BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_N24 (898 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 24 5.5 AY146759-1|AAO12074.1| 356|Anopheles gambiae odorant-binding pr... 24 7.2 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 24.2 bits (50), Expect = 5.5 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 354 GNVCSANLGQAPARQAVIFAGLPKSTICTT 443 GN SAN+ A +Q++I AG + I T Sbjct: 67 GNAASANVAVADRQQSLILAGGRRQRIMWT 96 >AY146759-1|AAO12074.1| 356|Anopheles gambiae odorant-binding protein AgamOBP45 protein. Length = 356 Score = 23.8 bits (49), Expect = 7.2 Identities = 10/31 (32%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = -3 Query: 248 SERTHRSSNC*-CNYYFVEGNFGRECCHCCK 159 +E ++ NC C F+ N CC C K Sbjct: 316 TEFNYKELNCQNCGRLFISNNGRVSCCRCMK 346 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 816,135 Number of Sequences: 2352 Number of extensions: 16868 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 96747534 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -