BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_N19 (1127 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 24 2.4 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 22 9.8 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 23.8 bits (49), Expect = 2.4 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = +3 Query: 708 PPAPXSXLSPXSXPXPPXSXXXPPXPPSTSXXTKPXSXLS 827 PPAP S +P S P PP+T+ P S S Sbjct: 12 PPAPQSAATPISSSGMTSPAAAP--PPATTSSGSPASVAS 49 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.8 bits (44), Expect = 9.8 Identities = 13/44 (29%), Positives = 16/44 (36%) Frame = +3 Query: 663 PRXRSXXPRVPXTXXPPAPXSXLSPXSXPXPPXSXXXPPXPPST 794 P+ S P P PP +P S P P S P+T Sbjct: 273 PKSASLSPP-PHVYNPPDHIQQATPYSAPGPTYSTWSTVQTPTT 315 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,327 Number of Sequences: 336 Number of extensions: 1557 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 58 effective length of database: 103,097 effective search space used: 32681749 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -