP ++ P Sbjct: 375 PPPPPYYSPFPKVEYKSPPPPYIYNSPPPPPYYSP 409 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/45 (35%), Positives = 19/45 (42%), Gaps = 8/45 (17%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKP-------PPPXX-XXPPPXPF 502 ++ SP P PPPPP P PPP PPP P+ Sbjct: 146 IYNSPPPPYIYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPY 190 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPF 502 + SP P PPPPP P P PP P+ Sbjct: 389 YKSPPPPYIYNSPPPPP--YYSPSPKITYKSPPPPY 422 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 + SP P PPPPP P PPP Sbjct: 173 YKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPP 205 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPF 502 + SP P PPPPP P P PP P+ Sbjct: 199 YKSPPPPYVYSFPPPPP--YYSPSPKVGYKSPPAPY 232 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 7/42 (16%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPP-------XXXVKPPPPXXXXPPPXP 505 + SP P PPPPP PPPP PP P Sbjct: 225 YKSPPAPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPP 266 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 + SP P PPPP PPPP P P Sbjct: 138 YYSPS-PKVIYNSPPPPYIYSSPPPPPYYSPSP 169 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 + SP P PPPP PPPP P P Sbjct: 164 YYSPS-PKVDYKSPPPPYVYSSPPPPPYYSPSP 195 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 + SP P PPPP PPPP P P Sbjct: 380 YYSPF-PKVEYKSPPPPYIYNSPPPPPYYSPSP 411 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/57 (29%), Positives = 21/57 (36%), Gaps = 4/57 (7%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFP----XSXPLFFLGKNNXPPP 408 PP +P P PPPP PP FP S P ++ + PPP Sbjct: 349 PPPPPYYSPSPTVNYKSPPPPYVYNSPPPPPYYSPFPKVEYKSPPPPYIYNSPPPPP 405 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP P K + P + N+ PPP Sbjct: 357 PSPTVNYKSPPPPYVYNSPPPPPYY----SPFPKVEYKSPPPPYIY--NSPPPP 404 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 + SP P PPPP PPPP P P Sbjct: 190 YYSPS-PKVEYKSPPPPYVYSFPPPPPYYSPSP 221 >At3g29390.1 68416.m03693 hydroxyproline-rich glycoprotein family protein sequencing discrepancy between cDNA and genomic sequence prevents representation of entire coding sequence Length = 578 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/57 (35%), Positives = 22/57 (38%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 G P +PP P PPPPP T PP K P S K+ PPP Sbjct: 460 GDVTPSANRVRSPPSPRSVMPPPPPKTI---APPPSKTMSPPS------SKSMLPPP 507 Score = 29.1 bits (62), Expect = 4.3 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPP 511 PP P + PPPP PPP Sbjct: 472 PPSPRSVMPPPPPKTIAPPP 491 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +2 Query: 455 GGKXFFXXGDPXXXPSK-GXGGGXXXSGGGGFTXXXGGGGG 574 G F G+P + GGG GGGG GGGGG Sbjct: 134 GDNSCFKCGEPGHMARECSQGGGGYSGGGGGGRYGSGGGGG 174 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +2 Query: 485 PXXXPSKGXGGGXXXSGG-GGFTXXXGGGGG 574 P P +G GG SGG GGF G GGG Sbjct: 81 PDGAPVQGNSGGGGSSGGRGGFGGGGGRGGG 111 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 508 GGGGXXXXGGGGFYXXXXGGG 570 GGGG GGGG Y GGG Sbjct: 154 GGGGYSGGGGGGRYGSGGGGG 174 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P PPP P PPP PPP P Sbjct: 86 PCLQNIPPPSPPPPSPPPPSQACPPPPLP 114 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/45 (33%), Positives = 18/45 (40%) Frame = -1 Query: 568 PPPXXXXKTPPPRXXXPPPXPL*RXXXGVPPXKKXFSPXPXXFFF 434 PPP +PPP PP PL PP K P P + + Sbjct: 92 PPPSPPPPSPPPPSQACPPPPL----PPSPPKKSYCPPPPSTYIY 132 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPP 514 P P PPP PPPP PP Sbjct: 93 PPSPPPPSPPPPSQACPPPPLPPSPP 118 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPP V PPP PPP P Sbjct: 98 PSPPPPLPTEAPPPANPVSSPPPESSPPPPPP 129 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -2 Query: 567 PPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PPP PPP PPP P + +P Sbjct: 85 PPPTTIPVSPPPEPSPPPPLPTEAPPPANP 114 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = -2 Query: 573 PPPP--PXXXVKPPPPXXXXPPPXP 505 PPPP P +PPPP P P P Sbjct: 219 PPPPGHPKRREQPPPPGSKRPTPSP 243 Score = 27.9 bits (59), Expect = 9.9 Identities = 16/54 (29%), Positives = 19/54 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPP PPP + PP P + P+ PPP Sbjct: 100 PPPPLPTEAPPPANPVSSPPPESSP----PPPPPTEAPPTTPITSPSPPTNPPP 149 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 SP P PP P P PP PPP Sbjct: 140 SPSPPTNPPPPPESPPSLPAPDPPSNPLPPP 170 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKK 468 PPP PPP PPPPPL PP K Sbjct: 46 PPPPLMRRRAPPP----PPPPPLPRPCSRPPKTK 75 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP + PPP P P P Sbjct: 45 PPPPPLMRRRAPPPPPPPPLPRP 67 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP ++ P PPP P Sbjct: 43 PPPPPPPLMRRRAPPPPPPPPLP 65 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPP 477 PPP P PP PPPPPL PP Sbjct: 19 PPPLMRRRAPLPP----PPPPPLMRRRAPPP 45 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXG 484 P P P PPP PPPP PPP FD G Sbjct: 27 PPPPMRRSAPSPPPMSGRVPPPP----PPPPMFDPKGAG 61 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 1/24 (4%) Frame = -2 Query: 573 PPPPPXXXVKP-PPPXXXXPPPXP 505 PPPPP P PPP PP P Sbjct: 26 PPPPPMRRSAPSPPPMSGRVPPPP 49 >At5g06640.1 68418.m00750 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 689 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP---PXXXVK---PPPPXXXXPPPXPF 502 + SP P PPPP P V+ PPPP PP P+ Sbjct: 150 YKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPY 191 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP---PXXXVK---PPPPXXXXPPPXPF 502 + SP P PPPP P V+ PPPP PP P+ Sbjct: 250 YKSPPPPYVYSSPPPPYFSPSPKVEYKSPPPPYVYNSPPPPY 291 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP---PXXXVK---PPPPXXXXPPPXPF 502 + SP P PPPP P V+ PPPP PP P+ Sbjct: 275 YKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPY 316 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP---PXXXVK---PPPPXXXXPPPXPF 502 + SP P PPPP P V+ PPPP PP P+ Sbjct: 450 YKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPY 491 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP---PXXXVK---PPPPXXXXPPPXPF 502 + SP P PPPP P V+ PPPP PP P+ Sbjct: 475 YKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPY 516 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 100 YKSPPPPNVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 141 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 200 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPY 241 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 300 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 341 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 325 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 366 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 400 YKSPPPPYVYSSPPPPYYSPSPKVAYKSPPPPYVYSSPPPPY 441 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 425 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 466 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 550 YKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPY 591 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP P K + P + N+ PPP Sbjct: 144 PSPKVDYKSPPPPYVYSSPPPPYY-----SPSPKVEYKSPPPPYVY--NSPPPP 190 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP P K + P + N+ PPP Sbjct: 194 PSPKIEYKSPPPPYVYSSPPPPYY-----SPSPKVDYKSPPPPYVY--NSPPPP 240 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP P K + P + N+ PPP Sbjct: 244 PSPKVDYKSPPPPYVYSSPPPPYF-----SPSPKVEYKSPPPPYVY--NSPPPP 290 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 300 YKSPPPPYVYSSPPPPYYSPSPKVYYK 326 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPP------PPXXXVKPPPPXXXXPPPXPF 502 + SP P PPP P PPPP PP P+ Sbjct: 375 YKSPPPPYVYSSPPPQYYSPSPKVAYKSPPPPYVYSSPPPPY 416 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPP------PPXXXVKPPPPXXXXPPPXPF 502 + SP P PPP P PPPP PP P+ Sbjct: 625 YKSPPLPYVYSSPPPLYYSPSPKVHYKSPPPPYVYNSPPPPY 666 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPF 502 ++ SP P + P P PPPP PP P+ Sbjct: 82 VYISPPPPSYYS--PSPKVNYKSPPPPNVYNSPPPPY 116 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/39 (35%), Positives = 16/39 (41%), Gaps = 6/39 (15%) Frame = -2 Query: 612 LFXSPXXPXFXXXP------PPPPXXXVKPPPPXXXXPP 514 ++ SP P F P PPPP PPPP P Sbjct: 258 VYSSPPPPYFSPSPKVEYKSPPPPYVYNSPPPPYYSPSP 296 >At4g08410.1 68417.m01390 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 707 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP---PXXXVK---PPPPXXXXPPPXPF 502 + SP P PPPP P V+ PPPP PP P+ Sbjct: 548 YKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYIYSSPPPPY 589 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 573 YKSPPPPYIYSSPPPPYYAPSPKVDYKSPPPPYVYSSPPPPY 614 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 148 YKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPY 189 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 173 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 214 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 198 YKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPY 239 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 248 YKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPY 289 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 298 YKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPY 339 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 323 YKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 364 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVKPPPPXX-XXPPPXPF 502 + SP P PPPP P KPPPP PP P+ Sbjct: 448 YKSPPPPYVYSSPPPPYYSPSPKVDYKPPPPPYVYSSPPPPY 489 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 498 YKSPPPPYVYSFPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 539 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 523 YKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPY 564 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 598 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 639 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 623 YKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPY 664 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPP 514 + SP P PPPPP PPPP P Sbjct: 464 YYSPS-PKVDYKPPPPPYVYSSPPPPYYSPSP 494 Score = 29.5 bits (63), Expect = 3.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPP 180 + PP PP+ SPPP ++ P Sbjct: 473 YKPPPPPYVYSSPPPPYYSPSP 494 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP P K + P + G + PPP Sbjct: 242 PSPKVDYKSPPPPYVYSSPPPPYY-----SPSPKVNYKSPPPPYVYG--SPPPP 288 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP P K + P + G + PPP Sbjct: 292 PSPKVDYKSPPPPYVYSSPPPPYY-----SPSPKVNYKSPPPPYVYG--SPPPP 338 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP P K P P + ++ PPP Sbjct: 442 PSPKVDYKSPPPPYVYSSPPPPYY----SPSPKVDYKPPPPPYVY---SSPPPP 488 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 500 SKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 S G GGG GGGG GGG G G G Sbjct: 477 SVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGG 510 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG + GGG + GGGG + G G Sbjct: 84 GVGGGAGGAIGGGASGGAGGGGKGRGRKGGGG 115 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG SGG G GGG G G G Sbjct: 68 GGGGGIGGSGGVGAGGGVGGGAGGAIGGGASG 99 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 503 KGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 KG GG GGG G GGG G G Sbjct: 161 KGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGG 193 >At3g54590.1 68416.m06040 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 743 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP---PXXXVK---PPPPXXXXPPPXPF 502 + SP P PPPP P V+ PPPP PP P+ Sbjct: 143 YKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPY 184 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP---PXXXVK---PPPPXXXXPPPXPF 502 + SP P PPPP P V+ PPPP PP P+ Sbjct: 193 YKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPY 234 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 7/43 (16%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPP-------XXXVKPPPPXXXXPPPXPF 502 + SP P PPPPP PPPP PP P+ Sbjct: 659 YKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPY 701 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 93 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPY 134 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 118 YKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 159 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 168 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 209 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 218 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 259 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 243 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 284 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 268 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 309 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 293 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 334 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 343 YKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPY 384 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 393 YKSPPPPYVYSSPPPPTYSPSPKVYYKSPPPPYVYSSPPPPY 434 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 418 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 459 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 443 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 484 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 468 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 509 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 493 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 534 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 543 YKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYNSPPPPY 584 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 568 YKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 609 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 593 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 634 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP P K + P + N+ PPP Sbjct: 87 PSPKVDYKSPPPPYVYSSPPPPYY-----SPSPKVDYKSPPPPYVY--NSPPPP 133 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 418 YKSPPPPYVYSSPPPPYYSPSPKVYYK 444 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 443 YKSPPPPYVYSSPPPPYYSPSPKVYYK 469 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 468 YKSPPPPYVYSSPPPPYYSPSPKVYYK 494 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 493 YKSPPPPYVYSSPPPPYYSPSPKVYYK 519 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP P K + P + N+ PPP Sbjct: 537 PSPKVHYKSPPPPYVYSSPPPPYY-----SPSPKVHYKSPPPPYVY--NSPPPP 583 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 568 YKSPPPPYVYNSPPPPYYSPSPKVYYK 594 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 593 YKSPPPPYVYSSPPPPYYSPSPKVYYK 619 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 618 YKSPPPPYVYSSPPPPYYSPSPKVYYK 644 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 685 YKSPPPPYVYNSPPPPYYSPSPKVYYK 711 >At3g54580.1 68416.m06039 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 951 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP---PXXXVK---PPPPXXXXPPPXPF 502 + SP P PPPP P V+ PPPP PP P+ Sbjct: 168 YKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPY 209 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP---PXXXVK---PPPPXXXXPPPXPF 502 + SP P PPPP P V+ PPPP PP P+ Sbjct: 393 YKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPY 434 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP---PXXXVK---PPPPXXXXPPPXPF 502 + SP P PPPP P V+ PPPP PP P+ Sbjct: 584 YKSPPPPYVYSSPPPPYHSPSPKVQYKSPPPPYVYSSPPPPY 625 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP---PXXXVK---PPPPXXXXPPPXPF 502 + SP P PPPP P V+ PPPP PP P+ Sbjct: 801 YKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPY 842 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 218 YKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPY 259 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 268 YKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPY 309 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 443 YKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPY 484 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 468 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 509 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 559 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 600 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 609 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 650 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 634 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 675 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 776 YKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPY 817 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 826 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 867 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 851 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 892 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 876 YKSPPPPYVYSSPPPPYYSPSPVVDYKSPPPPYVYSSPPPPY 917 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 7/42 (16%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPP-------XXXVKPPPPXXXXPPPXP 505 + SP P PPPPP PPPP PP P Sbjct: 684 YKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYSSPPPP 725 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/42 (35%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP + PPPP P K PPPP PP P+ Sbjct: 534 YYSPSPKVYYKSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 575 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/54 (29%), Positives = 19/54 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP K P P + + PPP Sbjct: 729 PSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYYAPTPKVHYKSPPPP 782 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 468 YKSPPPPYVYSSPPPPYYSPSPKVYYK 494 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 493 YKSPPPPYVYSSPPPPYYSPSPKVYYK 519 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 518 YKSPPPPYVYSSPPPPYYSPSPKVYYK 544 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 559 YKSPPPPYVYSSPPPPYYSPSPKVYYK 585 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 609 YKSPPPPYVYSSPPPPYYSPSPKVYYK 635 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 634 YKSPPPPYVYSSPPPPYYSPSPKVYYK 660 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 659 YKSPPPPYVYSSPPPPYYSPSPKVYYK 685 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGS 481 PP PP KPPPP PPP F GS Sbjct: 218 PPKPPSPPRKPPPP----PPPPAFMSSSGGS 244 >At3g08640.1 68416.m01003 alphavirus core protein family contains Pfam profile: PF00944 alphavirus core protein Length = 337 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +2 Query: 497 PSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXGXKKS 613 P G GGG GG + GGGGG G + S Sbjct: 58 PCAGGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESS 96 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +2 Query: 512 GGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 GGG GGGG++ GGGGG + G G Sbjct: 103 GGGGRREGGGGYS---GGGGGYSSRGGGGG 129 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +2 Query: 512 GGGXXXSGGGGFTXXXGGGG--GXXXKXGXXG 601 GGG GGGG++ GGGG G + G G Sbjct: 110 GGGGYSGGGGGYSSRGGGGGSYGGGRREGGGG 141 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 Query: 500 SKGXGGGXXXSGGGGFTXXXGGGGG 574 S+G GGG GGG + GGGGG Sbjct: 86 SRGSGGGGGHRGGGSY----GGGGG 106 >At1g76930.2 68414.m08956 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 256 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 ++ SP P + PPPP PPP PPP Sbjct: 90 VYKSPPPPVYKS--PPPPVKHYSPPPVYKSPPPP 121 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 F S + PPPP PPP PPP Sbjct: 17 FVSQTTANYFYSSPPPPVKHYSPPPVYKSPPPP 49 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 5/32 (15%) Frame = -2 Query: 591 PXFXXXPPP-----PPXXXVKPPPPXXXXPPP 511 P + PPP PP PPPP PPP Sbjct: 73 PVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPP 104 Score = 28.7 bits (61), Expect = 5.7 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXPF 502 PPPP PPP PPP + Sbjct: 62 PPPPVKHYSPPPVYKSPPPPVKY 84 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPP 511 PPPP PPP PPP Sbjct: 46 PPPPVKHYSPPPVYKSPPPP 65 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPP 511 PPPP PPP PPP Sbjct: 118 PPPPVKHYSPPPVYKSPPPP 137 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPP 511 PPPP PPP PPP Sbjct: 134 PPPPVKHYSPPPVYKSPPPP 153 >At1g76930.1 68414.m08955 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 293 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 ++ SP P + PPPP PPP PPP Sbjct: 90 VYKSPPPPVYKS--PPPPVKHYSPPPVYKSPPPP 121 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 F S + PPPP PPP PPP Sbjct: 17 FVSQTTANYFYSSPPPPVKHYSPPPVYKSPPPP 49 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 5/32 (15%) Frame = -2 Query: 591 PXFXXXPPP-----PPXXXVKPPPPXXXXPPP 511 P + PPP PP PPPP PPP Sbjct: 73 PVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPP 104 Score = 28.7 bits (61), Expect = 5.7 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXPF 502 PPPP PPP PPP + Sbjct: 62 PPPPVKHYSPPPVYKSPPPPVKY 84 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPP 511 PPPP PPP PPP Sbjct: 46 PPPPVKHYSPPPVYKSPPPP 65 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPP 511 PPPP PPP PPP Sbjct: 118 PPPPVKHYSPPPVYKSPPPP 137 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPP 511 PPPP PPP PPP Sbjct: 134 PPPPVKHYSPPPVYKSPPPP 153 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P PPPP PPPP PP P Sbjct: 53 PSCIQNPPPPSPPPPSPPPPACPPPPALP 81 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPP 511 PPP P PPPP PPP Sbjct: 65 PPPSPPPPACPPPPALPPPPP 85 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/47 (40%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXF-PXSXPLFFL 432 PPP +PPPP PPPP L PP K + P P FL Sbjct: 60 PPPSPPPPSPPPP--ACPPPPALPPP---PPKKVSSYCPPPPPANFL 101 >At5g49080.1 68418.m06074 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 609 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 70 YKSPPPPYVYSSPPPPYYTPSPKVDYKSPPPPYEYSSPPPPY 111 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 145 YKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPY 186 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 170 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 211 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 195 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 236 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 220 YKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPY 261 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 270 YKSPPLPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 311 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 295 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 336 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 320 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 361 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 345 YKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPY 386 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 370 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 411 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 420 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPY 461 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 445 YKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 486 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 470 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 511 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 520 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPY 561 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 545 YKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 586 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 95 YKSPPPPYEYSSPPPPYYSPSPKIDYKSPPPPYVYSSPPLPY 136 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP P K + P + N+ PPP Sbjct: 414 PSPKVDYKSPPPPYVYSSPPPPYY-----SPSPKVDYKSPPPPYVY--NSPPPP 460 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP P K + P + N+ PPP Sbjct: 514 PSPKVDYKSPPPPYVYSSPPPPYY-----SPSPKVDYKSPPPPYVY--NSPPPP 560 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPF 502 ++ SP P + P P PPPP PP P+ Sbjct: 53 IYNSPPPPYYS---PSPKVNYKSPPPPYVYSSPPPPY 86 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG G GG+ GGG G G G Sbjct: 196 GAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGG 227 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 508 GGGGXXXXGGGGFYXXXXGGG 570 GGGG GGGG Y GGG Sbjct: 252 GGGGGGGEGGGGSYGGEHGGG 272 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGG 574 G GGG GGG GGGGG Sbjct: 234 GSGGGEGGGYGGGAAGGYGGGGG 256 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGG 574 G GGG GGG + GGG G Sbjct: 252 GGGGGGGEGGGGSYGGEHGGGSG 274 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG SG GG GGG G G G Sbjct: 150 GEGGGAGASGYGGGAYGGGGGHGGGGGGGSAG 181 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = -2 Query: 573 PPPPPXXX---VKPPPPXXXXPPPXP 505 PPPPP PPPP PPP P Sbjct: 54 PPPPPVYSRPVAFPPPPPIYSPPPPP 79 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = -2 Query: 600 PXXPXFXXXPPPP--PXXXVKPPPPXXXXPP 514 P P PPPP P PPPP PP Sbjct: 67 PPPPPIYSPPPPPIYPPPIYSPPPPPIYPPP 97 Score = 28.7 bits (61), Expect = 5.7 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 542 PPPPXXXXPPPPPL 501 PPPP PPPPP+ Sbjct: 67 PPPPPIYSPPPPPI 80 Score = 28.7 bits (61), Expect = 5.7 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPP 511 P P + PPP + PPP PPP Sbjct: 68 PPPPIYSPPPPPIYPPPIYSPPPPPIYPPP 97 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXX--VKPPPPXXXXPPP 511 P P PPPPP + PPP PPP Sbjct: 79 PIYPPPIYSPPPPPIYPPPIYSPPPTPISPPP 110 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/48 (31%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = -3 Query: 542 PPP---PXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP P PPPP + PP P P++ + PPP Sbjct: 44 PPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPP 91 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P PPPPP + PPPP P P Sbjct: 85 PASPQPPPPPPIENLPPPPPPLPKFSPSP 113 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKK 468 PPPP PPPPP P K+ Sbjct: 92 PPPPIENLPPPPPPLPKFSPSPIKR 116 >At5g06630.1 68418.m00749 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 440 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 76 YKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 117 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 151 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 192 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 176 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 217 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 201 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 242 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 226 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 267 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 251 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 292 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 276 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 317 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 301 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 342 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 326 YKSPPPPYVYSSPPPPYYSPSPNVYYKSPPPPYVYSSPPPPY 367 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 351 YKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPY 392 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 376 YKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPY 417 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 76 YKSPPPPYVYNSPPPPYYSPSPKVYYK 102 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 101 YKSPPPPYVYSSPPPPYYSPSPKVYYK 127 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPP------PPXXXVKPPPPXXXXPPPXPF 502 + SP P PPP P PPPP PP P+ Sbjct: 126 YKSPPPPYVYSSPPPLYYSPSPKVYYKSPPPPYVYSSPPPPY 167 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 126 YKSPPPPYVYSSPPPLYYSPSPKVYYK 152 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 151 YKSPPPPYVYSSPPPPYYSPSPKVYYK 177 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 176 YKSPPPPYVYSSPPPPYYSPSPKVYYK 202 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 201 YKSPPPPYVYSSPPPPYYSPSPKVYYK 227 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 226 YKSPPPPYVYSSPPPPYYSPSPKVYYK 252 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 251 YKSPPPPYVYSSPPPPYYSPSPKVYYK 277 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 276 YKSPPPPYVYSSPPPPYYSPSPKVYYK 302 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 301 YKSPPPPYVYSSPPPPYYSPSPKVYYK 327 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 326 YKSPPPPYVYSSPPPPYYSPSPNVYYK 352 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 612 LFXSPXXPXFXXXPPPPPXXXVKPPPPXXXXPP 514 L+ SP P PPPP PPPP P Sbjct: 141 LYYSPS-PKVYYKSPPPPYVYSSPPPPYYSPSP 172 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -1 Query: 568 PPPXXXXKTPPPRXXXPPPXPL*RXXXGVPPXKKXFSP 455 PPP K PPP+ PPP P+ + P KK P Sbjct: 271 PPPVPVYK-PPPKIEHPPPVPVHKLPKKPCPPKKVDPP 307 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPP P P PP PPP P Sbjct: 238 PPPIPKKPCPPKPPKIEHPPPVP 260 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P + PP V PPP PPP P Sbjct: 181 PCPPKYSPPVEVPPPVPVYEPPPKKEIPPPVP 212 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPP P V PPP PPP P Sbjct: 247 PPKPPKIEHPPPVP---VYKPPPKIEKPPPVP 275 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/44 (34%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = -1 Query: 568 PPPXXXXKTP----PPRXXXPPPXPL*RXXXGVPPXKKXFSPXP 449 PPP K P PP+ PPP P+ + P K P P Sbjct: 286 PPPVPVHKLPKKPCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPP 329 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = -1 Query: 565 PPXXXXKTPPPRXXXPPPXPL*RXXXGVPPXKKXFSPXP 449 PP PPP+ PPP P+ PP K+ P P Sbjct: 193 PPPVPVYEPPPKKEIPPPVPV----YDPPPKKEVPPPVP 227 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 4/27 (14%) Frame = -2 Query: 573 PPP----PPXXXVKPPPPXXXXPPPXP 505 PPP PP V PPP PPP P Sbjct: 201 PPPKKEIPPPVPVYDPPPKKEVPPPVP 227 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 4/27 (14%) Frame = -2 Query: 573 PPP----PPXXXVKPPPPXXXXPPPXP 505 PPP PP V PPP PPP P Sbjct: 216 PPPKKEVPPPVPVYKPPPKVELPPPIP 242 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -1 Query: 568 PPPXXXXKTPPPRXXXPPPXPL 503 PPP K PPP+ PPP P+ Sbjct: 256 PPPVPVYK-PPPKIEKPPPVPV 276 >At4g32640.1 68417.m04646 sec23/sec24 transport protein-related Length = 1069 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PP P +PPPP P P P G+P Sbjct: 47 PPMMPGSGPRPPPPFGQSPQPFPQQSPSYGAP 78 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGG 574 G GGG GGGG+ GGGG Sbjct: 135 GGGGGGYGGGGGGYGGGGDGGGG 157 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +2 Query: 482 DPXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 D P GGG GGGG+ GG GG G G Sbjct: 113 DRPSAPRAYGGGGGYSGGGGGYGGGGGGYGGGGGGYGGGG 152 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 497 PSKGXGGGXXXSGGGGFTXXXGGGG 571 P+K GGG GGGG GGGG Sbjct: 54 PNKKWGGGMGGGGGGGGGSGGGGGG 78 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 545 NPPPPXXXXPPPPPLT 498 +PPPP PPPPPL+ Sbjct: 72 SPPPPPPPRPPPPPLS 87 Score = 27.9 bits (59), Expect = 9.9 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -3 Query: 542 PPPPXXXXPPPPP 504 PPPP PPPPP Sbjct: 105 PPPPPPPPPPPPP 117 >At2g24980.1 68415.m02987 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 559 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 70 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 111 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 120 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPY 161 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 145 YKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 186 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 170 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 211 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 195 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 236 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 220 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 261 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 245 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 286 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 270 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 311 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 295 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 336 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 320 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 361 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 370 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYNSPPPPY 411 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 395 YKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 436 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -2 Query: 609 FXSPXXPXFXXXPPPP-----PXXXVK-PPPPXXXXPPPXPF 502 + SP P PPPP P K PPPP PP P+ Sbjct: 420 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 461 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP P K + P + N+ PPP Sbjct: 114 PSPKVDYKSPPPPYVYSSPPPPYY-----SPSPKVDYKSPPPPYVY--NSPPPP 160 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 170 YKSPPPPYVYSSPPPPYYSPSPKVYYK 196 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 195 YKSPPPPYVYSSPPPPYYSPSPKVYYK 221 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 220 YKSPPPPYVYSSPPPPYYSPSPKVYYK 246 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 245 YKSPPPPYVYSSPPPPYYSPSPKVYYK 271 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 270 YKSPPPPYVYSSPPPPYYSPSPKVYYK 296 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 295 YKSPPPPYVYSSPPPPYYSPSPKVYYK 321 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 320 YKSPPPPYVYSSPPPPYYSPSPKVYYK 346 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 345 YKSPPPPYVYSSPPPPYYSPSPKVYYK 371 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 P P +PPPP PPPP P K + P + N+ PPP Sbjct: 364 PSPKVYYKSPPPPYVYSSPPPPYY-----SPSPKVYYKSPPPPYVY--NSPPPP 410 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 370 YKSPPPPYVYSSPPPPYYSPSPKVYYK 396 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 395 YKSPPPPYVYNSPPPPYYSPSPKVYYK 421 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 420 YKSPPPPYVYSSPPPPYYSPSPKVYYK 446 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 245 FXPPSPPFXXXSPPPXFFXXPPXXFXK 165 + P PP+ SPPP ++ P + K Sbjct: 445 YKSPPPPYVYSSPPPPYYSPSPKVYYK 471 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = +2 Query: 479 GDPXXXPSKGXGGGXXXSGGGGF---TXXXGGGGGXXXKXGXXG 601 G P + GGG GGGG+ T GGGGG G G Sbjct: 85 GYPPLYGTTPPGGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGG 128 >At1g22420.1 68414.m02803 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 480 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = -2 Query: 573 PPPPPXXXVKPPP-PXXXXPPPXP 505 PPPP + PPP P PPP P Sbjct: 164 PPPPVPANITPPPVPANITPPPVP 187 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGG 574 G GGG GGG T GGGGG Sbjct: 400 GGGGGGGDGGGGQGTGIGGGGGG 422 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 512 GGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 GGG GGGG GGGGG G G Sbjct: 401 GGGGGGDGGGGQGTGIGGGGGGEQGTGVGG 430 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 30.3 bits (65), Expect = 1.9 Identities = 19/46 (41%), Positives = 21/46 (45%) Frame = +2 Query: 455 GGKXFFXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXG 592 GG+ G SKG GGG SGGG + GGGGG G Sbjct: 51 GGEGGGGEGGGGQKISKGGGGGG--SGGGQRSSSGGGGGGGEGDGG 94 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGG 574 G G G GGGG GGGGG Sbjct: 50 GGGEGGGGEGGGGQKISKGGGGG 72 >At4g21720.1 68417.m03145 expressed protein Length = 139 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPP 477 PPPP PPPPP + PP Sbjct: 109 PPPPKPQPPPPPPRSQKPMQPP 130 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP P P Sbjct: 107 PPPPPPKPQPPPPPPRSQKPMQP 129 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPPP P P Sbjct: 108 PPPPPKPQPPPPPPRSQKPMQPP 130 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXP 505 PP P V PPPP P P P Sbjct: 74 PPAPVPPVSPPPPTPSVPSPTP 95 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXP 505 PPPP V P P PPP P Sbjct: 83 PPPPTPSVPSPTPPVSPPPPTP 104 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPP P V P P PPP P Sbjct: 100 PPPTPTPSVPSPTPPVSPPPPTP 122 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPP P V P P PPP P Sbjct: 118 PPPTPTPSVPSPTPPVSPPPPTP 140 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPP P V P P PPP P Sbjct: 136 PPPTPTPSVPSPTPPVSPPPPTP 158 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P PP P + PPP PPP P Sbjct: 160 PSVPSPTPPVPTDPMPSPPPPVSPPPPTP 188 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 4/38 (10%) Frame = -2 Query: 612 LFXSPXXPXFXXX--PPP--PPXXXVKPPPPXXXXPPP 511 LF P P PPP PP PPPP PPP Sbjct: 79 LFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPPP 116 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 291 PXFFXXXPPXXPFFXLXPPFXPFLXXXPPPRXFFXPP 181 P F PP P F L PP P PPP PP Sbjct: 60 PALFPPEPPLPPRFELPPPLFP-----PPPLPRLPPP 91 Score = 28.7 bits (61), Expect = 5.7 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFDG 496 PPPPP +PPPP P +G Sbjct: 103 PPPPPPPPEEPPPPASCLRTKSPENG 128 >At1g70250.1 68414.m08082 receptor serine/threonine kinase, putative similar to to receptor serine/threonine kinase PR5K gi|1235680|gb|AAC49208 Length = 799 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 G PPP PPP PPPP + PP P P Sbjct: 99 GAPPPPPDLF--PPPSAQMLPPPPASSPAPPSPPSSSRPRPLPRP 141 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 503 KGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 K GG GG G + GGGGG K G G Sbjct: 35 KKKNGGGEGGGGEGTSGEGGGGGGDGTKGGGDG 67 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 512 GGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 GGG + GGG T GGG G G G Sbjct: 14 GGGGDGTKGGGNTITGGGGEGKKKNGGGEG 43 >At1g07135.1 68414.m00759 glycine-rich protein Length = 155 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 7/51 (13%) Frame = +3 Query: 438 KKXXGXGEXXFFXGGTPXXXRQRGXGGG-------XXXRGGGVLXXXXGGG 569 KK G G GG R RG GGG RGGGV+ GGG Sbjct: 63 KKGGGGGGGGRGGGGARSGGRSRGGGGGSSSSRSRDWKRGGGVVPIHTGGG 113 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPP--PLTXXXGGPPXKKXXFPXSXP 444 PPP PPPP PPP P GG P P P Sbjct: 201 PPPGGMMRGPPPPHGMQGPPPSRPGMPPPGGAPMFAPPHPGMPP 244 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDG 496 P P F PPP ++PP P PPP + G Sbjct: 162 PPQPPFAGQGGPPPPYGMRPPYP---GPPPPQYGG 193 >At4g03390.1 68417.m00461 leucine-rich repeat transmembrane protein kinase, putative similar to Z. mays leucine-rich repeat transmembrane protein kinase LRRTPK 1, GenBank accession number AF023164 Length = 776 Score = 29.5 bits (63), Expect = 3.2 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -3 Query: 542 PPPPXXXXPPPPPL 501 PPPP PPPPPL Sbjct: 428 PPPPPPPPPPPPPL 441 Score = 27.9 bits (59), Expect = 9.9 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -3 Query: 542 PPPPXXXXPPPPP 504 PPPP PPPPP Sbjct: 427 PPPPPPPPPPPPP 439 >At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 646 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 Query: 500 SKGXGGGXXXSGGGGFTXXXGGGGG 574 S+G GG GGGG+ GGG G Sbjct: 567 SRGGGGADYYGGGGGYGGVPGGGYG 591 >At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, putative strong similarity to L-galactono-1,4-lactone dehydrogenase, Brassica oleracea, Z97060 [gi:2760543], and gi:3986289 from Ipomea batatas Length = 610 Score = 29.5 bits (63), Expect = 3.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 Query: 542 PPPPXXXXPPPPPLT 498 PPPP PPPPP T Sbjct: 45 PPPPPPRPPPPPPAT 59 Score = 27.9 bits (59), Expect = 9.9 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -3 Query: 542 PPPPXXXXPPPPP 504 PPPP PPPPP Sbjct: 44 PPPPPPPRPPPPP 56 >At3g26120.1 68416.m03257 RNA-binding protein, putative similar to GB:AAC39463 from [Zea mays], PF00076 RNA recognition motif (2 copies) Length = 615 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -2 Query: 603 SPXXPX-FXXXPPPPPXXXVKPPPPXXXXPPPXP-FDG 496 SP P F PP PPPP PPP P F+G Sbjct: 53 SPTEPRVFTFFNIPPHPMMFSPPPPQPPPPPPRPCFNG 90 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PP +PPPP PPPPP G ++ P + P Sbjct: 66 PPHPMMFSPPPPQP--PPPPPRPCFNGVSAAQRLPLPSNTP 104 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = -1 Query: 568 PPPXXXXKTPPPRXXXPPPXPL*RXXXGVPPXKKXFSPXP 449 PPP PP P P +PP FSP P Sbjct: 37 PPPQLPPPLPPSSYGLSPTEPRVFTFFNIPPHPMMFSPPP 76 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 +P P PPP PPPP P P P SP Sbjct: 115 TPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPPAPVSASP 156 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPP 511 PP P PPPP PPP Sbjct: 101 PPAPIVNPNPPPPSTPNPPP 120 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXPFD 499 SP P P PPP PPP PPP D Sbjct: 98 SPNPPAPIVNPNPPPPSTPNPPPE--FSPPPPDLD 130 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -2 Query: 603 SPXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 +P P PP P PPP PPP P Sbjct: 14 APPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAP 46 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXP 444 PP +PPP PPP P PP K P P Sbjct: 25 PPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPP 66 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKP-PPPXXXXPPPXP 505 P P P PPP KP PPP PP P Sbjct: 43 PPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKP 75 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PP P PPP PPP P Sbjct: 62 PVPPPACPPTPPKPQPKPAPPPEPKPAPPPAP 93 Score = 28.7 bits (61), Expect = 5.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PP PP KP PP P P P Sbjct: 101 PPKPPAPTPKPVPPHGPPPKPAP 123 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 P PPP KPPP P P P Sbjct: 32 PSPPPKPQPKPPPAPSPSPCPSP 54 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKK 468 PP P PPPPP PP K+ Sbjct: 297 PPSPPPPPPPPPPQPLIAATPPRKQ 321 >At5g19900.1 68418.m02368 PRLI-interacting factor, putative strong similarity to PRLI-interacting factor A [Arabidopsis thaliana] GI:11139262 Length = 494 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/50 (32%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = -3 Query: 545 NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLF-----FLGKNNXPP 411 NPPPP PPP PP + PL +G N PP Sbjct: 9 NPPPPQQMIGQPPPQQRMNPPPPSQVPRIMNQSPLLGQSHPIMGMNQQPP 58 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXP 505 PPPP + PPP PP P Sbjct: 10 PPPPQQMIGQPPPQQRMNPPPP 31 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPP 511 PPPP +PPP PPP Sbjct: 10 PPPPQQMIGQPPPQQRMNPPP 30 >At5g10550.1 68418.m01221 DNA-binding bromodomain-containing protein low similarity to kinase [Gallus gallus] GI:1370092; contains Pfam profile PF00439: Bromodomain Length = 678 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXP 505 P PP V+PPPP PPP P Sbjct: 421 PSPPPSPVQPPPP--PSPPPQP 440 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG G GGG G G Sbjct: 71 GGGGGGRGYGGGGRREGGGYGGGDGGSYGGGG 102 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVK--PPPPXXXXPPPXP 505 P + PPPP + PPPP PPP P Sbjct: 11 PAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPPPP 44 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP PPP P P P Sbjct: 164 PPPPPPYPSPLPPPPSPSPTPGP 186 >At3g05220.2 68416.m00570 heavy-metal-associated domain-containing protein similar to farnesylated protein 1 (GI:23304411) {Hordeum vulgare subsp. spontaneum}; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 478 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 503 KGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXGXK 607 KG GGG GGGGF G K G G K Sbjct: 168 KGGGGGGKKGGGGGFEIPVQMKGMGEGKNGKDGKK 202 >At3g05220.1 68416.m00569 heavy-metal-associated domain-containing protein similar to farnesylated protein 1 (GI:23304411) {Hordeum vulgare subsp. spontaneum}; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 577 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 503 KGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXGXK 607 KG GGG GGGGF G K G G K Sbjct: 267 KGGGGGGKKGGGGGFEIPVQMKGMGEGKNGKDGKK 301 >At2g30505.1 68415.m03716 Expressed protein Length = 321 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPP 477 PPPP PPPPP G P Sbjct: 6 PPPPPPPPPPPPPRRDSGFGDP 27 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 29.1 bits (62), Expect = 4.3 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPP--PPPLT-XXXGGPPXKKXXFPXSXP 444 PPP NPPPP PP PPP T PP P + P Sbjct: 65 PPPA----NPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATP 105 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PP P PPPP PP P Sbjct: 83 PPATPPPVASPPPPVASPPPATP 105 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PP PPP P Sbjct: 84 PATPPPVASPPPPVASPPPATPPPVATPPPAP 115 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 29.1 bits (62), Expect = 4.3 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPP--PPPLT-XXXGGPPXKKXXFPXSXP 444 PPP NPPPP PP PPP T PP P + P Sbjct: 65 PPPA----NPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATP 105 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PP P PPPP PP P Sbjct: 83 PPATPPPVASPPPPVASPPPATP 105 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PP PPP P Sbjct: 84 PATPPPVASPPPPVASPPPATPPPVATPPPAP 115 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKN---NXPPP 408 PPPP PP P G P +P P F G N PPP Sbjct: 63 PPPPPQWGPPSPHYPQ---GQPYSSPAYPPHQPPFNAGANGNSQFPPP 107 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKN---NXPPP 408 PPPP PP P G P +P P F G N PPP Sbjct: 63 PPPPPQWGPPSPHYPQ---GQPYSSPAYPPHQPPFNAGANGNSQFPPP 107 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPP 511 PPPPP VK P PPP Sbjct: 239 PPPPPSIAVKQSAPTPSPPPP 259 >At1g49270.1 68414.m05524 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 699 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 5/37 (13%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPF-----DGXXXGSP 478 PPPP + PPP PP P DG SP Sbjct: 44 PPPPSSPDIAPPPQQQQESPPPPLPENSSDGSSSSSP 80 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 28.7 bits (61), Expect = 5.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPP 511 PPPP PPPP PP Sbjct: 65 PPPPSPQYSPPPPPSQSSPP 84 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 5/39 (12%) Frame = -3 Query: 578 GXXPPPXXXX*NPPPPXXXXP-----PPPPLTXXXGGPP 477 G PPP PPPP P PP P T PP Sbjct: 63 GNPPPPSPQYSPPPPPSQSSPPRSRCPPVPTTGCCNQPP 101 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPP 514 PPPP PPPP PP Sbjct: 65 PPPPSPQYSPPPPPSQSSPP 84 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = -2 Query: 573 PPPPPXXX--VKPPPPXXXXPPPXP 505 PPPPP + PPPP PPP P Sbjct: 37 PPPPPVYSPPISPPPPP---PPPPP 58 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 28.7 bits (61), Expect = 5.7 Identities = 20/57 (35%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = +2 Query: 434 KKKXXRTGGKXFFXXGDPXXXPSKGXGGGXXX-SGGGGFTXXXGGGGGXXXKXGXXG 601 K+ R GG+ F G G GGG GGGG+ GGGG G G Sbjct: 552 KRSGGRFGGRDFRREGSYSRGGGGGGGGGGSDYYGGGGY----GGGGYGGAPSGGYG 604 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 28.7 bits (61), Expect = 5.7 Identities = 20/57 (35%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = +2 Query: 434 KKKXXRTGGKXFFXXGDPXXXPSKGXGGGXXX-SGGGGFTXXXGGGGGXXXKXGXXG 601 K+ R GG+ F G G GGG GGGG+ GGGG G G Sbjct: 552 KRSGGRFGGRDFRREGSYSRGGGGGGGGGGSDYYGGGGY----GGGGYGGAPSGGYG 604 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPP 504 PPP PPPP PPPPP Sbjct: 25 PPP-----QPPPPPPPPPPPPP 41 >At3g49300.1 68416.m05388 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 86 Score = 28.7 bits (61), Expect = 5.7 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPP 535 P P + PPPPP PPP Sbjct: 62 PTKPGYGFPPPPPPPLSPPPPP 83 Score = 27.9 bits (59), Expect = 9.9 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -3 Query: 542 PPPPXXXXPPPPP 504 PPPP PPPPP Sbjct: 71 PPPPPPLSPPPPP 83 >At3g13225.1 68416.m01660 WW domain-containing protein contains Pfam profile PF00397: WW domain Length = 863 Score = 28.7 bits (61), Expect = 5.7 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXPFD 499 PPPP + PPP PP P D Sbjct: 508 PPPPGEEWIPPPPSESEDVPPPPPD 532 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPPPXXXXPPPXP 505 P P PPPP PPPP P P Sbjct: 508 PPPPGEEWIPPPPSESEDVPPPPPDSYSEPIP 539 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 Query: 497 PSKGXGGGXXXSGGGGFTXXXGGGGG 574 P+K G G +GGGG G GGG Sbjct: 252 PAKNGGKGAPAAGGGGAGGGKGAGGG 277 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +1 Query: 478 GGPPXXXVKGGGGGXXXXGG--GGFYXXXXGG 567 GG P KG GGG GG GGF GG Sbjct: 307 GGGPNAGKKGNGGGGPMAGGVSGGFRPMGGGG 338 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +2 Query: 455 GGKXFFXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 GG + G G GG GGG GGGGG G G Sbjct: 51 GGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHG 99 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/53 (32%), Positives = 20/53 (37%) Frame = -3 Query: 566 PPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PP + PP PPPL+ PP P S PL L + P P Sbjct: 40 PPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPP---PSSSPLSSLSPSLSPSP 89 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 4/36 (11%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXV----KPPPPXXXXPPPXP 505 P P PPP P +PPPP PPP P Sbjct: 149 PESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPP 184 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 28.7 bits (61), Expect = 5.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 PPPPP P P PPP P Sbjct: 222 PPPPPPPSQPLPRPLLLPPPPPP 244 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/53 (28%), Positives = 17/53 (32%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPP 411 P P NP P PP PP + PP P+ G PP Sbjct: 138 PSPNVGPTNPESPPLQSPPAPPASDPTNSPPASPLDPTNPPPIQPSGPATSPP 190 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXGGPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP + PP P PPP T P + P + P +N PPP Sbjct: 78 PPPPS---DSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPP--NESNDNNPPP 126 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGG 574 G GGG GGGG G GGG Sbjct: 77 GGGGGGLGGGGGGLLGGGGFGGG 99 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGGG GGG G G G Sbjct: 75 GLGGGGGGLGGGGGGLLGGGGFGGGAGGGLGG 106 >At5g65410.1 68418.m08226 zinc finger homeobox family protein / ZF-HD homeobox family protein similar to hypothetical proteins (GP|4220524)(GP|3184285|)(Arabidopsis); ZP-HD homeobox family protein GP|13374061 (Flaveria bidentis);GP:5091602 {Oryza sativa} Length = 279 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPP 511 PPPPP + P P PPP Sbjct: 137 PPPPPPGFYRLPAPVSYRPPP 157 >At5g64430.1 68418.m08093 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 513 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPP 514 PPPPP VK P P PP Sbjct: 206 PPPPPPAEVKLPVPVALEPP 225 >At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family protein similar to SP|P42925 22 kDa peroxisomal membrane protein {Mus musculus}; contains Pfam profile PF04117: Mpv17 / PMP22 family Length = 288 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 500 SKGXGGGXXXSGGGGFTXXXGGGGGXXXK 586 + G GG SGGGG GGG G K Sbjct: 80 NSGGSGGLGGSGGGGGGSGGGGGDGSDGK 108 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/31 (41%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPP-PPPLTXXXGGP 480 PPP +PPPP PPP + GGP Sbjct: 47 PPPPPSNPSPPPPSPTTTACPPPPSSSGGGP 77 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = -3 Query: 542 PPPPXXXXPPPP-PLTXXXGGPPXKKXXFP 456 PPPP PPPP P T PP P Sbjct: 48 PPPPSNPSPPPPSPTTTACPPPPSSSGGGP 77 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 1/24 (4%) Frame = -2 Query: 573 PPPPPXXXVKPPP-PXXXXPPPXP 505 PPPPP PPP P PP P Sbjct: 47 PPPPPSNPSPPPPSPTTTACPPPP 70 >At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 300 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -3 Query: 542 PPPPXXXXPPPPPLTXXXGGPP 477 PPPP PPPP T PP Sbjct: 28 PPPPPPQSQPPPPQTQQQTYPP 49 >At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) similar to RNA helicases GI:3775995, GI:3775987 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 610 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +2 Query: 500 SKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXGXKKS 613 S G GG G GG + GGGGG G + S Sbjct: 526 SSGRSGGGSYGGYGGSSGRSGGGGGSYGGSGGSSSRYS 563 >At3g08630.1 68416.m01002 expressed protein Length = 339 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 497 PSKGXGGGXXXSGGGGFTXXXGGGGG 574 P G GGG GG + GGGGG Sbjct: 58 PCAGGGGGGSIGNHGGGSGSGGGGGG 83 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 2/25 (8%) Frame = -2 Query: 573 PPPPPXXXVKPPP--PXXXXPPPXP 505 PPPPP P P P PPP P Sbjct: 54 PPPPPLPDFAPQPLLPPPSPPPPPP 78 >At2g23770.1 68415.m02839 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein contains Pfam domains, PF00069: Protein kinase domain and PF01476: LysM domain Length = 612 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 570 PPPPXXXVKPPPPXXXXPPPXPFDG 496 PPPP PPPP PPP DG Sbjct: 245 PPPP-----PPPPQSVSPPPLSPDG 264 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGG + GG GG G G Sbjct: 97 GGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGG 128 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +2 Query: 455 GGKXFFXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGG 574 GG + G G GGG GGGG GGGGG Sbjct: 99 GGGHYGGGGGHYGGGGGGHGGGGHYGGGGG---GYGGGGG 135 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGG GGG + GG GG G G Sbjct: 83 GGGGGHYGGGGGHYGGGGGGYGGGGGHHGGGG 114 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 518 GXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 G GGGG+ GGGGG G G Sbjct: 186 GNAVGGGGGYGSNFGGGGGYGVAGGVGG 213 >At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 135 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLT 498 PPP PPPP PPP P+T Sbjct: 38 PPPPP----PPPPLSLSPPPSPIT 57 >At1g61750.1 68414.m06964 expressed protein contains Pfam profile: PF01657 domain of unknown function Length = 352 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -2 Query: 585 FXXXPPPPPXXXVKPPPP 532 F PPPPP PPPP Sbjct: 244 FLAPPPPPPPPPPPPPPP 261 Score = 27.9 bits (59), Expect = 9.9 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -3 Query: 542 PPPPXXXXPPPPP 504 PPPP PPPPP Sbjct: 247 PPPPPPPPPPPPP 259 Score = 27.9 bits (59), Expect = 9.9 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -3 Query: 542 PPPPXXXXPPPPP 504 PPPP PPPPP Sbjct: 248 PPPPPPPPPPPPP 260 Score = 27.9 bits (59), Expect = 9.9 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -3 Query: 542 PPPPXXXXPPPPP 504 PPPP PPPPP Sbjct: 249 PPPPPPPPPPPPP 261 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 27.9 bits (59), Expect = 9.9 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -3 Query: 542 PPPPXXXXPPPPP 504 PPPP PPPPP Sbjct: 266 PPPPSSPPPPPPP 278 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/35 (40%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = -2 Query: 591 PXFXXXPP-PPPXXXVKPP---PPXXXXPPPXPFD 499 P F PP PPP PP PP PP P++ Sbjct: 47 PKFPYSPPKPPPIEKYPPPVQYPPPIKKYPPPPYE 81 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/51 (33%), Positives = 19/51 (37%) Frame = +2 Query: 449 RTGGKXFFXXGDPXXXPSKGXGGGXXXSGGGGFTXXXGGGGGXXXKXGXXG 601 + GGK G P G GGG + GGG GG G G G Sbjct: 343 KNGGKG--GGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGG 391 >At4g18020.3 68417.m02683 pseudo-response regulator 2 (APRR2) (TOC2) identical to pseudo-response regulator 2 GI:7576356 from [Arabidopsis thaliana] Length = 487 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/34 (38%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = -2 Query: 573 PP--PPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PP PPP + PPP PP G G P Sbjct: 406 PPLWPPPLQSIGQPPPWHWKPPYPTVSGNAWGCP 439 >At4g18020.2 68417.m02682 pseudo-response regulator 2 (APRR2) (TOC2) identical to pseudo-response regulator 2 GI:7576356 from [Arabidopsis thaliana] Length = 535 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/34 (38%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = -2 Query: 573 PP--PPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PP PPP + PPP PP G G P Sbjct: 406 PPLWPPPLQSIGQPPPWHWKPPYPTVSGNAWGCP 439 >At4g18020.1 68417.m02681 pseudo-response regulator 2 (APRR2) (TOC2) identical to pseudo-response regulator 2 GI:7576356 from [Arabidopsis thaliana] Length = 535 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/34 (38%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = -2 Query: 573 PP--PPPXXXVKPPPPXXXXPPPXPFDGXXXGSP 478 PP PPP + PPP PP G G P Sbjct: 406 PPLWPPPLQSIGQPPPWHWKPPYPTVSGNAWGCP 439 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 27.9 bits (59), Expect = 9.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 545 NPPPPXXXXPPPPPLT 498 +PPPP PPPP +T Sbjct: 119 SPPPPPPPPPPPPTIT 134 Score = 27.9 bits (59), Expect = 9.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 545 NPPPPXXXXPPPPPLT 498 +PPPP PPPP +T Sbjct: 150 SPPPPPPPPPPPPTIT 165 >At3g50650.1 68416.m05540 scarecrow-like transcription factor 7 (SCL7) Length = 542 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/24 (45%), Positives = 12/24 (50%), Gaps = 1/24 (4%) Frame = -2 Query: 573 PPPPPXXXV-KPPPPXXXXPPPXP 505 PPPP + P PP PPP P Sbjct: 143 PPPPASTAIWSPSPPSPQHPPPPP 166 >At3g26400.1 68416.m03292 eukaryotic translation initiation factor 4B, putative/ eIF-4B, putative similar to eukaryotic initiation factor 4B [Arabidopsis thaliana] GI:6739518 Length = 532 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGG 574 G GGG GG GF GGGGG Sbjct: 194 GDGGGFG-GGGSGFGGGGGGGGG 215 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 573 PPPPPXXXVKPPPPXXXXPPPXP 505 P PP VKPP P PP P Sbjct: 36 PHKPPKHPVKPPKPPAVKPPKPP 58 >At3g15400.1 68416.m01954 anther development protein, putative similar to anther development protein ATA20 GB:AAC50042 GI:2708813 from [Arabidopsis thaliana] Length = 416 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGG 574 G G G SGG GF G GGG Sbjct: 255 GFGEGIGSSGGSGFGEGIGSGGG 277 >At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ boundaries domain protein 18 (LBD18) identical to LOB DOMAIN 18 [Arabidopsis thaliana] GI:17227164; supported by full-length cDNA gi:17227163 Length = 262 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 478 GGPPXXXVKGGGGGXXXXGGGGFYXXXXGGGXXP 579 GG V GGGGG G G GGG P Sbjct: 4 GGNTITAVGGGGGGCGGGGSSGGGGSSGGGGGGP 37 >At2g39750.1 68415.m04881 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 694 Score = 27.9 bits (59), Expect = 9.9 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -3 Query: 542 PPPPXXXXPPPPP 504 PPPP PPPPP Sbjct: 109 PPPPPSPSPPPPP 121 >At2g39250.1 68415.m04820 AP2 domain-containing transcription factor, putative AP2_ARATH Floral homeotic protein APETALA2.(SP:P47927){Arabidopsis thaliana} Length = 222 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -3 Query: 539 PPPXXXXPPPPPLTXXXGGP 480 PPP PPPPP GP Sbjct: 55 PPPPPPPPPPPPSENELSGP 74 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/40 (35%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -1 Query: 565 PPXXXXKTPPP-RXXXPPPXPL*RXXXGVPPXKKXFSPXP 449 PP ++PPP R P P R PP ++ SP P Sbjct: 355 PPARRHRSPPPARRRRSPSPPARRRRSPSPPARRRRSPSP 394 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 506 GXGGGXXXSGGGGFTXXXGGGGGXXXKXG 592 G GGG GGGG GGG G G Sbjct: 786 GCGGGHHGGGGGGCGGCGGGGCGGGGDGG 814 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 505 GGGGGXXXXGGGGFYXXXXGGG 570 GGGGG GGGG GGG Sbjct: 794 GGGGGCGGCGGGGCGGGGDGGG 815 >At1g12810.1 68414.m01488 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 129 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = -2 Query: 591 PXFXXXPPPPPXXXVKPPPPXXXXPPPXPFDG 496 P + PPPP PP PPP P+ G Sbjct: 23 PGYPSAPPPPGYP--SPPSHHEGYPPPQPYGG 52 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/34 (38%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = -2 Query: 600 PXXPXFXXXPPPPPXXXVKPPP--PXXXXPPPXP 505 P P PPP +PPP P PPP P Sbjct: 49 PSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTP 82 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/58 (29%), Positives = 20/58 (34%), Gaps = 4/58 (6%) Frame = -3 Query: 569 PPPXXXX*NPPPPXXXXPPPPPLTXXXG----GPPXKKXXFPXSXPLFFLGKNNXPPP 408 PPP PPP PPP +T PP + S + K PPP Sbjct: 68 PPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPP 125 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.317 0.151 0.481 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,574,215 Number of Sequences: 28952 Number of extensions: 292198 Number of successful extensions: 15062 Number of sequences better than 10.0: 181 Number of HSP's better than 10.0 without gapping: 804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7011 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2168774904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -